Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_16.4033.496ON20320310781e-151
YPR151C (SUE1)3.496ON2062049391e-130
Suva_16.4793.496ON2122129361e-130
Skud_16.4453.496ON2152018671e-119
TPHA0D033003.496ON1961404427e-55
SAKL0F02618g3.496ON2531404372e-53
Kpol_1017.43.496ON1841434261e-52
KNAG0A079603.496ON1771524033e-49
ZYRO0D09812g3.496ON1851433633e-43
NDAI0B058903.496ON2781393714e-43
Kwal_55.212483.496ON2221503655e-43
KLTH0F14938g3.496ON2291583595e-42
KLLA0E03983g3.496ON1911413496e-41
TDEL0D056403.496ON1241512341e-24
CAGL0L08426g3.496ON1401432301e-23
NCAS0F035703.496ON2301492212e-21
TBLA0D029403.496ON71461664e-15
Ecym_12333.496ON87441632e-14
NCAS0C013108.682ON2571941573e-12
ZYRO0F07480g8.682ON2361521546e-12
KAFR0G037103.496ON79391449e-12
YPL159C (PET20)8.682ON2531671512e-11
Suva_16.1518.682ON2531711494e-11
KNAG0J017608.682ON2581401494e-11
Skud_16.1238.682ON2551671485e-11
TDEL0A062708.682ON2421631478e-11
TPHA0D012908.682ON2181541442e-10
Smik_6.3568.682ON2531391432e-10
AFR315C3.496ON77411273e-09
KLLA0D06061g8.682ON2491521353e-09
SAKL0H06380g8.682ON2191411292e-08
Kpol_1013.98.682ON2611391274e-08
TPHA0G015708.682ON2551401222e-07
KLTH0D11396g8.682ON2251391185e-07
NDAI0K013208.682ON2581391186e-07
Kpol_1072.128.682ON2221591169e-07
Kwal_26.88288.682ON22373964e-04
KAFR0H023808.682ON220145940.001
Ecym_23908.682ON227152940.001
TDEL0E007103.62ON476149940.001
TBLA0B038008.682ON32431930.002
Kpol_1066.443.62ON479137930.002
ZYRO0C02244g3.62ON460151920.002
CAGL0M02101g8.682ON267176880.005
KLLA0A07447g3.62ON486155840.022
Skud_14.423.62ON524191840.023
NDAI0A061103.62ON490150820.047
SAKL0C12342g3.62ON552153780.14
TPHA0P012603.62ON494138780.14
Kpol_529.138.425ON1410110760.24
NCAS0A099403.62ON49428750.36
Suva_14.443.62ON525156710.97
Smik_14.363.62ON524155711.1
YNL295W3.62ON524155691.6
TBLA0B027208.798ON50233691.8
CAGL0D05874g5.221ON60955664.0
TDEL0E040805.221ON58956664.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_16.403
         (203 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_16.403 Chr16 complement(702998..703609) [612 bp, 203 aa] {O...   419   e-151
YPR151C Chr16 complement(831055..831675) [621 bp, 206 aa] {ON}  ...   366   e-130
Suva_16.479 Chr16 complement(827450..828088) [639 bp, 212 aa] {O...   365   e-130
Skud_16.445 Chr16 complement(784636..785283) [648 bp, 215 aa] {O...   338   e-119
TPHA0D03300 Chr4 complement(678395..678985) [591 bp, 196 aa] {ON...   174   7e-55
SAKL0F02618g Chr6 (225795..226556) [762 bp, 253 aa] {ON} similar...   172   2e-53
Kpol_1017.4 s1017 (17411..17965) [555 bp, 184 aa] {ON} (17411..1...   168   1e-52
KNAG0A07960 Chr1 complement(1270134..1270667) [534 bp, 177 aa] {...   159   3e-49
ZYRO0D09812g Chr4 (833123..833680) [558 bp, 185 aa] {ON} similar...   144   3e-43
NDAI0B05890 Chr2 complement(1423733..1424569) [837 bp, 278 aa] {...   147   4e-43
Kwal_55.21248 s55 complement(748370..749038) [669 bp, 222 aa] {O...   145   5e-43
KLTH0F14938g Chr6 complement(1220898..1221587) [690 bp, 229 aa] ...   142   5e-42
KLLA0E03983g Chr5 (363400..363975) [576 bp, 191 aa] {ON} similar...   139   6e-41
TDEL0D05640 Chr4 complement(1013767..1014141) [375 bp, 124 aa] {...    95   1e-24
CAGL0L08426g Chr12 (926880..927302) [423 bp, 140 aa] {ON} simila...    93   1e-23
NCAS0F03570 Chr6 complement(711238..711930) [693 bp, 230 aa] {ON...    90   2e-21
TBLA0D02940 Chr4 (720446..720661) [216 bp, 71 aa] {ON} Anc_3.496...    69   4e-15
Ecym_1233 Chr1 (481548..481811) [264 bp, 87 aa] {ON} similar to ...    67   2e-14
NCAS0C01310 Chr3 complement(241103..241876) [774 bp, 257 aa] {ON...    65   3e-12
ZYRO0F07480g Chr6 (607194..607904) [711 bp, 236 aa] {ON} similar...    64   6e-12
KAFR0G03710 Chr7 complement(764660..764899) [240 bp, 79 aa] {ON}...    60   9e-12
YPL159C Chr16 complement(250907..251668) [762 bp, 253 aa] {ON}  ...    63   2e-11
Suva_16.151 Chr16 complement(260210..260971) [762 bp, 253 aa] {O...    62   4e-11
KNAG0J01760 Chr10 (320758..321534) [777 bp, 258 aa] {ON} Anc_8.6...    62   4e-11
Skud_16.123 Chr16 complement(222359..223126) [768 bp, 255 aa] {O...    62   5e-11
TDEL0A06270 Chr1 (1098704..1099432) [729 bp, 242 aa] {ON} Anc_8....    61   8e-11
TPHA0D01290 Chr4 (268062..268718) [657 bp, 218 aa] {ON} Anc_8.68...    60   2e-10
Smik_6.356 Chr6 (572523..573284) [762 bp, 253 aa] {ON} YPL159C (...    60   2e-10
AFR315C Chr6 complement(1006937..1007170) [234 bp, 77 aa] {ON} S...    54   3e-09
KLLA0D06061g Chr4 (520082..520831) [750 bp, 249 aa] {ON} weakly ...    57   3e-09
SAKL0H06380g Chr8 complement(563753..564412) [660 bp, 219 aa] {O...    54   2e-08
Kpol_1013.9 s1013 (15300..16085) [786 bp, 261 aa] {ON} (15300..1...    54   4e-08
TPHA0G01570 Chr7 complement(319949..320716) [768 bp, 255 aa] {ON...    52   2e-07
KLTH0D11396g Chr4 (931339..932016) [678 bp, 225 aa] {ON} similar...    50   5e-07
NDAI0K01320 Chr11 complement(297117..297893) [777 bp, 258 aa] {O...    50   6e-07
Kpol_1072.12 s1072 complement(24362..25030) [669 bp, 222 aa] {ON...    49   9e-07
Kwal_26.8828 s26 (960466..961137) [672 bp, 223 aa] {ON} YPL159C ...    42   4e-04
KAFR0H02380 Chr8 complement(455996..456658) [663 bp, 220 aa] {ON...    41   0.001
Ecym_2390 Chr2 complement(757433..758116) [684 bp, 227 aa] {ON} ...    41   0.001
TDEL0E00710 Chr5 (152143..153573) [1431 bp, 476 aa] {ON} Anc_3.6...    41   0.001
TBLA0B03800 Chr2 complement(873861..874835) [975 bp, 324 aa] {ON...    40   0.002
Kpol_1066.44 s1066 complement(74670..76109) [1440 bp, 479 aa] {O...    40   0.002
ZYRO0C02244g Chr3 complement(174640..176022) [1383 bp, 460 aa] {...    40   0.002
CAGL0M02101g Chr13 complement(254024..254827) [804 bp, 267 aa] {...    39   0.005
KLLA0A07447g Chr1 (669272..670732) [1461 bp, 486 aa] {ON} simila...    37   0.022
Skud_14.42 Chr14 (70507..72081) [1575 bp, 524 aa] {ON} YNL295W (...    37   0.023
NDAI0A06110 Chr1 complement(1384706..1386178) [1473 bp, 490 aa] ...    36   0.047
SAKL0C12342g Chr3 complement(1099949..1101607) [1659 bp, 552 aa]...    35   0.14 
TPHA0P01260 Chr16 complement(252274..253758) [1485 bp, 494 aa] {...    35   0.14 
Kpol_529.13 s529 complement(28325..32557) [4233 bp, 1410 aa] {ON...    34   0.24 
NCAS0A09940 Chr1 complement(1986687..1988171) [1485 bp, 494 aa] ...    33   0.36 
Suva_14.44 Chr14 (73757..75334) [1578 bp, 525 aa] {ON} YNL295W (...    32   0.97 
Smik_14.36 Chr14 (61288..62862) [1575 bp, 524 aa] {ON} YNL295W (...    32   1.1  
YNL295W Chr14 (76946..78520) [1575 bp, 524 aa] {ON} Putative pro...    31   1.6  
TBLA0B02720 Chr2 (626800..628308) [1509 bp, 502 aa] {ON} Anc_8.7...    31   1.8  
CAGL0D05874g Chr4 (557894..559723) [1830 bp, 609 aa] {ON} simila...    30   4.0  
TDEL0E04080 Chr5 complement(759841..761610) [1770 bp, 589 aa] {O...    30   4.4  

>Smik_16.403 Chr16 complement(702998..703609) [612 bp, 203 aa] {ON}
           YPR151C (REAL)
          Length = 203

 Score =  419 bits (1078), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 203/203 (100%), Positives = 203/203 (100%)

Query: 1   MILLTRTKIKGVSFASIQRRTHSRLVNPIRQQHQQITKQRSSKIFKNVHFYDFRSLPKVP 60
           MILLTRTKIKGVSFASIQRRTHSRLVNPIRQQHQQITKQRSSKIFKNVHFYDFRSLPKVP
Sbjct: 1   MILLTRTKIKGVSFASIQRRTHSRLVNPIRQQHQQITKQRSSKIFKNVHFYDFRSLPKVP 60

Query: 61  TTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQMLLTADEAPITEAKTTEKS 120
           TTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQMLLTADEAPITEAKTTEKS
Sbjct: 61  TTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQMLLTADEAPITEAKTTEKS 120

Query: 121 KHKNILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEYFPEWRNIPSYM 180
           KHKNILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEYFPEWRNIPSYM
Sbjct: 121 KHKNILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEYFPEWRNIPSYM 180

Query: 181 TRKLKPFDKPLQIQLKHKSKKKE 203
           TRKLKPFDKPLQIQLKHKSKKKE
Sbjct: 181 TRKLKPFDKPLQIQLKHKSKKKE 203

>YPR151C Chr16 complement(831055..831675) [621 bp, 206 aa] {ON}
           SUE1Mitochondrial protein required for degradation of
           unstable forms of cytochrome c
          Length = 206

 Score =  366 bits (939), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 176/204 (86%), Positives = 186/204 (91%), Gaps = 2/204 (0%)

Query: 1   MILLTRTKIKGVS--FASIQRRTHSRLVNPIRQQHQQITKQRSSKIFKNVHFYDFRSLPK 58
           MILL RTKI+GVS  F S+QRRTHSRLVNPIRQQHQQITKQRSSKI KN HFYDFRSLPK
Sbjct: 1   MILLKRTKIRGVSVSFVSLQRRTHSRLVNPIRQQHQQITKQRSSKILKNAHFYDFRSLPK 60

Query: 59  VPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQMLLTADEAPITEAKTTE 118
           VPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKK+KSLQ LLT +E    EAKT +
Sbjct: 61  VPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKRKSLQTLLTMNEKTNAEAKTID 120

Query: 119 KSKHKNILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEYFPEWRNIPS 178
           + KHKNILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEYFPEW+N+P 
Sbjct: 121 EKKHKNILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEYFPEWKNVPP 180

Query: 179 YMTRKLKPFDKPLQIQLKHKSKKK 202
           YM RKLKPFDK LQ++L HKSKKK
Sbjct: 181 YMMRKLKPFDKALQMRLTHKSKKK 204

>Suva_16.479 Chr16 complement(827450..828088) [639 bp, 212 aa] {ON}
           YPR151C (REAL)
          Length = 212

 Score =  365 bits (936), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 170/212 (80%), Positives = 190/212 (89%), Gaps = 9/212 (4%)

Query: 1   MILLTRTKIKGVS---------FASIQRRTHSRLVNPIRQQHQQITKQRSSKIFKNVHFY 51
           MILL +T+I+G+S         FAS+QRRT +RLVNP+RQQHQQI+KQR+SK+FKN HF+
Sbjct: 1   MILLRKTEIRGLSSARVRSTMIFASVQRRTLTRLVNPVRQQHQQISKQRNSKLFKNAHFF 60

Query: 52  DFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQMLLTADEAPI 111
           DFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQMLL +DE P 
Sbjct: 61  DFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQMLLASDEKPA 120

Query: 112 TEAKTTEKSKHKNILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEYFP 171
           TEAK TEKS+HKN+ FGERGTGGIMSGGVNGTWKYNPTVPNELLP+NWWSTSSMGMEYFP
Sbjct: 121 TEAKATEKSEHKNVFFGERGTGGIMSGGVNGTWKYNPTVPNELLPYNWWSTSSMGMEYFP 180

Query: 172 EWRNIPSYMTRKLKPFDKPLQIQLKHKSKKKE 203
           EW+N+PSYM RKLKPFD+ LQ+Q KH S KK+
Sbjct: 181 EWKNVPSYMMRKLKPFDRALQLQAKHSSNKKK 212

>Skud_16.445 Chr16 complement(784636..785283) [648 bp, 215 aa] {ON}
           YPR151C (REAL)
          Length = 215

 Score =  338 bits (867), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 170/201 (84%), Positives = 178/201 (88%), Gaps = 9/201 (4%)

Query: 1   MILLTRTKIKGVSF---------ASIQRRTHSRLVNPIRQQHQQITKQRSSKIFKNVHFY 51
           MILL +TKI+G+ F         A IQRRTH+RLVNPIRQQHQQITKQRSSKIFKNVHFY
Sbjct: 1   MILLRKTKIRGLPFTRIRSSVTLARIQRRTHTRLVNPIRQQHQQITKQRSSKIFKNVHFY 60

Query: 52  DFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQMLLTADEAPI 111
           DFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKK+ SLQMLL  DEAP 
Sbjct: 61  DFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKRDSLQMLLAPDEAPA 120

Query: 112 TEAKTTEKSKHKNILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEYFP 171
            EAK TEK  HKN+LFGERGTGGI SGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEYFP
Sbjct: 121 AEAKATEKDMHKNVLFGERGTGGISSGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEYFP 180

Query: 172 EWRNIPSYMTRKLKPFDKPLQ 192
           EW+N+PSYM RKLKPFDK LQ
Sbjct: 181 EWKNVPSYMMRKLKPFDKSLQ 201

>TPHA0D03300 Chr4 complement(678395..678985) [591 bp, 196 aa] {ON}
           Anc_3.496 YPR151C
          Length = 196

 Score =  174 bits (442), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 83/140 (59%), Positives = 102/140 (72%), Gaps = 7/140 (5%)

Query: 53  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQMLLTAD----E 108
           F++LP+VPTT+YLE+ +LT DIL+SGYRP+ YPVKENPLFR+  K +   L T +     
Sbjct: 51  FKNLPRVPTTRYLESTKLTNDILFSGYRPITYPVKENPLFRNINKYNNDFLSTQETQEKN 110

Query: 109 APITEAKTTEKSKHKNILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSSMGME 168
            P+   K  E      +L GE+GTGGIMSGGVNGTWKYNPTVP  LLP+NWWSTS MGME
Sbjct: 111 NPVLPQKNHEAFS---VLTGEKGTGGIMSGGVNGTWKYNPTVPENLLPYNWWSTSIMGME 167

Query: 169 YFPEWRNIPSYMTRKLKPFD 188
           Y+PEW N+P    + LKPF+
Sbjct: 168 YYPEWNNVPRRFLKTLKPFE 187

>SAKL0F02618g Chr6 (225795..226556) [762 bp, 253 aa] {ON} similar to
           uniprot|Q06524 Saccharomyces cerevisiae YPR151C SUE1
           Mitochondrial protein required for degradation of
           unstable forms of cytochrome c
          Length = 253

 Score =  172 bits (437), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 82/140 (58%), Positives = 104/140 (74%), Gaps = 1/140 (0%)

Query: 53  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFR-DKKKKSLQMLLTADEAPI 111
           FR LPKVPTTQ+LE RELTRDIL+SGYRPV YPVKENP F    ++K L    +A +   
Sbjct: 23  FRLLPKVPTTQFLEPRELTRDILFSGYRPVTYPVKENPFFNIGTQRKGLAGETSAKKEYK 82

Query: 112 TEAKTTEKSKHKNILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEYFP 171
            EA+   + +  N++ G RGTGGI+SGGVNGTW+YNP +P +LLP+N WS+S+M MEY+P
Sbjct: 83  NEAERENEKEEHNVMAGPRGTGGIVSGGVNGTWRYNPRIPTKLLPYNLWSSSTMAMEYYP 142

Query: 172 EWRNIPSYMTRKLKPFDKPL 191
           EW N+P  +  KLKPFD P+
Sbjct: 143 EWLNVPKTIANKLKPFDMPI 162

>Kpol_1017.4 s1017 (17411..17965) [555 bp, 184 aa] {ON}
           (17411..17965) [555 nt, 185 aa]
          Length = 184

 Score =  168 bits (426), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 82/143 (57%), Positives = 104/143 (72%), Gaps = 8/143 (5%)

Query: 53  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDK---KKKSLQMLLTA--- 106
           FRSLP+VPTTQ+LE+  LT DIL+SGYRP+ YPVKENPLFR+    K    Q L+ A   
Sbjct: 36  FRSLPRVPTTQFLESTTLTNDILFSGYRPITYPVKENPLFRNTGNTKNIFGQDLVNAESN 95

Query: 107 --DEAPITEAKTTEKSKHKNILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSS 164
             D + + E      S+  N L G+RGTGGI SGGVNGTW++NP VP++LLP++WWSTS 
Sbjct: 96  SNDASLLQEHDKNITSQEFNTLSGDRGTGGIKSGGVNGTWRFNPRVPSKLLPYSWWSTSI 155

Query: 165 MGMEYFPEWRNIPSYMTRKLKPF 187
           MGMEY+PEW+NIP  + + LKP+
Sbjct: 156 MGMEYYPEWKNIPRKVVKDLKPY 178

>KNAG0A07960 Chr1 complement(1270134..1270667) [534 bp, 177 aa] {ON}
           Anc_3.496 YPR151C
          Length = 177

 Score =  159 bits (403), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 100/152 (65%), Gaps = 13/152 (8%)

Query: 53  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQMLLTADEAPIT 112
           FR LPKVP T+YLE REL +DILYSGYRPVMYPV+ENPLFR+  K      L A   P  
Sbjct: 32  FRRLPKVPMTKYLETRELAKDILYSGYRPVMYPVRENPLFRNSNK------LMAISHPEH 85

Query: 113 EAKTTEKSKHKNI------LFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSSMG 166
           + + TE + H++       LFG    GGI + G NGTWKY P +P ++LPFNWWS SS+ 
Sbjct: 86  DTEGTEGT-HRDSQTVNTELFGNNNCGGINTLGCNGTWKYAPKIPQKMLPFNWWSASSLA 144

Query: 167 MEYFPEWRNIPSYMTRKLKPFDKPLQIQLKHK 198
           ME +PEW ++P ++ + LKPFD  L ++   K
Sbjct: 145 MEVYPEWSSVPKHVVKGLKPFDLLLGVKATQK 176

>ZYRO0D09812g Chr4 (833123..833680) [558 bp, 185 aa] {ON} similar to
           gnl|GLV|CAGL0L08426g Candida glabrata CAGL0L08426g and
           weakly similar to YPR151C uniprot|Q06524 Saccharomyces
           cerevisiae YPR151C SUE1 Mitochondrial protein required
           for degradation of unstable forms of cytochrome c
          Length = 185

 Score =  144 bits (363), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 107/143 (74%), Gaps = 6/143 (4%)

Query: 53  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKS--LQMLLTADEAP 110
           FRS+P+VPTTQ+LE+RELTRDIL+SGYRPVMYPVKENPLF+++ +       L +   + 
Sbjct: 25  FRSMPRVPTTQFLESRELTRDILFSGYRPVMYPVKENPLFKERTRNGELTDELQSRHNSG 84

Query: 111 ITEAKTTEKSKHK----NILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSSMG 166
           + + +T E+ K      +++ G RG GGI SGG +GTW+    +P++LLP++WWST+SMG
Sbjct: 85  LRQGRTQEEEKESGEEYSVIAGPRGCGGIASGGASGTWRNGAKMPSKLLPYSWWSTTSMG 144

Query: 167 MEYFPEWRNIPSYMTRKLKPFDK 189
           ME+FPEW  +P ++ RKLKPFD+
Sbjct: 145 MEFFPEWEGVPRHVVRKLKPFDR 167

>NDAI0B05890 Chr2 complement(1423733..1424569) [837 bp, 278 aa] {ON}
           Anc_3.496 YPR151C
          Length = 278

 Score =  147 bits (371), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 73/139 (52%), Positives = 97/139 (69%), Gaps = 4/139 (2%)

Query: 53  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRD--KKKKSLQMLLTADEAP 110
           FR++PKVP T+YLE +EL++D+LYSGYRP+MYPVKENPLFR   KK  S     +   + 
Sbjct: 129 FRTMPKVPMTKYLETKELSQDMLYSGYRPIMYPVKENPLFRLTLKKNSSSSFPFSTTSSS 188

Query: 111 ITEAKTTEKSKHKNILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEYF 170
            +E K  ++ + K     E   GGIM+GG+NGTW+Y+P +PN LLP   WS S MGMEY+
Sbjct: 189 SSEKKKPQQEQMKKHYDDE--YGGIMTGGINGTWRYSPRIPNNLLPNKIWSMSIMGMEYY 246

Query: 171 PEWRNIPSYMTRKLKPFDK 189
           PEW+ +P  + + LKPFDK
Sbjct: 247 PEWKGVPFNIVKNLKPFDK 265

>Kwal_55.21248 s55 complement(748370..749038) [669 bp, 222 aa] {ON}
           YPR151C - Hypothetical ORF [contig 130] FULL
          Length = 222

 Score =  145 bits (365), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 85/150 (56%), Positives = 107/150 (71%), Gaps = 3/150 (2%)

Query: 41  SSKIFKNVHFYDFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSL 100
           +SK+ K      FRSLPKVPTTQYLE  ELTRDILYSGYRPV+YPVKENPLF++   K+ 
Sbjct: 11  ASKMLKRRSSDIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPLFKETGWKTQ 70

Query: 101 QMLLTADEAPITEAKTTEKSKHKNILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWW 160
           ++    +E     A T  K   KN + G +GTGGI SGGVNGTW+YNP +P++LLPF+ W
Sbjct: 71  RL---REEPGSDTALTAAKESSKNAMAGPQGTGGIGSGGVNGTWRYNPRIPSKLLPFSLW 127

Query: 161 STSSMGMEYFPEWRNIPSYMTRKLKPFDKP 190
           S++SM MEY PEW  +P  +  KL+PF+ P
Sbjct: 128 SSTSMAMEYHPEWLAVPRTVVNKLRPFNSP 157

>KLTH0F14938g Chr6 complement(1220898..1221587) [690 bp, 229 aa]
           {ON} weakly similar to uniprot|Q06524 Saccharomyces
           cerevisiae YPR151C SUE1 Mitochondrial protein required
           for degradation of unstable forms of cytochrome c
          Length = 229

 Score =  142 bits (359), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 84/158 (53%), Positives = 108/158 (68%), Gaps = 3/158 (1%)

Query: 33  HQQITKQRSSKIFKNVHFYDFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLF 92
           H++     +SK+ K      FRSLPKVPTTQYLE  ELTRDILYSGYRPV+YPVKENPLF
Sbjct: 3   HKRQFSLEASKMLKRKSSEIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPLF 62

Query: 93  RDKKKKSLQMLLTADEAPITEAKTTEKSKHKNILFGERGTGGIMSGGVNGTWKYNPTVPN 152
           ++   K+ ++     E    ++ T  +S   N + G  GTGGI SGGVNGTW+YNP +P+
Sbjct: 63  KEAGWKTQRL---RGERGARKSSTVPQSSEMNAMAGPLGTGGIGSGGVNGTWRYNPRIPS 119

Query: 153 ELLPFNWWSTSSMGMEYFPEWRNIPSYMTRKLKPFDKP 190
           +LLP+N WS +SM MEY PEW  +P  +  KL+PF+ P
Sbjct: 120 KLLPYNLWSCTSMAMEYHPEWLAVPRTVVNKLRPFESP 157

>KLLA0E03983g Chr5 (363400..363975) [576 bp, 191 aa] {ON} similar to
           gnl|GLV|CAGL0L08426g Candida glabrata CAGL0L08426g and
           weakly similar to YPR151C uniprot|Q06524 Saccharomyces
           cerevisiae YPR151C SUE1 Mitochondrial protein required
           for degradation of unstable forms of cytochrome c
          Length = 191

 Score =  139 bits (349), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 66/141 (46%), Positives = 102/141 (72%), Gaps = 4/141 (2%)

Query: 53  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQMLLTADEAPIT 112
           +R LP+VPTT++L  +ELT DIL+SGYRP++ P+++NPLF+  K K L++    +     
Sbjct: 12  YRQLPRVPTTRFLAPQELTADILFSGYRPIVSPLRDNPLFQ-AKVKELEVEREKNGGGKL 70

Query: 113 EAKTTEKSKHKN-ILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEYFP 171
           ++K    S+ ++  + G  GTGGI+SGGVNGTW+YNP +PN+LL    WS+S+MGME++P
Sbjct: 71  KSKAAFASEPEHPFMAGPNGTGGILSGGVNGTWRYNPRIPNKLLQSALWSSSAMGMEFYP 130

Query: 172 EWRNIPSYMTRKLKPF--DKP 190
           EW ++P+ ++  LKP+  D+P
Sbjct: 131 EWNDVPNKVSASLKPYQLDQP 151

>TDEL0D05640 Chr4 complement(1013767..1014141) [375 bp, 124 aa] {ON}
           Anc_3.496 YPR151C
          Length = 124

 Score = 94.7 bits (234), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 55/151 (36%), Positives = 79/151 (52%), Gaps = 48/151 (31%)

Query: 41  SSKIFKNVHFYD--FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKK 98
           SS++++     D  FR+LP+VPTT++LE + L+ DIL+SGYRPVMYPV+ENPLF    K 
Sbjct: 17  SSRVWRRKSVTDDLFRTLPRVPTTRFLETQRLSSDILFSGYRPVMYPVRENPLFGRGTKT 76

Query: 99  SLQMLLTADEAPITEAKTTEKSKHKNILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFN 158
                    EAP                                      ++ + L  ++
Sbjct: 77  ---------EAPA-------------------------------------SLESNLPRYD 90

Query: 159 WWSTSSMGMEYFPEWRNIPSYMTRKLKPFDK 189
            WST++MG+E FPEW N+P  + RKL+PFD+
Sbjct: 91  LWSTTTMGLERFPEWSNVPREVVRKLRPFDR 121

>CAGL0L08426g Chr12 (926880..927302) [423 bp, 140 aa] {ON} similar
           to uniprot|Q06524 Saccharomyces cerevisiae YPR151c
          Length = 140

 Score = 93.2 bits (230), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 55/143 (38%), Positives = 78/143 (54%), Gaps = 25/143 (17%)

Query: 53  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKK-------SLQMLLT 105
           FR LPKVP T+YLE R L+ D+LY+GYRP++YP++ENPL      +       S   L  
Sbjct: 8   FRKLPKVPMTRYLENRLLSEDMLYNGYRPILYPMRENPLLCHSNVRETHYYGESSNELQK 67

Query: 106 ADEAPITEAKTTEKSKHKNILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSSM 165
            DE P+ E           +L+G  G GGI + GV      +P+     L     S S M
Sbjct: 68  KDEEPVNE-----------LLYGPEGRGGISTMGVRRMA--DPSKVKLGL-----SYSIM 109

Query: 166 GMEYFPEWRNIPSYMTRKLKPFD 188
           GMEY+PEW  +P  + +++KP++
Sbjct: 110 GMEYYPEWEKVPRDVVKRIKPYE 132

>NCAS0F03570 Chr6 complement(711238..711930) [693 bp, 230 aa] {ON}
           Anc_3.496 YPR151C
          Length = 230

 Score = 89.7 bits (221), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 52/149 (34%), Positives = 76/149 (51%), Gaps = 36/149 (24%)

Query: 53  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQMLLTADEAPIT 112
           FR LPKVP T+YLE ++L+++IL++GY+P+MYPV+ENPLF+ K K+        +E    
Sbjct: 118 FRKLPKVPMTRYLETKQLSKEILFAGYKPIMYPVRENPLFKLKIKQEDAKRENGNE---- 173

Query: 113 EAKTTEKSKHKNILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEYFPE 172
                           +R  G  +S    G                 WSTS +G++ +PE
Sbjct: 174 ----------------KRALGSSVSHKYKGI----------------WSTSILGLQDYPE 201

Query: 173 WRNIPSYMTRKLKPFDKPLQIQLKHKSKK 201
           W N+P    + LKPFD+ L      K+KK
Sbjct: 202 WNNVPWNNIKNLKPFDEELASITIKKNKK 230

>TBLA0D02940 Chr4 (720446..720661) [216 bp, 71 aa] {ON} Anc_3.496
          YPR151C
          Length = 71

 Score = 68.6 bits (166), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 36/46 (78%)

Query: 53 FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKK 98
           R LP+VPTT+YLE   L  DI +SGYRPVMYPVKENPLFR+ + K
Sbjct: 16 LRDLPRVPTTEYLENTRLYNDIFFSGYRPVMYPVKENPLFRNGELK 61

>Ecym_1233 Chr1 (481548..481811) [264 bp, 87 aa] {ON} similar to
          Ashbya gossypii AFR315C
          Length = 87

 Score = 67.4 bits (163), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 29/44 (65%), Positives = 34/44 (77%)

Query: 53 FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKK 96
           R LP+VPTTQYL   EL  DI +SGYRP++YPVK+NPLFR  K
Sbjct: 10 LRHLPRVPTTQYLSLEELRTDIFFSGYRPMVYPVKQNPLFRSSK 53

>NCAS0C01310 Chr3 complement(241103..241876) [774 bp, 257 aa] {ON}
           Anc_8.682
          Length = 257

 Score = 65.1 bits (157), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 57/194 (29%), Positives = 83/194 (42%), Gaps = 44/194 (22%)

Query: 5   TRTKIKGVSFASIQRRTHSRLVNPIRQQHQQITKQRSSKIFKNVHFYDFRSLPKVPTTQY 64
           T T +K  S A     T +++  PI   H Q  K+R          +D+ +LPKV     
Sbjct: 54  TNTNVKVKSIAKASDTTDTKV--PI---HIQRKKKR----------FDYSTLPKVEPITN 98

Query: 65  LEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQMLLTADEAPITEAKTTEKSKHKN 124
           L   E++ DILYSGYRP+         F+D +  S +    A+      +   E +   +
Sbjct: 99  LRHNEISTDILYSGYRPLFLN------FKDLENSSRK----AEFGNSNNSTLYEIAMKLD 148

Query: 125 ILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEYFPEWRNIPSYMTRKL 184
            L  E  +G   S                     W STS+ GME F EW N+P+ + + L
Sbjct: 149 DLSPEAISGSTSSNF-------------------WHSTSATGMEVFDEWDNVPNSILKNL 189

Query: 185 KPFDKPLQIQLKHK 198
           KPF  P++  L HK
Sbjct: 190 KPFQAPVKKNLTHK 203

>ZYRO0F07480g Chr6 (607194..607904) [711 bp, 236 aa] {ON} similar to
           uniprot|Q99373 Saccharomyces cerevisiae YPL159C PET20
           Protein required for respiratory growth and stability of
           the mitochondrial genome
          Length = 236

 Score = 63.9 bits (154), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 45/152 (29%), Positives = 68/152 (44%), Gaps = 42/152 (27%)

Query: 51  YDFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQMLLTADEAP 110
           YD+  LP+VP+T YL  R+++  ILYSGYRP                    + L  D   
Sbjct: 83  YDYSWLPRVPSTNYLRPRDMSSKILYSGYRP--------------------LFLNPD--- 119

Query: 111 ITEAKTTEKSKHKNILFGERGTGGIMSGGVNGTWKYNPTVP-NELLPFNWWSTSSMGMEY 169
             E KT++   + N                NG   Y   +   EL   + W++S+ G E 
Sbjct: 120 --ELKTSQDGGNAN----------------NGARLYEFAMKLEELGEQSLWTSSATGQEI 161

Query: 170 FPEWRNIPSYMTRKLKPFDKPLQIQLKHKSKK 201
           +PEW  +P  + RKLKPF+ P    +  +++K
Sbjct: 162 YPEWDYVPMEVQRKLKPFNAPAPFNVDKEAEK 193

>KAFR0G03710 Chr7 complement(764660..764899) [240 bp, 79 aa] {ON}
          Anc_3.496 YPR151C
          Length = 79

 Score = 60.1 bits (144), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 34/39 (87%)

Query: 54 RSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLF 92
          ++LP+VPTT+YL+  +L  DILY+GYRPV+YP+KENPL 
Sbjct: 9  KNLPRVPTTKYLDKSKLKIDILYNGYRPVLYPMKENPLL 47

>YPL159C Chr16 complement(250907..251668) [762 bp, 253 aa] {ON}
           PET20Mitochondrial protein, required for respiratory
           growth under some conditions and for stability of the
           mitochondrial genome
          Length = 253

 Score = 62.8 bits (151), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 47/167 (28%), Positives = 76/167 (45%), Gaps = 49/167 (29%)

Query: 28  PIRQQHQQITKQRSSKIFKNVHF----YDFRSLPKVPTTQYLEARELTRDILYSGYRPVM 83
           P+ +Q++ ITK+  S + +  H      DF  LP+VP+T +L+  ++T ++LYSGYRP+ 
Sbjct: 72  PLIKQNKTITKKEHSDV-RGSHLKKKRSDFSWLPRVPSTSHLKQSDMTTNVLYSGYRPLF 130

Query: 84  YPVKENPLFRDKKKKSLQMLLTADEAPITEAKTTEKSKHKNILFGERGTGGIMSGGVNGT 143
                NP   D K K                                 TG  +       
Sbjct: 131 I----NP--NDPKLK-------------------------------EDTGSTL------- 146

Query: 144 WKYNPTVPNELLPFNWWSTSSMGMEYFPEWRNIPSYMTRKLKPFDKP 190
           +++   + +   P + W +S+ G+E+F EW NIPS + + LKPF  P
Sbjct: 147 YEFAMKLEDLNEPLSPWISSATGLEFFSEWENIPSELLKNLKPFHPP 193

>Suva_16.151 Chr16 complement(260210..260971) [762 bp, 253 aa] {ON}
           YPL159C (REAL)
          Length = 253

 Score = 62.0 bits (149), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 45/171 (26%), Positives = 70/171 (40%), Gaps = 49/171 (28%)

Query: 24  RLVNPIRQQHQQITKQRSSKIFKNVHFY----DFRSLPKVPTTQYLEARELTRDILYSGY 79
               P+ +Q + I K  S+ I +  H      DF  LP+VP+T +L+  ++T ++LYSGY
Sbjct: 68  ECTTPLIEQSEAIAKTDSTNI-RASHSRKKRRDFSWLPRVPSTSHLKHSDMTTNVLYSGY 126

Query: 80  RPVMYPVKENPLFRDKKKKSLQMLLTADEAPITEAKTTEKSKHKNILFGERGTGGIMSGG 139
           RP+     +  L  D      +  +  D+                               
Sbjct: 127 RPIFINPNDPKLKEDTGSTLYEFAMKLDDL------------------------------ 156

Query: 140 VNGTWKYNPTVPNELLPFNWWSTSSMGMEYFPEWRNIPSYMTRKLKPFDKP 190
                       NE  P + W +S+ G+E+F EW NIPS + + LKPF  P
Sbjct: 157 ------------NE--PLSPWISSATGLEFFSEWENIPSELLKNLKPFHPP 193

>KNAG0J01760 Chr10 (320758..321534) [777 bp, 258 aa] {ON} Anc_8.682
           YPL159C
          Length = 258

 Score = 62.0 bits (149), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 39/140 (27%), Positives = 58/140 (41%), Gaps = 33/140 (23%)

Query: 51  YDFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQMLLTADEAP 110
           Y +  LP VP+TQ++EA ++  ++LYSGYR         PLF D       +L   ++A 
Sbjct: 91  YRYHPLPSVPSTQHIEANDMCTELLYSGYR---------PLFLDSTALERGLLAAKEQAS 141

Query: 111 ITEAKTTEKSKHKNILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEYF 170
            T++ +   S    I                              P   W+ S+ G+E +
Sbjct: 142 FTQSASPTGSTFYEIAMKLED------------------------PACIWANSATGLEKY 177

Query: 171 PEWRNIPSYMTRKLKPFDKP 190
            EW NIP  +   LKPF  P
Sbjct: 178 TEWDNIPYSVANSLKPFVPP 197

>Skud_16.123 Chr16 complement(222359..223126) [768 bp, 255 aa] {ON}
           YPL159C (REAL)
          Length = 255

 Score = 61.6 bits (148), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 48/167 (28%), Positives = 75/167 (44%), Gaps = 49/167 (29%)

Query: 28  PIRQQHQQITKQRSSKIFKNVH----FYDFRSLPKVPTTQYLEARELTRDILYSGYRPVM 83
           P+ +Q +QI K  S+ I +  H      DF  LP+VP+T +L+  ++T ++LYSGYRP+ 
Sbjct: 72  PLIKQSEQIAKNDSTSI-RASHPRKKRRDFSWLPRVPSTSHLKHTDMTTNVLYSGYRPLF 130

Query: 84  YPVKENPLFRDKKKKSLQMLLTADEAPITEAKTTEKSKHKNILFGERGTGGIMSGGVNGT 143
                NP   D K K                                 TG  +       
Sbjct: 131 I----NP--NDPKLK-------------------------------EDTGSTL------- 146

Query: 144 WKYNPTVPNELLPFNWWSTSSMGMEYFPEWRNIPSYMTRKLKPFDKP 190
           +++   + +   P + W +S+ G+E+F EW NIPS + + LKPF  P
Sbjct: 147 YEFAMKLEDLNEPLSPWISSATGLEFFSEWENIPSELLKNLKPFHPP 193

>TDEL0A06270 Chr1 (1098704..1099432) [729 bp, 242 aa] {ON} Anc_8.682
           YPL159C
          Length = 242

 Score = 61.2 bits (147), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 48/163 (29%), Positives = 77/163 (47%), Gaps = 43/163 (26%)

Query: 30  RQQHQQITKQRSSKIFKNVHFYDFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKEN 89
           R Q +++T + S +  K    +D+  LP+VP+T  L+ R+++  +LYSGYRP+      N
Sbjct: 71  RSQQKKMTVEISGRGRKQ-QRHDYSWLPRVPSTGNLKPRDMSMKVLYSGYRPLFI----N 125

Query: 90  PLFRDKKKKSLQMLLTADEAPITEAKTTEKSKHKNILFGERGTGGIMSGGVNGTWKYNPT 149
           P                      E KT+ +           GTGG +       +++   
Sbjct: 126 P---------------------DEIKTSSEGS---------GTGGTL-------YEFAMK 148

Query: 150 VPNELLPFNWWSTSSMGMEYFPEWRNIPSYMTRKLKPFDKPLQ 192
           +  EL   + W TS+ G+EY+ EW +IP  + +KLKPF  P Q
Sbjct: 149 L-EELGDQSPWVTSATGLEYYREWDSIPGELQKKLKPFTAPEQ 190

>TPHA0D01290 Chr4 (268062..268718) [657 bp, 218 aa] {ON} Anc_8.682
           YPL159C
          Length = 218

 Score = 60.1 bits (144), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 44/154 (28%), Positives = 70/154 (45%), Gaps = 38/154 (24%)

Query: 35  QITKQRSSKIFKNVHFYDFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRD 94
           Q++   S K   +    D+  LPKVP T  +  RE+T + LYSGYR         PLF D
Sbjct: 74  QMSGGLSGKSLADKKVLDYSWLPKVPQTSSITHREITTNSLYSGYR---------PLFID 124

Query: 95  KKKKSLQMLLTADEAPITEAKTTEKSKHKNILFGERGTGGIMSGGVNGTWKYNPTVPNEL 154
            KK +L          + +  +T +  + +I                  +++   + NEL
Sbjct: 125 NKKGTL----------LGDVNSTAQDANSSI------------------YEFAMKL-NEL 155

Query: 155 LPFNWWSTSSMGMEYFPEWRNIPSYMTRKLKPFD 188
              + W  S+ G+E + EW  +PS + +KLKP+D
Sbjct: 156 SEPSPWMMSATGLESYSEWDYVPSKVIKKLKPYD 189

>Smik_6.356 Chr6 (572523..573284) [762 bp, 253 aa] {ON} YPL159C
           (REAL)
          Length = 253

 Score = 59.7 bits (143), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 42/139 (30%), Positives = 62/139 (44%), Gaps = 44/139 (31%)

Query: 52  DFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQMLLTADEAPI 111
           DF  LPKVP+T +L+  ++T ++LYSGYRP+      NP   D K K             
Sbjct: 99  DFSWLPKVPSTSHLKQSDMTTNVLYSGYRPLFI----NP--NDPKLK------------- 139

Query: 112 TEAKTTEKSKHKNILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEYFP 171
                               TG  +       +++   + +   P + W +S+ G+E+F 
Sbjct: 140 ------------------EDTGSTL-------YEFAMKLEDLNEPLSPWISSATGLEFFS 174

Query: 172 EWRNIPSYMTRKLKPFDKP 190
           EW NIPS + R LKPF  P
Sbjct: 175 EWDNIPSELLRNLKPFHPP 193

>AFR315C Chr6 complement(1006937..1007170) [234 bp, 77 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YPR151C
          (SUE1)
          Length = 77

 Score = 53.5 bits (127), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 32/41 (78%)

Query: 53 FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFR 93
          FR LP+VP+TQ+L A ++  DIL+S +RP+ YPV +NPL R
Sbjct: 7  FRMLPRVPSTQHLPADKVRLDILFSRHRPLTYPVSQNPLIR 47

>KLLA0D06061g Chr4 (520082..520831) [750 bp, 249 aa] {ON} weakly
           similar to uniprot|Q99373 Saccharomyces cerevisiae
           YPL159C PET20 Protein required for respiratory growth
           and stability of the mitochondrial genome
          Length = 249

 Score = 56.6 bits (135), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 42/152 (27%), Positives = 64/152 (42%), Gaps = 51/152 (33%)

Query: 52  DFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQMLLTADEAPI 111
           D+  LP+VPTT+++   E   D+LYSGYRP++   K       K+ K +Q  +  +    
Sbjct: 108 DYSWLPRVPTTEHILREEFNSDMLYSGYRPIVVGDK-----NAKENKLMQFAMKLE---- 158

Query: 112 TEAKTTEKSKHKNILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEYFP 171
                                            K +  VP        W +S+ G E+F 
Sbjct: 159 ---------------------------------KLSEPVP--------WVSSATGQEFFS 177

Query: 172 EWRNIPSYMTRKLKPFDKPLQIQLKHKSKKKE 203
           EW N+PS + + LKPF  P  I+  + +K KE
Sbjct: 178 EWDNVPSEIIKDLKPFHPP-SIEETNNAKNKE 208

>SAKL0H06380g Chr8 complement(563753..564412) [660 bp, 219 aa] {ON}
           similar to uniprot|Q99373 Saccharomyces cerevisiae
           YPL159C PET20 Protein required for respiratory growth
           and stability of the mitochondrial genome
          Length = 219

 Score = 54.3 bits (129), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 60/141 (42%), Gaps = 48/141 (34%)

Query: 51  YDFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQMLLTADEAP 110
           +D+  LPK P+T++L+ RE++ D+ YSGYRP+      NP    + + +L       EA 
Sbjct: 78  HDYSWLPKAPSTEHLKLREISTDVFYSGYRPIFL----NPASPKESESTLYEFAMKLEA- 132

Query: 111 ITEAKTTEKSKHKNILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEYF 170
                            G+                          P  W S S+ G E++
Sbjct: 133 ----------------LGD--------------------------PIPWVS-SATGTEFY 149

Query: 171 PEWRNIPSYMTRKLKPFDKPL 191
            EW N+P+ + +KLKPF  P+
Sbjct: 150 GEWDNVPTEVIKKLKPFQPPV 170

>Kpol_1013.9 s1013 (15300..16085) [786 bp, 261 aa] {ON}
           (15300..16085) [786 nt, 262 aa]
          Length = 261

 Score = 53.5 bits (127), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 57/139 (41%), Gaps = 41/139 (29%)

Query: 52  DFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQMLLTADEAPI 111
           D+  LPKVP+T+ L  RE+    LYSGYRP+                             
Sbjct: 108 DYSWLPKVPSTENLNHREIRTSALYSGYRPIY---------------------------- 139

Query: 112 TEAKTTEKSKHKNILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEYFP 171
                  K   KN L       G M  GVN T+     +  +L   + W +S+ GME + 
Sbjct: 140 ----INSKGSGKNKL------SGTMKNGVNSTFY---EIAMKLENPSPWMSSATGMELYS 186

Query: 172 EWRNIPSYMTRKLKPFDKP 190
           EW ++P  + + LKPF  P
Sbjct: 187 EWDHVPLDVLKDLKPFHPP 205

>TPHA0G01570 Chr7 complement(319949..320716) [768 bp, 255 aa] {ON}
           Anc_8.682 YPL159C
          Length = 255

 Score = 51.6 bits (122), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/140 (27%), Positives = 53/140 (37%), Gaps = 41/140 (29%)

Query: 51  YDFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQMLLTADEAP 110
           +D+ SLPK PTT +L + E   D+ YSGYRP+   V +              L +  E P
Sbjct: 101 FDYSSLPKAPTTHHLHSSEFNTDLFYSGYRPLSIDVNQ--------------LASEQENP 146

Query: 111 ITEAKTTEKSKHKNILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEYF 170
            T  + +                  +S  +         V   L     W  S+ G E +
Sbjct: 147 CTCYEIS------------------LSMDI---------VKKNLKVSTPWLFSATGSELY 179

Query: 171 PEWRNIPSYMTRKLKPFDKP 190
            EW NIP  +   LK F  P
Sbjct: 180 KEWDNIPKSVLDNLKCFHPP 199

>KLTH0D11396g Chr4 (931339..932016) [678 bp, 225 aa] {ON} similar to
           uniprot|Q99373 Saccharomyces cerevisiae YPL159C PET20
           Protein required for respiratory growth and stability of
           the mitochondrial genome
          Length = 225

 Score = 50.1 bits (118), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 37/139 (26%), Positives = 58/139 (41%), Gaps = 48/139 (34%)

Query: 52  DFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQMLLTADEAPI 111
           DF  LPK P+T +L+ R+++  +LYSGYRP                     +L + E   
Sbjct: 81  DFSWLPKAPSTDHLKHRDVSTTLLYSGYRP--------------------FVLNSSEQKQ 120

Query: 112 TEAKTTEKSKHKNILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEYFP 171
           T++   E +     L                          + LP   W +S+ G E++ 
Sbjct: 121 TDSTLYEFAMKLEAL-------------------------GDPLP---WISSATGTEFYG 152

Query: 172 EWRNIPSYMTRKLKPFDKP 190
           EW NIP+ + +KL+PF  P
Sbjct: 153 EWDNIPADVIKKLRPFQPP 171

>NDAI0K01320 Chr11 complement(297117..297893) [777 bp, 258 aa] {ON}
           Anc_8.682 YPL159C
          Length = 258

 Score = 50.1 bits (118), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 54/139 (38%), Gaps = 41/139 (29%)

Query: 52  DFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQMLLTADEAPI 111
           +F  LPK+     L  ++++  +LYSGYRP+  P   N  F+  +K +   L        
Sbjct: 90  NFSRLPKITPPSNLRHQDISMKLLYSGYRPLFIP---NGSFQQGQKNNGSTLYEF----- 141

Query: 112 TEAKTTEKSKHKNILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEYFP 171
              K  E  K KN                                   W TS+ G+E F 
Sbjct: 142 -AMKLDEFKKDKNSTI--------------------------------WDTSATGVETFT 168

Query: 172 EWRNIPSYMTRKLKPFDKP 190
           EW N+P  + R LKPF KP
Sbjct: 169 EWDNVPESVIRNLKPFQKP 187

>Kpol_1072.12 s1072 complement(24362..25030) [669 bp, 222 aa] {ON}
           complement(24362..25030) [669 nt, 223 aa]
          Length = 222

 Score = 49.3 bits (116), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 40/159 (25%), Positives = 62/159 (38%), Gaps = 41/159 (25%)

Query: 32  QHQQITKQRSSKIFKNVHFYDFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPL 91
           Q  Q+ K  ++    N    D+  LPKVP+ + L  +++T DI YSG+RP+     E   
Sbjct: 73  QKLQLNKYNNNTQLNNDLVVDYSWLPKVPSNKRLTHQDITTDIFYSGFRPLSIDPTE--- 129

Query: 92  FRDKKKKSLQMLLTADEAPITEAKTTEKSKHKNILFGERGTGGIMSGGVNGTWKYNPTVP 151
             +K + S     T  E  +T       S H +I                          
Sbjct: 130 LENKDEDS----STWYEVSLTLDSPVPPSGHNSI-------------------------- 159

Query: 152 NELLPFNWWSTSSMGMEYFPEWRNIPSYMTRKLKPFDKP 190
                   W++S+ GME + EW ++P  +   L PF  P
Sbjct: 160 --------WTSSATGMERYREWHSVPEEVINSLTPFQPP 190

>Kwal_26.8828 s26 (960466..961137) [672 bp, 223 aa] {ON} YPL159C -
           Hypothetical ORF [contig 68] FULL
          Length = 223

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 40/73 (54%), Gaps = 2/73 (2%)

Query: 18  QRRTHSRLVNPIRQQHQQITKQRSSKIFKNVHF-YDFRSLPKVPTTQYLEARELTRDILY 76
           +R++   +        +Q +K+R +   K      DF  LPK P+T +L+ R+++  +LY
Sbjct: 46  KRKSRKNVGQSAEPASEQSSKKRVAVELKGKQLKTDFSWLPKAPSTDHLKQRDVSTTLLY 105

Query: 77  SGYRP-VMYPVKE 88
           SGYRP V+ P  +
Sbjct: 106 SGYRPFVLAPADQ 118

 Score = 35.4 bits (80), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 11/31 (35%), Positives = 21/31 (67%)

Query: 160 WSTSSMGMEYFPEWRNIPSYMTRKLKPFDKP 190
           W +S+ G E++ EW  +P+ + ++L+PF  P
Sbjct: 141 WISSATGTEFYGEWDGVPADVIKQLRPFQPP 171

>KAFR0H02380 Chr8 complement(455996..456658) [663 bp, 220 aa] {ON}
           Anc_8.682 YPL159C
          Length = 220

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/145 (22%), Positives = 56/145 (38%), Gaps = 51/145 (35%)

Query: 51  YDFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQMLLTADEAP 110
           Y + +LP+VP+T  ++ ++L  ++L+S YRP                  L M L +D + 
Sbjct: 86  YKYSALPRVPSTSNMDRKQLNTELLFSAYRP------------------LSMDLKSDSST 127

Query: 111 ITEAKTTEKSKHKNILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEYF 170
           + E                     +M+             P++    + W      +   
Sbjct: 128 MYEF--------------------LMA-------------PDQSTTSSPWGRPFSRLHDH 154

Query: 171 PEWRNIPSYMTRKLKPFDKPLQIQL 195
             WRN+PS+  RKLKPF  P +I  
Sbjct: 155 RAWRNVPSHTVRKLKPFVPPSEIDF 179

>Ecym_2390 Chr2 complement(757433..758116) [684 bp, 227 aa] {ON}
           similar to Ashbya gossypii AAL087C
          Length = 227

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/152 (23%), Positives = 57/152 (37%), Gaps = 49/152 (32%)

Query: 52  DFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQMLLTADEAPI 111
           D+   P  P T++L+  ++  D+LYSGYRP+    + +P     K   L M L A E P 
Sbjct: 85  DYSWFPVAPKTEHLKEGDIAVDLLYSGYRPLSLR-RADPKEAQSKIYELAMRLEAVEDP- 142

Query: 112 TEAKTTEKSKHKNILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEYFP 171
                                                      LP   W  ++ G   + 
Sbjct: 143 -------------------------------------------LP---WVKNATGRVLYD 156

Query: 172 EWRNIPSYMTRKLKPFDKPLQIQLKHKSKKKE 203
           EW N+P  + R L+P+  P +++ K K+   E
Sbjct: 157 EWDNVPQSVIRNLRPYVPP-KVETKEKTDNDE 187

>TDEL0E00710 Chr5 (152143..153573) [1431 bp, 476 aa] {ON} Anc_3.62
           YNL295W
          Length = 476

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/149 (23%), Positives = 73/149 (48%), Gaps = 14/149 (9%)

Query: 56  LPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQMLLT--ADEAPITE 113
           LP+VP+T Y+   E+  + L++GYRP+   +  + L  + +  +L    T  A+    +E
Sbjct: 75  LPRVPSTDYIPNTEVQTEGLFAGYRPLF--LGNSSLRPETRTNALDNFFTSFANLKVTSE 132

Query: 114 AKTTEKSKHKNILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEYFPE- 172
           +K + + + ++++   +     ++   +      P +P        W  S  GM Y    
Sbjct: 133 SKNSAEEEVQDVIEELKRDSAQLNLKNSKGKNRKPIIP--------WDASISGMVYNDHS 184

Query: 173 WRNIPSYMTRKLKPFDKPLQIQLKHKSKK 201
           ++++P  +  KLKPF K ++++   +SKK
Sbjct: 185 FKDVPKSVVSKLKPF-KMVKLERAGESKK 212

>TBLA0B03800 Chr2 complement(873861..874835) [975 bp, 324 aa] {ON}
           Anc_8.682 YPL159C
          Length = 324

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 24/31 (77%)

Query: 52  DFRSLPKVPTTQYLEARELTRDILYSGYRPV 82
           D+  LPKVPT + L+ R++  ++LYSGYRP+
Sbjct: 163 DYSWLPKVPTLKNLKQRDVMTNVLYSGYRPL 193

 Score = 38.1 bits (87), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 26/43 (60%), Gaps = 3/43 (6%)

Query: 153 ELLPFNWWSTSSMGMEYFPEWRNIPSYMTRKLKPFDKPLQIQL 195
           E+ P   W +S+ G+E + EW +IP  + +KLKP   P  I+L
Sbjct: 231 EIFP---WMSSAAGLEVYSEWDSIPIEVLKKLKPLQSPQMIKL 270

>Kpol_1066.44 s1066 complement(74670..76109) [1440 bp, 479 aa] {ON}
           complement(74670..76109) [1440 nt, 480 aa]
          Length = 479

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 59/137 (43%), Gaps = 14/137 (10%)

Query: 56  LPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQMLLTADEAPITEAK 115
           LP+VP+T+ +   E+  D L++GYRP+   +   P+   +K   L   L    A  ++ K
Sbjct: 74  LPRVPSTENIPVEEVQTDGLFAGYRPLF--LGNCPIDDAEKGSELDRFL----ASFSDLK 127

Query: 116 --TTEKSKHKNILFGE--RGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEYFP 171
               E S  K +   +        +    N     N      ++P   W  S  G+ Y  
Sbjct: 128 LLNNEDSDSKEVKIEDILEDIQNDIRNATNEDIGDNSRTRKPVVP---WDASISGLIYND 184

Query: 172 E-WRNIPSYMTRKLKPF 187
             ++NIP+ +  KLKPF
Sbjct: 185 RPFKNIPNEVVSKLKPF 201

>ZYRO0C02244g Chr3 complement(174640..176022) [1383 bp, 460 aa] {ON}
           similar to gnl|GLV|KLLA0A07447g Kluyveromyces lactis
           KLLA0A07447g and weakly similar to YNL295W
           uniprot|P48564 Saccharomyces cerevisiae YNL295W
           Hypothetical ORF
          Length = 460

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 40/151 (26%), Positives = 73/151 (48%), Gaps = 20/151 (13%)

Query: 56  LPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQMLLT--ADEAPITE 113
           +P+VP T Y+ A E+  + L++GYRP+   +  +P+        L    T  A+   + E
Sbjct: 58  VPRVPPTDYISAPEIQTEGLFAGYRPLF--LGNSPINDKNGSTPLDNFFTSFANLKVVEE 115

Query: 114 AKTTEKSKHKNILFGERGTGGIMSGGVNGTWKYN--PTVPNELLPFNWWSTSSMGMEYFP 171
           ++   +   + ++  E    GI SG ++ +   N  P +P        W  S  GM Y  
Sbjct: 116 SEVVGEVNVQEVI--EDLRRGIPSGQMSNSKGKNRKPIIP--------WDASISGMVYND 165

Query: 172 E-WRNIPSYMTRKLKPFDKPLQIQLKHKSKK 201
           + ++++P+ +  KLKPF     ++L+ KS K
Sbjct: 166 DPFKHVPNNVVSKLKPFK---MVRLEKKSDK 193

>CAGL0M02101g Chr13 complement(254024..254827) [804 bp, 267 aa] {ON}
           some similarities with uniprot|Q99373 Saccharomyces
           cerevisiae YPL159c
          Length = 267

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 40/176 (22%), Positives = 70/176 (39%), Gaps = 46/176 (26%)

Query: 16  SIQRRTHSRLVNPIRQQHQQITKQRSSKIFKNVHFYDFRSLPKVPTTQYLEARELTRDIL 75
           S +++ +S + +  ++    +   +S K       YD+ +LP+V      + + ++ ++L
Sbjct: 76  SDKKQYNSGVTSAAQEAGGAVRDLKSEKAQTKKKVYDYSTLPRVEQISDTKLKNMSTEVL 135

Query: 76  YSGYRPVMYPVKENPLFRDKKKKSLQMLLTADEAPITEAKTTEKSKHKNILFGERGTGGI 135
           YSGYR         PLF D + K+ Q           E KT  +   K   F E      
Sbjct: 136 YSGYR---------PLFFDVEPKNSQ-----------EGKTLYEFAMKLEEFQE------ 169

Query: 136 MSGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEYFPEWRNIPSYMTRKLKPFDKPL 191
                             + P+   +T S   E + EW N+P  + + LKPF  P+
Sbjct: 170 -----------------AMSPWVSSATGS---EMYAEWDNVPGDVIKDLKPFTPPV 205

>KLLA0A07447g Chr1 (669272..670732) [1461 bp, 486 aa] {ON} similar
           to uniprot|P48564 Saccharomyces cerevisiae YNL295W
          Length = 486

 Score = 37.0 bits (84), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 39/155 (25%), Positives = 71/155 (45%), Gaps = 25/155 (16%)

Query: 56  LPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQMLLTADEAPITEAK 115
           +P+VP+T YL   +L  + L++GY+P+   +  +PL    +  +  +LL    + I + K
Sbjct: 90  VPQVPSTDYLPREDLETEGLFAGYKPLF--LGNSPL----ESNNNDVLLDGLFSSIRKLK 143

Query: 116 TTEKSKHKNILFGERGTGGIMSGGVNGTWKYN------PTVPNELLPFNWWSTSSMGMEY 169
             + +   N +  E     ++        +Y       P +P        W  S  G+ Y
Sbjct: 144 NAQINSENNTV--EIDVSDMLDDLKKDNQEYQRLHEKAPKIP--------WDASISGLVY 193

Query: 170 FPE-WRNIPSYMTRKLKPFDKPLQIQLKHKSKKKE 203
             E ++ +P  +  KLKPF K ++++ K  SK KE
Sbjct: 194 NDEPFKGVPRSVVSKLKPF-KLVRVE-KKNSKDKE 226

>Skud_14.42 Chr14 (70507..72081) [1575 bp, 524 aa] {ON} YNL295W
           (REAL)
          Length = 524

 Score = 37.0 bits (84), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 48/191 (25%), Positives = 85/191 (44%), Gaps = 30/191 (15%)

Query: 23  SRLVNPIRQQHQQITKQRSS--KIF-KNVHFYDFRSLPKVPTTQYLEARELTRDILYSGY 79
           S  V+ ++Q +Q +    +S  K+F  N+H      +PKV +T+Y+  +E+  + L++GY
Sbjct: 79  SHTVSALQQMNQSVDNVGTSRPKMFGSNLHLL----VPKVASTEYIPIKEVHTEGLFAGY 134

Query: 80  RPVMYPVKENPLFRDKKKKSLQMLLTADEAP----ITEAKTTEKSKHKNILFGERGTGGI 135
           RP+      N  F    +K        D  P    I  ++   K   + I+   + T  I
Sbjct: 135 RPLFLG---NSSFSSDMRKGKNFHALDDGLPNIQVIDASEKDGKLDVQEIIEDLQKTSLI 191

Query: 136 MSGG----VNGTWKYNPTVPNELLPFNWWSTSSMGMEY--FPEWRNIPSYMTRKLKPFDK 189
            +       + + K  P +P        W  S  GM Y   P ++ +P  +  K+KPF K
Sbjct: 192 ENVSDKEQFSSSHKRKPVIP--------WDASISGMVYNDMP-FKYVPKNVISKMKPF-K 241

Query: 190 PLQIQLKHKSK 200
            ++I+ K  +K
Sbjct: 242 LMRIERKSHAK 252

>NDAI0A06110 Chr1 complement(1384706..1386178) [1473 bp, 490 aa]
           {ON} Anc_3.62 YNL295W
          Length = 490

 Score = 36.2 bits (82), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 38/150 (25%), Positives = 63/150 (42%), Gaps = 26/150 (17%)

Query: 56  LPKVPTTQYLEARELTRDILYSGYRPVMY---PVKENPLFRDK--------KKKSLQMLL 104
           +P+V  T ++   E+  + L++GY+P+      +     F D         +   L++L 
Sbjct: 67  VPRVGETDHIPVNEVQTEGLFAGYKPLFLGNSSISTQNRFYDNELHLKLLPQLSDLKLLG 126

Query: 105 TADEAPITEAKTTEK--SKHKNI--LFGERGTGGIMSGGVN--GTWKYNPTVPNELLPFN 158
              E  ITE+ +     S+  NI  +  E     I S  +N  G     PT+P       
Sbjct: 127 ANAENFITESSSLHDTLSQKNNIQDIIEELKNATIHSQDINSDGEGITKPTIP------- 179

Query: 159 WWSTSSMGMEYFPE-WRNIPSYMTRKLKPF 187
            W  S  GM Y    ++ +P+ +  KLKPF
Sbjct: 180 -WDASISGMLYKDRPFKAVPNSVVTKLKPF 208

>SAKL0C12342g Chr3 complement(1099949..1101607) [1659 bp, 552 aa]
           {ON} similar to uniprot|P48564 Saccharomyces cerevisiae
           YNL295W Hypothetical ORF
          Length = 552

 Score = 34.7 bits (78), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 39/153 (25%), Positives = 67/153 (43%), Gaps = 24/153 (15%)

Query: 56  LPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQMLLTADEAPITEAK 115
           +P VP T Y+   E+  + L++GY+P+      N    +K+   L  L T+    +T+ K
Sbjct: 161 VPHVPNTDYIPHSEIQTEGLFAGYKPLFL---GNSSLDEKRADVLDGLFTS----LTKIK 213

Query: 116 TTEKSKHKNI----LFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEY-- 169
               + +  I    +  +      M      + K  P +P        W  S  GM Y  
Sbjct: 214 KGTSAPNGEINVQEILDDLQKDDTMETLKEKSHK-KPVIP--------WDASISGMVYND 264

Query: 170 FPEWRNIPSYMTRKLKPFDKPLQIQLKHKSKKK 202
            P ++++P  +  KLKPF K L+I+ ++K   K
Sbjct: 265 LP-FKDVPRNVVGKLKPF-KLLRIERRNKKDGK 295

>TPHA0P01260 Chr16 complement(252274..253758) [1485 bp, 494 aa] {ON}
           Anc_3.62 YNL295W
          Length = 494

 Score = 34.7 bits (78), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 31/138 (22%), Positives = 59/138 (42%), Gaps = 15/138 (10%)

Query: 56  LPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQMLLTA-----DEAP 110
           +PKV +T  L + E+  + L++GYRP+   +  + L  + K   L    T+       AP
Sbjct: 89  VPKVASTDNLSSAEIQTEGLFAGYRPLF--LGNSSLETNSKLDVLDNFFTSFANLKVSAP 146

Query: 111 ITEAKTTEKSKHKNILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEYF 170
            +E  +    + K+++         +  G+    + +        P   W  S  GM Y 
Sbjct: 147 ESETDSYNSGQIKDVI-------DDLQNGLESEQEQSSLTRENRKPIIPWDASIGGMVYS 199

Query: 171 PE-WRNIPSYMTRKLKPF 187
            + ++++P  +  KL PF
Sbjct: 200 DKAFKDLPKSVVSKLSPF 217

>Kpol_529.13 s529 complement(28325..32557) [4233 bp, 1410 aa] {ON}
            complement(28325..32557) [4233 nt, 1411 aa]
          Length = 1410

 Score = 33.9 bits (76), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 45/110 (40%), Gaps = 13/110 (11%)

Query: 29   IRQQHQQITKQRSSKIFKNVHFYDFRSLPKVPTTQYLEARE-LTRDILYSGYRPVMYPVK 87
            I QQ+  I   +  K+  NV  Y F        T +L   E  T + L+S   P  YP  
Sbjct: 1253 INQQYATIDVDKLEKLLNNVLVYSFND------TSFLNMSEQSTNEFLFSSNYPTYYPFT 1306

Query: 88   ENP-----LFRDKKKKSLQMLLTADEAPITEAKTTEKSKHKNILFGERGT 132
             +P       +D+   S+  + + D  P T++     + H+ IL G   T
Sbjct: 1307 SSPPTILQSIQDEDDNSMNDMTSNDPVP-TKSSMDLVATHQQILNGTVST 1355

>NCAS0A09940 Chr1 complement(1986687..1988171) [1485 bp, 494 aa]
          {ON} Anc_3.62 YNL295W
          Length = 494

 Score = 33.5 bits (75), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 21/28 (75%)

Query: 56 LPKVPTTQYLEARELTRDILYSGYRPVM 83
          +PKVPTT Y+ + E+  + L++GY+P+ 
Sbjct: 70 VPKVPTTDYIPSLEMQTEGLFAGYKPLF 97

>Suva_14.44 Chr14 (73757..75334) [1578 bp, 525 aa] {ON} YNL295W
           (REAL)
          Length = 525

 Score = 32.0 bits (71), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 38/156 (24%), Positives = 74/156 (47%), Gaps = 25/156 (16%)

Query: 56  LPKVPTTQYLEARELTRDILYSGYRPVM-----YP--VKENPLFRDKKKK--SLQMLLTA 106
           +PKV +T ++  +E+  + L++GYRP+      +P  V++   F D  +   ++Q++  +
Sbjct: 112 VPKVASTDHIPKKEVNTEGLFAGYRPLFLGNSSFPSDVRKGKNFHDLDEVLPNIQLVDAS 171

Query: 107 DEAPITEAKTTEKSKHKNILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSSMG 166
           ++      +   +   +  L   R +   M    + + K  P +P        W  S  G
Sbjct: 172 EKDGKLNVQEIIEDLQRTSL---RESISNMEQS-SSSHKRRPVIP--------WDASISG 219

Query: 167 MEY--FPEWRNIPSYMTRKLKPFDKPLQIQLKHKSK 200
           M Y   P +++IP  +  KLKPF K ++++ K  SK
Sbjct: 220 MVYNDMP-FKHIPKNVVSKLKPF-KLVRVERKSNSK 253

>Smik_14.36 Chr14 (61288..62862) [1575 bp, 524 aa] {ON} YNL295W
           (REAL)
          Length = 524

 Score = 32.0 bits (71), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 37/155 (23%), Positives = 67/155 (43%), Gaps = 23/155 (14%)

Query: 56  LPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQMLLTADEAP-ITEA 114
           +PKV +T +++ +E+  + L++GYRP+      N  F    +K        D  P I   
Sbjct: 111 VPKVASTDHIQNKEVHTEGLFAGYRPLFLG---NSSFPSDARKGKNFHELGDVLPNIQVI 167

Query: 115 KTTEKSKHKNI--LFGERGTGGIMSGGVN-----GTWKYNPTVPNELLPFNWWSTSSMGM 167
             +EK    N+  +  +     +     N      + K  P +P        W  S  GM
Sbjct: 168 DASEKDGKLNMQEIIEDLHKSSLRDSIHNMEQHSSSHKRKPVIP--------WDASISGM 219

Query: 168 EY--FPEWRNIPSYMTRKLKPFDKPLQIQLKHKSK 200
            Y   P ++++P  +  ++KPF K ++I+ K + K
Sbjct: 220 VYNDMP-FKHVPKSVVLRMKPF-KLMRIERKSQMK 252

>YNL295W Chr14 (76946..78520) [1575 bp, 524 aa] {ON} Putative
           protein of unknown function
          Length = 524

 Score = 31.2 bits (69), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 38/155 (24%), Positives = 66/155 (42%), Gaps = 23/155 (14%)

Query: 56  LPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQMLLTADEAP-ITEA 114
           +P+V +T Y+  +E+  + L++GYRP+      N  F    +K        D  P I   
Sbjct: 111 VPRVASTDYISNKEVHTEGLFAGYRPLFLG---NSGFPSDARKGKNFHELDDVLPNIQVV 167

Query: 115 KTTEKSKHKNI--LFGERGTGGIMSG-----GVNGTWKYNPTVPNELLPFNWWSTSSMGM 167
             +EK    N+  +  +     +         +  + K  P +P        W  S  GM
Sbjct: 168 DASEKDGKLNVQEIIEDLQRTSLRESIHSMEQLPSSHKRKPVIP--------WDASISGM 219

Query: 168 EY--FPEWRNIPSYMTRKLKPFDKPLQIQLKHKSK 200
            Y   P ++ +P  +  K+KPF K L+I+ K ++K
Sbjct: 220 VYNDMP-FKYVPKNIILKMKPF-KLLRIERKSQAK 252

>TBLA0B02720 Chr2 (626800..628308) [1509 bp, 502 aa] {ON} Anc_8.798
           YOR320C
          Length = 502

 Score = 31.2 bits (69), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 2/33 (6%)

Query: 53  FRSLPKVPTTQYLEARELTRDILYSG--YRPVM 83
           +  LP +P T YL A+ L +DI+ SG  Y P+ 
Sbjct: 273 YNHLPSLPDTLYLNAKNLGQDIISSGPLYSPIF 305

>CAGL0D05874g Chr4 (557894..559723) [1830 bp, 609 aa] {ON} similar
           to uniprot|P47083 Saccharomyces cerevisiae YJR002w MPP10
           component of the U3 small nucleolar ribonucleoprotein
          Length = 609

 Score = 30.0 bits (66), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 14/55 (25%), Positives = 32/55 (58%)

Query: 4   LTRTKIKGVSFASIQRRTHSRLVNPIRQQHQQITKQRSSKIFKNVHFYDFRSLPK 58
           + R +IK  +F  +QRRT + L   +R++  +++  +SSK    ++  D++ + +
Sbjct: 381 MIRRRIKEYNFDDLQRRTVADLNLGMRREKFELSDAKSSKSLAEIYEEDYKGVSE 435

>TDEL0E04080 Chr5 complement(759841..761610) [1770 bp, 589 aa] {ON}
           Anc_5.221 YJR002W
          Length = 589

 Score = 30.0 bits (66), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 35/56 (62%), Gaps = 2/56 (3%)

Query: 4   LTRTKIKGVSFASIQRRTHSRLVNPIRQQHQ-QITKQRSSKIFKNVHFYDFRSLPK 58
           L R +I+  +F  +QRR  S L N  + + Q +++ Q+SSK   +++  D++++P+
Sbjct: 363 LIRRRIQEYNFDDLQRRVVSDL-NLKKMKPQFELSDQKSSKSLADIYEDDYKNVPQ 417

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.133    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 22,392,259
Number of extensions: 965007
Number of successful extensions: 2977
Number of sequences better than 10.0: 62
Number of HSP's gapped: 2996
Number of HSP's successfully gapped: 85
Length of query: 203
Length of database: 53,481,399
Length adjustment: 104
Effective length of query: 99
Effective length of database: 41,556,135
Effective search space: 4114057365
Effective search space used: 4114057365
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 63 (28.9 bits)