Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_16.4013.491ON42742719070.0
YPR148C3.491ON43543514800.0
Skud_16.4433.491ON42042714560.0
Suva_16.4773.491ON42343113650.0
TDEL0D055903.491ON34442710361e-139
SAKL0F02794g3.491ON3974378981e-117
ZYRO0D10010g3.491ON3824318861e-116
KLTH0F14806g3.491ON3584298501e-111
Kwal_55.212273.491ON3764368461e-110
KLLA0E04621g3.491ON3894297721e-98
Kpol_1017.73.491ON3784337682e-98
TPHA0D032703.491ON3884277198e-91
Ecym_12383.491ON3934427191e-90
NDAI0B058503.491ON4732987006e-87
CAGL0L08492g3.491ON3854066701e-83
KAFR0G036803.491ON4154566679e-83
NCAS0F035403.491ON4442746593e-81
TBLA0D029803.491ON4433006351e-77
AFR309C3.491ON3644385402e-64
KNAG0A079303.491ON4522805028e-58
TDEL0H022407.221ON3382322082e-17
Kwal_47.181487.221ON3232571974e-16
KLTH0A03894g7.221ON3232541922e-15
KLLA0E04511g7.221ON3022841877e-15
CAGL0L00891g7.221ON3412491781e-13
ZYRO0D16522g7.221ON3582541791e-13
Kpol_1070.197.221ON3112321772e-13
KAFR0I019507.221ON3302321753e-13
Suva_9.1597.221ON3252321745e-13
SAKL0F08162g7.221ON3302571735e-13
NDAI0A026607.221ON3642501737e-13
Kpol_478.227.221ON3502271729e-13
KNAG0D017607.221ON3422281711e-12
Smik_9.1507.221ON3262321603e-11
TPHA0C012307.221ON3051191576e-11
TBLA0D042007.221ON3312291567e-11
YIL041W (GVP36)7.221ON3262321568e-11
Skud_9.1287.221ON3292321541e-10
Ecym_43777.221ON333611471e-09
NCAS0A133807.221ON3292501462e-09
ADL115W7.221ON333621425e-09
TPHA0B027507.221ON3632381372e-08
TBLA0B015807.221ON3863121354e-08
AEL006W3.211ON249174770.86
NCAS0B082301.193ON91193704.7
ABL136C2.78ON30359677.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_16.401
         (427 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_16.401 Chr16 complement(698791..700074) [1284 bp, 427 aa] {...   739   0.0  
YPR148C Chr16 complement(826833..828140) [1308 bp, 435 aa] {ON} ...   574   0.0  
Skud_16.443 Chr16 complement(780561..781823) [1263 bp, 420 aa] {...   565   0.0  
Suva_16.477 Chr16 complement(823311..824582) [1272 bp, 423 aa] {...   530   0.0  
TDEL0D05590 Chr4 complement(1008107..1009141) [1035 bp, 344 aa] ...   403   e-139
SAKL0F02794g Chr6 (238272..239465) [1194 bp, 397 aa] {ON} simila...   350   e-117
ZYRO0D10010g Chr4 (845993..847141) [1149 bp, 382 aa] {ON} simila...   345   e-116
KLTH0F14806g Chr6 complement(1212362..1213438) [1077 bp, 358 aa]...   332   e-111
Kwal_55.21227 s55 complement(739317..740447) [1131 bp, 376 aa] {...   330   e-110
KLLA0E04621g Chr5 (412009..413178) [1170 bp, 389 aa] {ON} some s...   301   1e-98
Kpol_1017.7 s1017 (27496..28272,28322..28330,28419..28769) [1137...   300   2e-98
TPHA0D03270 Chr4 complement(673063..674229) [1167 bp, 388 aa] {O...   281   8e-91
Ecym_1238 Chr1 (489922..491103) [1182 bp, 393 aa] {ON} similar t...   281   1e-90
NDAI0B05850 Chr2 complement(1418191..1419612) [1422 bp, 473 aa] ...   274   6e-87
CAGL0L08492g Chr12 (931048..932205) [1158 bp, 385 aa] {ON} simil...   262   1e-83
KAFR0G03680 Chr7 complement(760604..761851) [1248 bp, 415 aa] {O...   261   9e-83
NCAS0F03540 Chr6 complement(707257..708591) [1335 bp, 444 aa] {O...   258   3e-81
TBLA0D02980 Chr4 (723788..725119) [1332 bp, 443 aa] {ON} Anc_3.4...   249   1e-77
AFR309C Chr6 complement(1000078..1001172) [1095 bp, 364 aa] {ON}...   212   2e-64
KNAG0A07930 Chr1 complement(1265981..1267339) [1359 bp, 452 aa] ...   197   8e-58
TDEL0H02240 Chr8 (377524..378540) [1017 bp, 338 aa] {ON} Anc_7.2...    85   2e-17
Kwal_47.18148 s47 complement(708086..709057) [972 bp, 323 aa] {O...    80   4e-16
KLTH0A03894g Chr1 complement(328648..329619) [972 bp, 323 aa] {O...    79   2e-15
KLLA0E04511g Chr5 complement(406764..407672) [909 bp, 302 aa] {O...    77   7e-15
CAGL0L00891g Chr12 (108801..109826) [1026 bp, 341 aa] {ON} simil...    73   1e-13
ZYRO0D16522g Chr4 complement(1371404..1372480) [1077 bp, 358 aa]...    74   1e-13
Kpol_1070.19 s1070 (45405..46340) [936 bp, 311 aa] {ON} (45405.....    73   2e-13
KAFR0I01950 Chr9 (398299..399291) [993 bp, 330 aa] {ON} Anc_7.22...    72   3e-13
Suva_9.159 Chr9 (265174..266151) [978 bp, 325 aa] {ON} YIL041W (...    72   5e-13
SAKL0F08162g Chr6 complement(622302..623294) [993 bp, 330 aa] {O...    71   5e-13
NDAI0A02660 Chr1 (599113..600207) [1095 bp, 364 aa] {ON} Anc_7.221     71   7e-13
Kpol_478.22 s478 (67833..68885) [1053 bp, 350 aa] {ON} (67833..6...    71   9e-13
KNAG0D01760 Chr4 (296169..297197) [1029 bp, 342 aa] {ON} Anc_7.2...    70   1e-12
Smik_9.150 Chr9 (250717..251697) [981 bp, 326 aa] {ON} YIL041W (...    66   3e-11
TPHA0C01230 Chr3 (280944..281861) [918 bp, 305 aa] {ON} Anc_7.22...    65   6e-11
TBLA0D04200 Chr4 (1038483..1039478) [996 bp, 331 aa] {ON} Anc_7....    65   7e-11
YIL041W Chr9 (276525..277505) [981 bp, 326 aa] {ON}  GVP36BAR do...    65   8e-11
Skud_9.128 Chr9 (245338..246327) [990 bp, 329 aa] {ON} YIL041W (...    64   1e-10
Ecym_4377 Chr4 complement(796971..797972) [1002 bp, 333 aa] {ON}...    61   1e-09
NCAS0A13380 Chr1 complement(2633641..2634630) [990 bp, 329 aa] {...    61   2e-09
ADL115W Chr4 (483164..484165) [1002 bp, 333 aa] {ON} Syntenic ho...    59   5e-09
TPHA0B02750 Chr2 (627808..628899) [1092 bp, 363 aa] {ON} Anc_7.2...    57   2e-08
TBLA0B01580 Chr2 (345206..346366) [1161 bp, 386 aa] {ON} Anc_7.2...    57   4e-08
AEL006W Chr5 (621384..628859) [7476 bp, 2491 aa] {ON} Syntenic h...    34   0.86 
NCAS0B08230 Chr2 (1566310..1569045) [2736 bp, 911 aa] {ON} Anc_1...    32   4.7  
ABL136C Chr2 complement(137983..138894) [912 bp, 303 aa] {ON} Sy...    30   7.9  

>Smik_16.401 Chr16 complement(698791..700074) [1284 bp, 427 aa] {ON}
           YPR148C (REAL)
          Length = 427

 Score =  739 bits (1907), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/427 (86%), Positives = 370/427 (86%)

Query: 1   MSGYFSSFSLNKITDSIATAAHKTHDTXXXXXXXXXXXXXDPQTRLSIKSRTRFVQESLG 60
           MSGYFSSFSLNKITDSIATAAHKTHDT             DPQTRLSIKSRTRFVQESLG
Sbjct: 1   MSGYFSSFSLNKITDSIATAAHKTHDTLNNALANANVNLNDPQTRLSIKSRTRFVQESLG 60

Query: 61  TISDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKD 120
           TISDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKD
Sbjct: 61  TISDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKD 120

Query: 121 GWFGSKKSEITNKKKGSNHDDAFLPRSFAQAISKAAVDCEFEFQNLENDEKAELKKKRES 180
           GWFGSKKSEITNKKKGSNHDDAFLPRSFAQAISKAAVDCEFEFQNLENDEKAELKKKRES
Sbjct: 121 GWFGSKKSEITNKKKGSNHDDAFLPRSFAQAISKAAVDCEFEFQNLENDEKAELKKKRES 180

Query: 181 TKNAQTTGAQXXXXXXXXXXXXXXXXXLSNLIKVFDSWSTCYKNIDEGKTEMDSMMVKEF 240
           TKNAQTTGAQ                 LSNLIKVFDSWSTCYKNIDEGKTEMDSMMVKEF
Sbjct: 181 TKNAQTTGAQDEENEEDEDEEEEEDEDLSNLIKVFDSWSTCYKNIDEGKTEMDSMMVKEF 240

Query: 241 NKKLEKLINQDFKRVHELRKKVEISRLKFDTMRYEVKAKEAQLDAQKPGVTEEAHTKDVS 300
           NKKLEKLINQDFKRVHELRKKVEISRLKFDTMRYEVKAKEAQLDAQKPGVTEEAHTKDVS
Sbjct: 241 NKKLEKLINQDFKRVHELRKKVEISRLKFDTMRYEVKAKEAQLDAQKPGVTEEAHTKDVS 300

Query: 301 ANTATSLNEIPSTVDEKQKSNVNTEAESKKEANEQVADDAVVMXXXXXXXXXXXTPXXXX 360
           ANTATSLNEIPSTVDEKQKSNVNTEAESKKEANEQVADDAVVM           TP    
Sbjct: 301 ANTATSLNEIPSTVDEKQKSNVNTEAESKKEANEQVADDAVVMKEDPKDDKKDDTPLEES 360

Query: 361 XXXXXXXXXXXXFVSNTTAAVETMEEIADSSEILGLIKLFQNFQLVYFRQCVQEVEANLK 420
                       FVSNTTAAVETMEEIADSSEILGLIKLFQNFQLVYFRQCVQEVEANLK
Sbjct: 361 EENKLLEKLEDEFVSNTTAAVETMEEIADSSEILGLIKLFQNFQLVYFRQCVQEVEANLK 420

Query: 421 VLNGLEN 427
           VLNGLEN
Sbjct: 421 VLNGLEN 427

>YPR148C Chr16 complement(826833..828140) [1308 bp, 435 aa] {ON}
           Protein of unknown function that may interact with
           ribosomes, based on co-purification experiments; green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm in a punctate pattern
          Length = 435

 Score =  574 bits (1480), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/435 (74%), Positives = 336/435 (77%), Gaps = 10/435 (2%)

Query: 1   MSGYFSSFSLNKITDSIATAAHKTHDTXXXXXXXXXXXXXDPQTRLSIKSRTRFVQESLG 60
           MSGYFS FSLNKITDSIATAAHKT DT             DPQTRLSIKSRTRFVQESLG
Sbjct: 1   MSGYFSGFSLNKITDSIATAAHKTQDTLNNALANANVNLNDPQTRLSIKSRTRFVQESLG 60

Query: 61  TISDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKD 120
           T+SDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKD
Sbjct: 61  TVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKD 120

Query: 121 GWFGSKKSEITNKKKGSNHDDAFLPRSFAQAISKAAVDCEFEFQNLENDEKAELKKKRES 180
           GWFGSKKSE + KKKGSNHDDAFLPRSFAQAISKAAVDCE EFQNLE++EKAELKKK+ES
Sbjct: 121 GWFGSKKSESSTKKKGSNHDDAFLPRSFAQAISKAAVDCECEFQNLEHNEKAELKKKKES 180

Query: 181 TKNAQTT---GAQXXXXXXXXXXXXXXXXXLSNLIKVFDSWSTCYKNIDEGKTEMDSMMV 237
            K AQTT   GA                  LSNLIKVFDSWSTCYKNIDEGK EMDSMMV
Sbjct: 181 IKTAQTTEAQGADHNEEDEEDEEDEEDDEDLSNLIKVFDSWSTCYKNIDEGKAEMDSMMV 240

Query: 238 KEFNKKLEKLINQDFKRVHELRKKVEISRLKFDTMRYEVKAKEAQLDAQKPGVTEEAHTK 297
           KEFNKKLE LINQDFK+VH+LRKKVE SRLKFDTMRYEVKAKEA+L+A+K   T EAH+K
Sbjct: 241 KEFNKKLETLINQDFKKVHDLRKKVEESRLKFDTMRYEVKAKEAELEAKKAEATGEAHSK 300

Query: 298 DV-----SANTATSLNEIPSTVDEKQKSNVNTEAESKKEANEQVADD-AVVMXXXXXXXX 351
           DV     SANT TS +E PST DEK KS    E ESKKEANE   DD A           
Sbjct: 301 DVSAKDISANTTTSFDETPSTEDEKPKSE-GAEEESKKEANEPTVDDVADRKEDLKSNKV 359

Query: 352 XXXTPXXXXXXXXXXXXXXXXFVSNTTAAVETMEEIADSSEILGLIKLFQNFQLVYFRQC 411
               P                FVSNTTAAVETMEEI DSSEILGLIKLFQNFQLVYFRQC
Sbjct: 360 NDEPPIEESEDNKLLEKLEDEFVSNTTAAVETMEEITDSSEILGLIKLFQNFQLVYFRQC 419

Query: 412 VQEVEANLKVLNGLE 426
           VQEVEANLKVLNGLE
Sbjct: 420 VQEVEANLKVLNGLE 434

>Skud_16.443 Chr16 complement(780561..781823) [1263 bp, 420 aa] {ON}
           YPR148C (REAL)
          Length = 420

 Score =  565 bits (1456), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/427 (69%), Positives = 321/427 (75%), Gaps = 7/427 (1%)

Query: 1   MSGYFSSFSLNKITDSIATAAHKTHDTXXXXXXXXXXXXXDPQTRLSIKSRTRFVQESLG 60
           MSGYFS FSLNKITDSIATAAHKT DT             DP+TRLSIKSRTRFVQESLG
Sbjct: 1   MSGYFSGFSLNKITDSIATAAHKTQDTLNNALASANVNLNDPETRLSIKSRTRFVQESLG 60

Query: 61  TISDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKD 120
           T+SDISKLPPQYQFLEKKSDSLEKVC+RILLVSKTFEVEGYDYPPNLTESISDWWS+NKD
Sbjct: 61  TVSDISKLPPQYQFLEKKSDSLEKVCRRILLVSKTFEVEGYDYPPNLTESISDWWSVNKD 120

Query: 121 GWFGSKKSEITNKKKGSNHDDAFLPRSFAQAISKAAVDCEFEFQNLENDEKAELKKKRES 180
           GWFGS+KSE  NKKK SNHDDAFLPRSFAQAISKAAVDCE EFQ+L+ DEKA LKKK ES
Sbjct: 121 GWFGSRKSENANKKKVSNHDDAFLPRSFAQAISKAAVDCECEFQSLKQDEKAGLKKKSES 180

Query: 181 TKNAQTTGAQXXXXXXXXXXXXXXXXXLSNLIKVFDSWSTCYKNIDEGKTEMDSMMVKEF 240
            + AQ   AQ                 LSNLIKVFDSWSTCYKNIDEGK EMDS M+KEF
Sbjct: 181 NETAQDAEAQ------EEDEEDEEDEDLSNLIKVFDSWSTCYKNIDEGKAEMDSTMIKEF 234

Query: 241 NKKLEKLINQDFKRVHELRKKVEISRLKFDTMRYEVKAKEAQLDAQKPGVTEEAHTKDVS 300
           NKKLEKLIN+DFK+VHELRKKVE SRLKFDTMRYEVK+KEA+L AQK   ++E   K VS
Sbjct: 235 NKKLEKLINKDFKKVHELRKKVEDSRLKFDTMRYEVKSKEAKLKAQKAETSKEVDDKAVS 294

Query: 301 ANTATSLNEIPSTVDEKQKSNVNTEAESKKEANEQVADDAVVMXXXXXXXXXXXTPXXXX 360
           AN   S +E P+T DE   S  + E +SKKE +   ADDA V+                 
Sbjct: 295 ANAPISPDENPTTEDESPISK-DLEGDSKKETSGSAADDAAVVKEDSKANQGDEPTIEDL 353

Query: 361 XXXXXXXXXXXXFVSNTTAAVETMEEIADSSEILGLIKLFQNFQLVYFRQCVQEVEANLK 420
                       FVSNTT AVE MEEI DSS+ILGL+KLFQNFQLVYFRQCVQEVEANLK
Sbjct: 354 EENKLLEKLEDEFVSNTTTAVEIMEEITDSSDILGLVKLFQNFQLVYFRQCVQEVEANLK 413

Query: 421 VLNGLEN 427
           VLN LEN
Sbjct: 414 VLNSLEN 420

>Suva_16.477 Chr16 complement(823311..824582) [1272 bp, 423 aa] {ON}
           YPR148C (REAL)
          Length = 423

 Score =  530 bits (1365), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/431 (66%), Positives = 313/431 (72%), Gaps = 12/431 (2%)

Query: 1   MSGYFSSFSLNKITDSIATAAHKTHDTXXXXXXXXXXXXXDPQTRLSIKSRTRFVQESLG 60
           MSGY+     NKITDSIATAAHKT DT             DPQTRLSIKSRTRFVQESLG
Sbjct: 1   MSGYW-----NKITDSIATAAHKTQDTLNSALANANVNLNDPQTRLSIKSRTRFVQESLG 55

Query: 61  TISDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKD 120
           T+SDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKD
Sbjct: 56  TVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKD 115

Query: 121 GWFGSKKSEITNKKKGSNHDDAFLPRSFAQAISKAAVDCEFEFQNLENDEKAELKKKRES 180
           GWFGSKK+E  +KKK SNHDD FLPRSFAQAISKAAVDCE EF+NLE +EK +LK+K+E+
Sbjct: 116 GWFGSKKTEHASKKKDSNHDDTFLPRSFAQAISKAAVDCESEFKNLEQNEKEDLKQKKEA 175

Query: 181 TKNAQTTGAQXXXXXXXXXXXXXXXXXLSNLIKVFDSWSTCYKNIDEGKTEMDSMMVKEF 240
            K  Q T  Q                 LSNLIKVFDSWSTCYKNIDEGK EMDSMMVKEF
Sbjct: 176 KKTTQETAEQ--EEEEEEEEEEEDDEDLSNLIKVFDSWSTCYKNIDEGKAEMDSMMVKEF 233

Query: 241 NKKLEKLINQDFKRVHELRKKVEISRLKFDTMRYEVKAKEAQLDAQKPGVTEEAHTKDVS 300
           NKKLEKLIN+DFK+VHELR+KVE SRLKFDTMRYE K+KE QL AQK   ++EA   D S
Sbjct: 234 NKKLEKLINEDFKKVHELRRKVEESRLKFDTMRYEGKSKEEQLRAQKDETSKEADNNDNS 293

Query: 301 ANTATSLNEIPSTVDEKQKSN---VNTEAESKKEANEQVADDAV-VMXXXXXXXXXXXTP 356
           AN +TSL E  +   + +K +   V  E   K E +   A+D +               P
Sbjct: 294 AN-STSLEEALTAEKKAEKEDDAKVPEEEPKKVETDVTTANDDIDTNENPKQQPTNNQPP 352

Query: 357 XXXXXXXXXXXXXXXXFVSNTTAAVETMEEIADSSEILGLIKLFQNFQLVYFRQCVQEVE 416
                           FVSNTTAAVETMEEI DSSEIL L+KLFQNFQLVYFRQC QEVE
Sbjct: 353 VEDSEENKLLEKLEDEFVSNTTAAVETMEEITDSSEILSLVKLFQNFQLVYFRQCAQEVE 412

Query: 417 ANLKVLNGLEN 427
           ANLKVLNG+EN
Sbjct: 413 ANLKVLNGMEN 423

>TDEL0D05590 Chr4 complement(1008107..1009141) [1035 bp, 344 aa]
           {ON} Anc_3.491 YPR148C
          Length = 344

 Score =  403 bits (1036), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 227/427 (53%), Positives = 261/427 (61%), Gaps = 86/427 (20%)

Query: 1   MSGYFSSFSLNKITDSIATAAHKTHDTXXXXXXXXXXXXXDPQTRLSIKSRTRFVQESLG 60
           MSGY S+FSLNKITD++A AAHKT DT             DPQ +LS+K+RTR++QE+LG
Sbjct: 1   MSGYLSNFSLNKITDTLANAAHKTQDTLNSAIANVS----DPQAKLSLKARTRYLQETLG 56

Query: 61  TISDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKD 120
           TI D SKLPPQYQ LEKKSD+LEK CKRILLV++TFEVEGYDYPPNLTESISDWWSLNKD
Sbjct: 57  TIDDKSKLPPQYQSLEKKSDALEKCCKRILLVTRTFEVEGYDYPPNLTESISDWWSLNKD 116

Query: 121 GWFGSKKSEITNKKKGSNHDDAFLPRSFAQAISKAAVDCEFEFQNLENDEKAELKKKRES 180
           GWFG+KK E T K   S+  DAFLPRSF+QAISKAA DC   F NL              
Sbjct: 117 GWFGTKKPEKT-KNDSSDGSDAFLPRSFSQAISKAANDCNSVFTNL-------------- 161

Query: 181 TKNAQTTGAQXXXXXXXXXXXXXXXXXLSNLIKVFDSWSTCYKNIDEGKTEMDSMMVKEF 240
               Q  G +                 +SN+ K+FDSWS CYKNIDEGK EMDSM+ KEF
Sbjct: 162 ----QEHGDEDEEDED-----------VSNVAKMFDSWSKCYKNIDEGKHEMDSMIRKEF 206

Query: 241 NKKLEKLINQDFKRVHELRKKVEISRLKFDTMRYEVKAKEAQLDAQKPGVTEEAHTKDVS 300
           N KLEK+IN+DFK+VH  RKKVE SRLKFDT+RYE+K KE               T++  
Sbjct: 207 NTKLEKIINEDFKKVHASRKKVEESRLKFDTVRYEIKLKE---------------TENAK 251

Query: 301 ANTATSLNEIPSTVDEKQKSNVNTEAESKKEANEQVADDAVVMXXXXXXXXXXXTPXXXX 360
            +T T         DE  K    TE E                            P    
Sbjct: 252 KSTET---------DEASKDETKTEEE----------------------------PPKTS 274

Query: 361 XXXXXXXXXXXXFVSNTTAAVETMEEIADSSEILGLIKLFQNFQLVYFRQCVQEVEANLK 420
                       FVSNTTAAVE M E+ +S+EILGL KLFQNFQLVYFRQCVQEVEA+LK
Sbjct: 275 EEDKLLEELEDEFVSNTTAAVEIMGEVTESAEILGLAKLFQNFQLVYFRQCVQEVEASLK 334

Query: 421 VLNGLEN 427
           +L  LE+
Sbjct: 335 ILGALES 341

>SAKL0F02794g Chr6 (238272..239465) [1194 bp, 397 aa] {ON} similar
           to uniprot|Q06523 Saccharomyces cerevisiae YPR148C
           Protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm in a
           punctate pattern
          Length = 397

 Score =  350 bits (898), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 202/437 (46%), Positives = 266/437 (60%), Gaps = 51/437 (11%)

Query: 1   MSGYFSSFSLNKITDSIATAAHKTHDTXXXXXXXXXXXXXDPQTRLSIKSRTRFVQESLG 60
           MSGYFSSFSL+K+T+SI++AAHKT D              DPQ +LS+K R  ++QE+LG
Sbjct: 1   MSGYFSSFSLDKLTNSISSAAHKTQD--KLSTAIANIQLDDPQAKLSLKVRKHYLQETLG 58

Query: 61  TISDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKD 120
            I DISKLPPQYQFLEKK DSLEK+C+R+L+V+KTFEVEGYDYPPNL+ESISDWW  N+ 
Sbjct: 59  AIDDISKLPPQYQFLEKKCDSLEKICRRMLVVTKTFEVEGYDYPPNLSESISDWWGANRS 118

Query: 121 GWF----GSKKSEITNKKKGSNHDDAFLPRSFAQAISKAAVDCEFEFQNLENDEKAELKK 176
           G      G K      K +  + ++ FLPRSFAQA+SKAA D     + L++++K   + 
Sbjct: 119 GLLSFMDGKKGEGSRAKAEEKDENEGFLPRSFAQALSKAAKDSGDVLRTLKDEQKEPPQD 178

Query: 177 KRESTKNAQTTGAQXXXXXXXXXXXXXXXXXLSNLIKVFDSWSTCYKNIDEGKTEMDSMM 236
           + E                            +++LI +F++WS C + ID+ K EMDS+M
Sbjct: 179 EDEDEDED-----------------------INSLITMFEAWSKCEQKIDQEKAEMDSLM 215

Query: 237 VKEFNKKLEKLINQDFKRVHELRKKVEISRLKFDTMRYEVKAKEAQLDAQKPGVTEEAHT 296
            KEFNKKL+KLIN+DFK+VH LRKKVE SRLKFDT+RYE+  KE +   QK    EE + 
Sbjct: 216 AKEFNKKLDKLINEDFKKVHSLRKKVEESRLKFDTLRYELNLKEKE--QQKAKAKEEENE 273

Query: 297 K-DVSANTATSLNEIPSTVDEKQKSNVNTEAESKK---EANEQVADDAV--VMXXXXXXX 350
           K DV    A          +EK K+     +E K+   +A+E++++D    +        
Sbjct: 274 KVDVVEQNAP---------EEKAKTEGQETSEGKEHDLKADEKLSEDTASKIPESVENEE 324

Query: 351 XXXXTPXXXXXXXXXXXXXXXXFVSNTTAAVETMEEIADSSEILGLIKLFQNFQLVYFRQ 410
                P                FVS+TT AVE M EI DSSEIL L+KLF  FQL+Y RQ
Sbjct: 325 VDNEDP-----EHKLLEKLEDEFVSSTTEAVEIMGEITDSSEILSLVKLFHKFQLIYHRQ 379

Query: 411 CVQEVEANLKVLNGLEN 427
           CVQE+EA+ K+L+GL+N
Sbjct: 380 CVQELEASTKILDGLDN 396

>ZYRO0D10010g Chr4 (845993..847141) [1149 bp, 382 aa] {ON} similar
           to uniprot|Q06523 Saccharomyces cerevisiae YPR148C
           Protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm in a
           punctate pattern
          Length = 382

 Score =  345 bits (886), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 196/431 (45%), Positives = 256/431 (59%), Gaps = 53/431 (12%)

Query: 1   MSGYFSSFSLNKITDSIATAAHKTHDTXXXXXXXXXXXXXDPQTRLSIKSRTRFVQESLG 60
           MS YFSSFS   + DSIA AAH+T D              DPQTRLSIK+RTR+++E+LG
Sbjct: 1   MSEYFSSFSFKNLGDSIANAAHRTQD--KLSNAVANVNLNDPQTRLSIKTRTRYLKETLG 58

Query: 61  TISDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKD 120
            + +ISKLPPQY  LE+KSD+LEK CKR+LLV++TFEVEGYDYPPNL ES SDWWS +K+
Sbjct: 59  AVDEISKLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDWWSGSKE 118

Query: 121 GWFGSKKSEITNKKK----GSNHDDAFLPRSFAQAISKAAVDCEFEFQNLENDEKAELKK 176
           GWFGS K +   + K    GS+ D   +PRSFAQAI+KA+ +C   +QN +  EK ++ +
Sbjct: 119 GWFGSTKQDEDGESKIQTDGSSKD-PLMPRSFAQAIAKASHECGEAYQNSQKSEKKQIDE 177

Query: 177 KRESTKNAQTTGAQXXXXXXXXXXXXXXXXXLSNLIKVFDSWSTCYKNIDEGKTEMDSMM 236
             +                              NL+++F++ S CY+NIDEGK EMD  +
Sbjct: 178 DEDDV----------------------------NLVEMFNTLSICYRNIDEGKDEMDKSI 209

Query: 237 VKEFNKKLEKLINQDFKRVHELRKKVEISRLKFDTMRYEVKAKEAQLDAQKPGVTEEAHT 296
            +EFN KLE+L+N+DFK++H LR KVE SRLKFDTMRYE++ KE +          E   
Sbjct: 210 AREFNDKLEQLLNRDFKKIHVLRNKVENSRLKFDTMRYEMRLKEKE----------EKEE 259

Query: 297 KDVSANTATSLNEIPSTVDEKQKSNVNTEAESKKEANEQVADDAVVMXXXXXXXXXXXTP 356
            + +AN     +E PS  ++++ +N   + E K    E                     P
Sbjct: 260 NENTANA----DEGPSNKNQQEPTNEPAKEEEKPTPAEPAEAQHTTKTENSNKEPMVEKP 315

Query: 357 XXXXXXXXXXXXXXXXFVSNTTAAVETMEEIADSSEILGLIKLFQNFQLVYFRQCVQEVE 416
                           FVSNT+ AVETM  I + SEIL L+KLFQN QLVY+RQCVQE+E
Sbjct: 316 EDNKLLEQLEDE----FVSNTSEAVETMTSIVEGSEILRLMKLFQNLQLVYYRQCVQEME 371

Query: 417 ANLKVLNGLEN 427
           A+LK LN LEN
Sbjct: 372 ASLKGLNDLEN 382

>KLTH0F14806g Chr6 complement(1212362..1213438) [1077 bp, 358 aa]
           {ON} similar to uniprot|P40531 Saccharomyces cerevisiae
           YIL041W GVP36 Golgi-vesicle protein of unknown function
           green fluorescent protein (GFP)-fusion protein localizes
           to the cytoplasm
          Length = 358

 Score =  332 bits (850), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 192/429 (44%), Positives = 243/429 (56%), Gaps = 76/429 (17%)

Query: 1   MSGYFSSFSLNKITDSIATAAHKTHDTXXXXXXXXXXXXXDPQTRLSIKSRTRFVQESLG 60
           MS YF  FSLNK+T+SI   AHKT DT             DPQ +LS+K+R  ++QE+LG
Sbjct: 1   MSNYFGGFSLNKLTNSITNVAHKTQDTLSTAIANIQLD--DPQAKLSLKARKHYLQETLG 58

Query: 61  TISDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKD 120
           TI DISKLPPQYQFLEKK DSLEKVC+R+L+V+KT+EVEGYDYPPNL+ES+SDWWS NK+
Sbjct: 59  TIEDISKLPPQYQFLEKKCDSLEKVCRRMLVVTKTYEVEGYDYPPNLSESLSDWWSSNKE 118

Query: 121 GWFGSKKSEITNKKKGSNHD--DAFLPRSFAQAISKAAVDCEFEFQNLENDEKAELKKKR 178
           G FG   S    KK     D  +A +PRSFAQAISKAA D                    
Sbjct: 119 GLFGFVSSSKKEKKLEPAEDSKEALMPRSFAQAISKAAKD-------------------- 158

Query: 179 ESTKNAQTTGAQXXXXXXXXXXXXXXXXXLSNLIKVFDSWSTCYKNIDEGKTEMDSMMVK 238
               + +   A                  +++LIK+F++WS C  N+D+ K EMD++MVK
Sbjct: 159 ----SGEVMTALKTEEQKASAEEDEEDEDITSLIKMFEAWSACQHNMDQSKAEMDALMVK 214

Query: 239 EFNKKLEKLINQDFKRVHELRKKVEISRLKFDTMRYEVKAKEAQLDAQKPGVTEEAHTKD 298
           EFN KL   + + FK    LRKKVE SRLKFDTMRYE+K  E Q      G TEEA  + 
Sbjct: 215 EFNHKLTAFVEEKFKNARTLRKKVEDSRLKFDTMRYELKMAEEQ------GKTEEAAQQ- 267

Query: 299 VSANTATSLNEIPSTVDEKQKSNVNTEAESKKEANEQVADDAVVMXXXXXXXXXXXTPXX 358
                            E QK   + EAE+ K+++   +D+A  +               
Sbjct: 268 ----------------TESQKPQED-EAEASKDSDS--SDEAQKL--------------- 293

Query: 359 XXXXXXXXXXXXXXFVSNTTAAVETMEEIADSSEILGLIKLFQNFQLVYFRQCVQEVEAN 418
                         FVSNTT AVETM EI DS+EI+ L+KLF NFQL+Y++QCVQ +E +
Sbjct: 294 -------LEKLEDEFVSNTTEAVETMGEITDSAEIINLVKLFHNFQLIYYKQCVQNLETS 346

Query: 419 LKVLNGLEN 427
           +  LN LE 
Sbjct: 347 INSLNELEG 355

>Kwal_55.21227 s55 complement(739317..740447) [1131 bp, 376 aa] {ON}
           YPR148C - Hypothetical ORF [contig 130] FULL
          Length = 376

 Score =  330 bits (846), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 195/436 (44%), Positives = 252/436 (57%), Gaps = 72/436 (16%)

Query: 1   MSGYFSSFSLNKITDSIATAAHKTHDTXXXXXXXXXXXXXDPQTRLSIKSRTRFVQESLG 60
           MS YF  FS NK+TD++  AAHKT DT             DPQ  LS+K+R  ++QE+LG
Sbjct: 1   MSSYFGGFSFNKLTDTLTNAAHKTQDTLSTAIANIQLD--DPQAILSLKARKHYLQETLG 58

Query: 61  TISDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKD 120
           TI DISKLPPQYQ LEKK DSLEK C+R+L+V+KTFEVEGYDYPPNL+ES+SDWWS NK+
Sbjct: 59  TIEDISKLPPQYQLLEKKCDSLEKACRRMLVVTKTFEVEGYDYPPNLSESLSDWWSSNKE 118

Query: 121 GWFGSKKSEITNKKKG----SNHDDAFLPRSFAQAISKAAVDCEFEFQNLENDEKAELKK 176
           G FG   S  + K KG    +    A +PRSFAQAI+KAA D          D  A LK 
Sbjct: 119 GLFGLMSS--SKKDKGAESAAAAKSALMPRSFAQAIAKAAKDS--------GDVLAALKD 168

Query: 177 KRESTKNAQTTGAQXXXXXXXXXXXXXXXXXLSNLIKVFDSWSTCYKNIDEGKTEMDSMM 236
           + +     +    +                 ++ LIK+F +WS C   ID+GK EMD++M
Sbjct: 169 QEQQASADEEDEDE----------------DITPLIKMFSAWSECQYKIDQGKAEMDALM 212

Query: 237 VKEFNKKLEKLINQDFKRVHELRKKVEISRLKFDTMRYEVKAKEAQ----LDAQKPGVTE 292
            KEFN+KL  LI + FK    LR+KVE SRLKFDTMRYEVK  E Q    ++ +K    E
Sbjct: 213 AKEFNQKLNALIEEKFKNASVLRRKVEDSRLKFDTMRYEVKLTEQQSKQAMENEKAQFKE 272

Query: 293 -EAHTKDVSANTATSLNEIPSTVDEKQKSNVNTEAESKKEANEQVADDAVVMXXXXXXXX 351
            +  +K+  A+   + NE+  +V + ++     +A   +E  E++ D+            
Sbjct: 273 SDLSSKEEGADANETSNEVGKSVTKTKEEQATNDA--AQELLEKLEDE------------ 318

Query: 352 XXXTPXXXXXXXXXXXXXXXXFVSNTTAAVETMEEIADSSEILGLIKLFQNFQLVYFRQC 411
                                FVSNTT AVETM EI DS+E+L L+KLF NFQLVY RQC
Sbjct: 319 ---------------------FVSNTTEAVETMGEITDSAELLNLVKLFHNFQLVYHRQC 357

Query: 412 VQEVEANLKVLNGLEN 427
           VQ++EA+L  LN LE 
Sbjct: 358 VQDLEASLSTLNELEG 373

>KLLA0E04621g Chr5 (412009..413178) [1170 bp, 389 aa] {ON} some
           similarites with uniprot|Q06523 Saccharomyces cerevisiae
           YPR148C Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 389

 Score =  301 bits (772), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 182/429 (42%), Positives = 248/429 (57%), Gaps = 50/429 (11%)

Query: 5   FSSFSLNKITDSIATAAHKTHDTXXXXXXXXXXXXXDPQTRLSIKSRTRFVQESLGTISD 64
           FS  SLN ITDSI+ AA +T +              DP+TRLSI  R   +QE+LGT+ D
Sbjct: 2   FSKLSLNNITDSISNAAQRTQE--QFSSAIEKIHLDDPETRLSILKRRHQLQETLGTVHD 59

Query: 65  ISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKDGW-- 122
           IS+LP QY+FLE+KSD+LEK+CKR+LLV+KTFEVEGYDYPPNLTES +DWWS NKD    
Sbjct: 60  ISQLPIQYKFLEQKSDALEKICKRLLLVTKTFEVEGYDYPPNLTESFNDWWSGNKDSIFS 119

Query: 123 FGSKKSEITNKKKGSNHDDAFLPRSFAQAISKAAVDCEFEFQNLENDE---KAELKKKRE 179
           F  KK+E++ + K +  ++  LPRSFAQA+SKAA D     + L+ +E     E  ++  
Sbjct: 120 FSKKKAEVSPEVKETA-ENGLLPRSFAQALSKAATDSALILKQLKAEETRTNQEESQEGA 178

Query: 180 STKNAQTTGAQXXXXXXXXXXXXXXXXXLSNLIKVFDSWSTCYKNIDEGKTEMDSMMVKE 239
             K A+ T A+                   NLIK F+SW+ C  +ID+ K EMDS+MVKE
Sbjct: 179 DQKPAEETKAEPELEAEADEDEDEDEDV-DNLIKAFESWTKCQLSIDQSKAEMDSLMVKE 237

Query: 240 FNKKLEKLINQDFKRVHELRKKVEISRLKFDTMRYEVKAKEAQLDAQKPGVTEEAHTKDV 299
           FN KL KLI  DFK+ HELR KV+ +RL FDT+R+E+K     L  Q+  V   A +++ 
Sbjct: 238 FNAKLSKLIETDFKKGHELRAKVQDARLNFDTLRHEIK-----LKLQEKEVV--ASSEEA 290

Query: 300 SANTATSLNEIPS-TVDEKQKSNVNTEAESKKEANEQVADDAVVMXXXXXXXXXXXTPXX 358
               AT   E P    +E+      TE +   +  E++ D                    
Sbjct: 291 EKKVATETPETPEKKTNEEPVDMAKTEEDPDSKLFERLED-------------------- 330

Query: 359 XXXXXXXXXXXXXXFVSNTTAAVETMEEIADSSEILGLIKLFQNFQLVYFRQCVQEVEAN 418
                         FVS T+  VE + E+ DSSEI+ L+KLF NFQL++++QCV+ +E +
Sbjct: 331 -------------QFVSATSETVEFLGELTDSSEIISLVKLFHNFQLIHYKQCVKSLEED 377

Query: 419 LKVLNGLEN 427
           L+VLN L++
Sbjct: 378 LEVLNSLDS 386

>Kpol_1017.7 s1017 (27496..28272,28322..28330,28419..28769) [1137
           bp, 378 aa] {ON}
           (27496..28272,28322..28330,28419..28769) [1137 nt, 379
           aa]
          Length = 378

 Score =  300 bits (768), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 183/433 (42%), Positives = 245/433 (56%), Gaps = 68/433 (15%)

Query: 5   FSSFSLNKITDSIATAAHKTHDTXXXXXXXXXXXX----XDPQTRLSIKSRTRFVQESLG 60
           FS FS++K+TDSI+  A KT +                  DP T+LSIKS+ RF+QE LG
Sbjct: 2   FSGFSIDKLTDSISNVALKTQENLTNALSNVNENLENYLNDPNTKLSIKSKARFIQEKLG 61

Query: 61  TISD-ISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNK 119
           TI+D  SKLPP Y  LE K+D++EK  KR+L V+KT+E EGYDYPPNLTES+SDWW+ N 
Sbjct: 62  TINDQPSKLPPTYTDLELKTDAIEKALKRLLTVTKTYETEGYDYPPNLTESLSDWWT-ND 120

Query: 120 DGWFGSKKSEITNKKKGSNH---DDAFLPRSFAQAISKAAVDCEFEFQNLENDEKAELKK 176
           D         +TN  +   +   + +FLPRSFAQAIS A+ D      ++ N  K   K 
Sbjct: 121 DN--------VTNTDENDENIQSNKSFLPRSFAQAISNASFDAASNVNSVTNTIKLNHKD 172

Query: 177 KRESTKNAQTTGAQXXXXXXXXXXXXXXXXXLSNLIKVFDSWSTCYKNIDEGKTEMDSMM 236
             E  ++ +                       S+L K+F+S   CY+NID GKTEMD ++
Sbjct: 173 DEEEEEDDEE---------------------WSDLHKIFESLGNCYRNIDNGKTEMDKLI 211

Query: 237 VKEFNKKLEKLINQDFKRVHELRKKVEISRLKFDTMRYEVKAKEAQLDAQKPGVTEEAHT 296
           V EFN KL+ LIN +FK VH+LRK VE SRLKFDTMRYE+K KE     ++     EA  
Sbjct: 212 VNEFNNKLKDLINTEFKNVHQLRKSVENSRLKFDTMRYELKIKE----WKRTXXXMEAED 267

Query: 297 KDVSANTATSLNEIP---STVDEKQKSNVNTEAESKKEANEQVADDAVVMXXXXXXXXXX 353
           K   +   TS  E P   ++  E  K  +N + +   E N +  +D  ++          
Sbjct: 268 KSDVSKKGTSKKETPKKEASKKETPKKEINKKEDITNEGNTENDNDNKLL---------- 317

Query: 354 XTPXXXXXXXXXXXXXXXXFVSNTTAAVETMEEIADSSEILGLIKLFQNFQLVYFRQCVQ 413
                              FVSNT  AVE MEE+ D+S+I+ L+KL+QNFQLVY++QC+Q
Sbjct: 318 -------------EKLEDEFVSNTQNAVEKMEELTDNSKIINLVKLYQNFQLVYYKQCIQ 364

Query: 414 EVEANLKVLNGLE 426
           E+E+NLK+LNGLE
Sbjct: 365 EIESNLKILNGLE 377

>TPHA0D03270 Chr4 complement(673063..674229) [1167 bp, 388 aa] {ON}
           Anc_3.491 YPR148C
          Length = 388

 Score =  281 bits (719), Expect = 8e-91,   Method: Compositional matrix adjust.
 Identities = 179/427 (41%), Positives = 232/427 (54%), Gaps = 48/427 (11%)

Query: 5   FSSFSLNKITDSIATAAHKTHDTXXXXXX----XXXXXXXDPQTRLSIKSRTRFVQESLG 60
           FS+FSL+K+TDSI+  A KT +                  DP T+LSI++R+R++QE LG
Sbjct: 2   FSNFSLDKLTDSISNVALKTQENFTNAITDLNNNIETILNDPNTKLSIRARSRYIQEQLG 61

Query: 61  TISD-ISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNK 119
           T+ D ISKLP QY  LE K+DS+EK+ KR+LLV+ TF  EGYDYPPNLTESISDWW+   
Sbjct: 62  TLDDEISKLPQQYVELEIKTDSVEKILKRLLLVTNTFATEGYDYPPNLTESISDWWA--- 118

Query: 120 DGWFGSKKSEITNKKKGSNHDDAFLPRSFAQAISKAAVDCEFEFQNLENDEKAELKKKRE 179
                  + E T  K        FLPRSFAQA++KA  D +      E + K +   K  
Sbjct: 119 -------EDETTENKN-------FLPRSFAQALAKAYSDSKLITDKAERNIKLQTSPKNT 164

Query: 180 STKNAQTTGAQXXXXXXXXXXXXXXXXXLSNLIKVFDSWSTCYKNIDEGKTEMDSMMVKE 239
            TK+      +                 L  L K F + S  + NID GK EMD+M+V E
Sbjct: 165 GTKDE---NPEAGAEEEVEADDDEEDEDLVTLGKAFKALSNSFTNIDNGKNEMDTMIVNE 221

Query: 240 FNKKLEKLINQDFKRVHELRKKVEISRLKFDTMRYEVKAKEAQLDAQKPGVTEEAHTKDV 299
           FNKKLE L+  +FK V +LR+ VE SRLKFDTMRY+VK KEA+         E+   K+V
Sbjct: 222 FNKKLEHLLEVEFKEVAQLRRNVENSRLKFDTMRYDVKLKEAK--------AEQEEAKEV 273

Query: 300 SANTATSLNEIPSTVDEKQKSNVNTEAESKKEANEQVADDAVVMXXXXXXXXXXXTPXXX 359
           S +      EI     E ++       E + E  +    D V                  
Sbjct: 274 STD-----KEIEKKESETKEPETKGTEEKEPETKDTEEKDPV----------KENEGENE 318

Query: 360 XXXXXXXXXXXXXFVSNTTAAVETMEEIADSSEILGLIKLFQNFQLVYFRQCVQEVEANL 419
                        FVSNT++AVE MEE+ DS++IL L+KLFQNFQLVY+RQCVQE+E NL
Sbjct: 319 DEDYKLLEQLEDEFVSNTSSAVEKMEELTDSAKILDLVKLFQNFQLVYYRQCVQEIENNL 378

Query: 420 KVLNGLE 426
           K ++ LE
Sbjct: 379 KTISDLE 385

>Ecym_1238 Chr1 (489922..491103) [1182 bp, 393 aa] {ON} similar to
           Ashbya gossypii AFR309C
          Length = 393

 Score =  281 bits (719), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 180/442 (40%), Positives = 236/442 (53%), Gaps = 74/442 (16%)

Query: 1   MSGYFSSFSLNKITDSIATAAHKTHDTXXXXXXXXXXXXX-----DPQTRLSIKSRTRFV 55
           MS YFS+FSL+KI  +I TAAHKT                     DPQT LS+++R   +
Sbjct: 1   MSSYFSNFSLDKIASTINTAAHKTQQKLNETQEQLTHAIHSINLDDPQTMLSLRTRKHQL 60

Query: 56  QESLGTISDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWW 115
           QE+LGTI DISKLPP+YQFLE+K D+ EKVC RIL+VSKTFEV+GYDYPPNL ESISDWW
Sbjct: 61  QETLGTIKDISKLPPRYQFLERKCDAFEKVCSRILVVSKTFEVDGYDYPPNLAESISDWW 120

Query: 116 --SLNKDG--W-FGSKKSEITNK-------KKGSNHDDAFLPRSFAQAISKAAVDCEFEF 163
             S  KDG  W FG K     NK       +K SN  + ++P SFAQAISKAA       
Sbjct: 121 GSSSKKDGVFWGFGKKSKNDKNKAEQKSSAEKKSN--EGYIPPSFAQAISKAA------- 171

Query: 164 QNLENDEKAELKKKRESTKNAQTTGAQXXXXXXXXXXXXXXXXXLSNLIKVFDSWSTCYK 223
               +D    LK+  E      + GA+                 + +L+ + ++W+    
Sbjct: 172 ----DDSITILKELNEEQLVNPSNGAE------------TEDEDVDSLMPILEAWAEAQS 215

Query: 224 NIDEGKTEMDSMMVKEFNKKLEKLINQDFKRVHELRKKVEISRLKFDTMRYEVKAKEAQL 283
           NIDE K +MD  M+ EFNKKL+ L+N DF +V  LRKKVE SRLKFDT+RYE       L
Sbjct: 216 NIDEAKQQMDQFMINEFNKKLDSLVNNDFLKVRALRKKVEESRLKFDTLRYE-------L 268

Query: 284 DAQKPGVTEEAHTKDVSANTATSLNEIPSTVDEKQKSNVNTEAESKKEANEQVADDAVVM 343
           + +K G              A+   E  +T++ +Q ++ + E E           D +  
Sbjct: 269 EMRKSG--------------ASQTKETFTTIESQQVNDKDKENE-----------DNLKP 303

Query: 344 XXXXXXXXXXXTPXXXXXXXXXXXXXXXXFVSNTTAAVETMEEIADSSEILGLIKLFQNF 403
                      +                 FVSNTT AV  M +I DS  +  L+KLF NF
Sbjct: 304 TIHNNTGIGSSSDEEDQKFRLLLEKAEDEFVSNTTDAVAYMTQITDSVNLSTLVKLFHNF 363

Query: 404 QLVYFRQCVQEVEANLKVLNGL 425
           QL+Y ++CVQE++A+L V+N L
Sbjct: 364 QLIYHKKCVQELQASLNVINTL 385

>NDAI0B05850 Chr2 complement(1418191..1419612) [1422 bp, 473 aa]
           {ON} Anc_3.491 YPR148C
          Length = 473

 Score =  274 bits (700), Expect = 6e-87,   Method: Compositional matrix adjust.
 Identities = 155/298 (52%), Positives = 186/298 (62%), Gaps = 24/298 (8%)

Query: 5   FSSFSLNKITDSIATAAHKTHDTXXXXXXXXXXXXXDPQTRLSIKSRTRFVQESLGTISD 64
           FSSFSL+KIT+SI  AA K  +T             DPQT+LSIKS+TR  QE LGTI D
Sbjct: 2   FSSFSLDKITNSIGNAAQKATNTLNNAINTAT----DPQTKLSIKSQTRLFQEQLGTIHD 57

Query: 65  ISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKDGWFG 124
           ISKLP QY+ LE K+DSLEK  KRILLVSKTFE+EGYDYPPNLTES SDWW++ K     
Sbjct: 58  ISKLPDQYKSLELKTDSLEKSIKRILLVSKTFEMEGYDYPPNLTESFSDWWNITKKSSSH 117

Query: 125 SKK----SEITNKKKGSNHDDA--------------FLPRSFAQAISKAAVDCEFEFQNL 166
            KK    +        ++HD+A              FLPRSFAQAISK+A+DC   +Q L
Sbjct: 118 RKKQISVNNKKKNNTDNDHDNATNVEPIENDITSSSFLPRSFAQAISKSAMDCTDIYQQL 177

Query: 167 ENDEKAELKKKRESTKNAQTTGAQXXXXXXXXXXXXXXXXXLSNLIKVFDSWSTCYKNID 226
              E A  +   +    AQ    +                 + NLIK F+SWS CYKNID
Sbjct: 178 SIQETATKETTIKDENEAQEEDDE--DAGEEEEEDDDDDEDIQNLIKAFESWSNCYKNID 235

Query: 227 EGKTEMDSMMVKEFNKKLEKLINQDFKRVHELRKKVEISRLKFDTMRYEVKAKEAQLD 284
           +GK+EMDSMM KEFN KLE LIN +FK+V+ LRKKV  SRLKFDT+R+E+K KE + D
Sbjct: 236 QGKSEMDSMMTKEFNNKLEDLINNEFKKVNTLRKKVADSRLKFDTVRHEIKIKEEEQD 293

 Score = 89.7 bits (221), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 40/55 (72%), Positives = 48/55 (87%)

Query: 373 FVSNTTAAVETMEEIADSSEILGLIKLFQNFQLVYFRQCVQEVEANLKVLNGLEN 427
           FVS+T +AVE M EI +SS I+GLIKLFQNFQLVY+RQCVQE+EANLK LN L++
Sbjct: 418 FVSSTASAVEMMTEITESSSIIGLIKLFQNFQLVYYRQCVQEIEANLKTLNELDH 472

>CAGL0L08492g Chr12 (931048..932205) [1158 bp, 385 aa] {ON} similar
           to uniprot|Q06523 Saccharomyces cerevisiae YPR148c
          Length = 385

 Score =  262 bits (670), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 155/406 (38%), Positives = 219/406 (53%), Gaps = 65/406 (16%)

Query: 41  DPQTRLSIKSRTRFVQESLGTISDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEG 100
           DP+T+LSIK++TRF+QE++G   DISKLPPQY  LEKK DS+EKV KRIL+V+KT+E+EG
Sbjct: 26  DPKTKLSIKAKTRFLQEAIGNERDISKLPPQYVVLEKKCDSIEKVLKRILIVTKTYEIEG 85

Query: 101 YDYPPNLTESISDWWSLNKDGWF-------------------GSKKSEITNKKKGSNHDD 141
           YDYPPN++ES+S WW   +  WF                   G++ S+    K+ S+   
Sbjct: 86  YDYPPNISESLSSWWQTKE--WFNISELTKNVIPKHGNVEKAGTEASKTLTDKEVSHEG- 142

Query: 142 AFLPRSFAQAISKAAVDCEFEFQNLENDEKAELKKKRESTKNAQTTGAQXXXXXXXXXXX 201
              P SFA AI++A  D +  F+++E  ++ E +                          
Sbjct: 143 ---PPSFASAIARAGKDSQLIFESIETKDEDEKEDI------------------------ 175

Query: 202 XXXXXXLSNLIKVFDSWSTCYKNIDEGKTEMDSMMVKEFNKKLEKLINQDFKRVHELRKK 261
                    L+K+F  WS C+  I + KTEMD MM+KEFN KLE  + ++F+++H LR K
Sbjct: 176 -------DELVKIFKIWSDCFYEISDSKTEMDQMMIKEFNVKLEDYLQKNFQKIHTLRAK 228

Query: 262 VEISRLKFDTMRYEVKAKEAQLDAQKPGVTEEAHTKDVSANTATSLNEIPSTVDEKQKSN 321
           VE SRL FDTMRYEV     Q D+++ G  +E     + AN         +  +EK+ +N
Sbjct: 229 VEESRLNFDTMRYEVAQTSKQTDSKELGNEDETKPSSMDAN--------KTNTEEKEAAN 280

Query: 322 VNTEAESKKEANEQVADDAVVMXXXXXXXXXXXTPXXXXXXXXXXXXXXXXFVSNTTAAV 381
              E + K E N  +AD+                                 FVSNTT AV
Sbjct: 281 DKVETKEKTETNATIADETKETKDTKDSEDLKE-DSKTSTDGQLLEQLEDEFVSNTTEAV 339

Query: 382 ETMEEIADSSEILGLIKLFQNFQLVYFRQCVQEVEANLKVLNGLEN 427
           E M E++++SE+L LIKLFQ FQL Y + CV+ +E +LK LN ++N
Sbjct: 340 EVMTEVSENSELLSLIKLFQTFQLSYHQHCVKSLEQSLKDLNAIDN 385

>KAFR0G03680 Chr7 complement(760604..761851) [1248 bp, 415 aa] {ON}
           Anc_3.491 YPR148C
          Length = 415

 Score =  261 bits (667), Expect = 9e-83,   Method: Compositional matrix adjust.
 Identities = 177/456 (38%), Positives = 243/456 (53%), Gaps = 76/456 (16%)

Query: 5   FSSFSLNKITDSIATAAH----KTHDTXXXXXXXXXXXXXDPQTRLSIKSRTRFVQESLG 60
           FS+F+ +KIT+SI+TAA     K +DT             D QT+L  K   RF QE +G
Sbjct: 2   FSNFNFDKITNSISTAAQSAQQKINDTILTP---------DVQTKLHFKKTARFWQEKVG 52

Query: 61  TISD--ISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLN 118
            I D  ISKLP  Y  LE K D+LEK+ KR+L+V+KT+E+EGYDYPPNL+ES++DWW   
Sbjct: 53  QIPDKEISKLPEGYLNLENKVDALEKILKRLLIVTKTYEIEGYDYPPNLSESLNDWW--- 109

Query: 119 KDGWFGSKKSEITNKKKGSNHDDAFLPRSFAQAISKAAVDCEFEFQNLENDEKAELKKKR 178
              W   KKS      K      +F+  SF  AISKAA D +    +L+ +++ +L K+ 
Sbjct: 110 ---WSDLKKS------KKHQEKSSFMNNSFPMAISKAAFDSKSILDDLK-EKQQDLPKEG 159

Query: 179 ESTKNAQTTGAQXXXXXXXXXXXXXXXXXLSNLIKVFDSWSTCYKNIDEGKTEMDSMMVK 238
           E  +                           NL++VF+S S CYKNID+ K EMD+M+VK
Sbjct: 160 EEPEEEVEEEDDDE---------------FLNLLEVFNSLSNCYKNIDKSKAEMDAMIVK 204

Query: 239 EFNKKLEKLINQDFKRVHELRKKVEISRLKFDTMRYEVKAKEAQLDAQKPGVTEEAHTKD 298
           EFN KLE LIN DFK+V +LR KV+ SRL+FDT+R+E+K KE    AQ+    E +   D
Sbjct: 205 EFNFKLEHLINNDFKKVSKLRTKVQDSRLEFDTLRHEIKLKEL---AQESIRQENSQKTD 261

Query: 299 VSANTATSLNEIPSTVDEKQKSNVNTEA-----ESKKEANEQVADDAVVMXXXXXXXXXX 353
           V    +T   E+P   +  ++  VN E+     E KK   ++ A+D V            
Sbjct: 262 VFKEDSTK--EVPPKEESTKEEQVNEESNKEETEKKKITEDKPAEDVVEKKTVEEQAEAK 319

Query: 354 XTPXXXXXXXXXXXXXXX-----------------------XFVSNTTAAVETMEEIADS 390
            T                                        FVSNT AAVE M E+ ++
Sbjct: 320 ETEKPAKEGSSKEEAPKEDVKHNGSSEEETEEYKLLEKLEDEFVSNTGAAVELMTELTET 379

Query: 391 SEILGLIKLFQNFQLVYFRQCVQEVEANLKVLNGLE 426
           SE++ L+KLFQNFQL++++QCVQE+E N+K L+ LE
Sbjct: 380 SEVINLVKLFQNFQLIHYKQCVQEIENNMKFLDQLE 415

>NCAS0F03540 Chr6 complement(707257..708591) [1335 bp, 444 aa] {ON}
           Anc_3.491 YPR148C
          Length = 444

 Score =  258 bits (659), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 136/274 (49%), Positives = 180/274 (65%), Gaps = 28/274 (10%)

Query: 5   FSSFSLNKITDSIATAAHKTHDTXXXXXXXXXXXXXDPQTRLSIKSRTRFVQESLGTISD 64
           FS+FSL+KIT+S+ATAA KT DT             DP T+LS++S+ R  QES+GT+ D
Sbjct: 2   FSNFSLDKITNSLATAAQKTSDTLSNAITTAT----DPATKLSLRSQKRLFQESIGTVHD 57

Query: 65  ISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKDGWFG 124
           IS LP QY  LE ++D+LEK  +RIL+VSKTFE+EGYDYPPNL+ES SDWWSL       
Sbjct: 58  ISTLPEQYTTLEARTDALEKCLRRILIVSKTFEMEGYDYPPNLSESFSDWWSL------- 110

Query: 125 SKKSEITNKKKGSNHDDAFLPRSFAQAISKAAVDCEFEFQNLENDEKAELKKKRESTKNA 184
              S    K++       FLPRSFAQAIS +A DC   +Q++ + +  + ++   + +  
Sbjct: 111 ---SSKKKKEQEKEDKKGFLPRSFAQAISNSAEDCVEIYQHVNDGDDEDKEENANNEEEN 167

Query: 185 QTTGAQXXXXXXXXXXXXXXXXXLSNLIKVFDSWSTCYKNIDEGKTEMDSMMVKEFNKKL 244
           +    +                 + NLIK FDSW+ CYKNID+GK EMDSMM+KEFN KL
Sbjct: 168 EEEDEEDED--------------VKNLIKTFDSWAKCYKNIDQGKAEMDSMMMKEFNAKL 213

Query: 245 EKLINQDFKRVHELRKKVEISRLKFDTMRYEVKA 278
           EKL+N++FK+VH LRK+V+ SRLKFDT+RYE+K 
Sbjct: 214 EKLLNEEFKKVHTLRKRVKDSRLKFDTVRYELKV 247

 Score = 96.3 bits (238), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 43/54 (79%), Positives = 49/54 (90%)

Query: 373 FVSNTTAAVETMEEIADSSEILGLIKLFQNFQLVYFRQCVQEVEANLKVLNGLE 426
           FVS+T +AVE MEEI DSSEI+GL+KLFQNFQLVY+RQCVQE+EANLK LN LE
Sbjct: 390 FVSSTASAVEMMEEITDSSEIIGLVKLFQNFQLVYYRQCVQEIEANLKTLNELE 443

>TBLA0D02980 Chr4 (723788..725119) [1332 bp, 443 aa] {ON} Anc_3.491
           YPR148C
          Length = 443

 Score =  249 bits (635), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 139/300 (46%), Positives = 186/300 (62%), Gaps = 34/300 (11%)

Query: 1   MSGYFSSFSLNKITDSIATAAHKTHDTXXXXXXXXXXXXXDPQTRLSIKSRTRFVQESLG 60
           MSGYFS+FSL+K+ DS+ +AA KT DT             DPQTRL++ S+  ++QES+G
Sbjct: 26  MSGYFSNFSLDKLADSLQSAAQKTQDTLSNAIQNVNIDWNDPQTRLTLLSKQHYLQESIG 85

Query: 61  TISDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKD 120
            I++ISKLP QY  LE+K+D+LEK+ KRIL+V+ TFE+EGYDYPPNL+ESIS+WW LN D
Sbjct: 86  QINEISKLPSQYNALERKTDALEKIIKRILIVTNTFEIEGYDYPPNLSESISEWW-LN-D 143

Query: 121 GWFGSKKSEITNKKKGSNHDDA-------------FLPRSFAQAISKAAVDCEFEFQNLE 167
                + ++ TN K  SN +               FLPRSF  AISKA+ D      NL 
Sbjct: 144 PLAFLRDNDNTNDKNKSNSNPPDTKSKSDSDSESSFLPRSFPHAISKASSDSSAILTNLN 203

Query: 168 NDEKAELKKKRESTKNAQTTGAQXXXXXXXXXXXXXXXXXLSNLIKVFDSWSTCYKNIDE 227
           N+EK E  K +   +  +                      +  LIKVFDSWS C KNID+
Sbjct: 204 NNEKLEFAKTKTEDEEYEDDED------------------IQLLIKVFDSWSLCNKNIDK 245

Query: 228 GKTEMDSMMVKEFNKKLEKLINQDFKRVHELRKKVEISRLKFDTMRYEV-KAKEAQLDAQ 286
            K + D +++K+FNKKL  L++ +FK V  LR KV+ +RLKFDTMRYE+ KA EA++ A+
Sbjct: 246 SKFQRDQLIIKQFNKKLTSLLDVEFKNVKALRLKVQDARLKFDTMRYEIAKAAEAKVRAE 305

 Score = 81.6 bits (200), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 36/53 (67%), Positives = 48/53 (90%)

Query: 373 FVSNTTAAVETMEEIADSSEILGLIKLFQNFQLVYFRQCVQEVEANLKVLNGL 425
           FVS+T+AAVETMEEI +SS+IL LIKLFQNFQL++++QC++EVE N+K+L  L
Sbjct: 388 FVSHTSAAVETMEEITESSKILDLIKLFQNFQLLHYQQCIKEVETNMKLLTDL 440

>AFR309C Chr6 complement(1000078..1001172) [1095 bp, 364 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR148C
          Length = 364

 Score =  212 bits (540), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 151/438 (34%), Positives = 219/438 (50%), Gaps = 89/438 (20%)

Query: 1   MSGYFSSFSLNKITDSIATAAHKTHDTXXXXXXXXXXXXX-----DPQTRLSIKSRTRFV 55
           MS YF + SL+K+ +++  AA KT                     DP+T LS+K+R R +
Sbjct: 1   MSAYFGAISLDKLANTLNNAAQKTQQKLSETQEHLTHAIQNIKIDDPKTILSLKTRKRQL 60

Query: 56  QESLGTISDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWW 115
           QE+LG+  DIS+LPPQY FLE+K D++E+VCK+IL+VSKTFEVEGYDYPPN TESISDWW
Sbjct: 61  QETLGSAKDISQLPPQYGFLERKCDAIEQVCKKILVVSKTFEVEGYDYPPNPTESISDWW 120

Query: 116 SLN-------KDGWFGSKKSEITNKKKGSNHDDAFLPRSFAQAISKAAVDCEFEFQNLEN 168
           + +       K G  G+ K +   +K+ +   D   P SFA A+ +AA   +   Q L+ 
Sbjct: 121 NTSTKETRFLKFGKGGTDKQKEDKQKQAAGSSD---PPSFAHALHRAAKGSQGIIQELKE 177

Query: 169 DEKAELKKKRESTKNAQTTGAQXXXXXXXXXXXXXXXXXLSNLIKVFDSWSTCYKNIDEG 228
             + E +++ E  ++ ++                        LIK+F +W+    N+D  
Sbjct: 178 QAEEEQEQEVEIDEDVES------------------------LIKMFGTWADAQYNMDIA 213

Query: 229 KTEMDSMMVKEFNKKLEKLINQDFKRVHELRKKVEISRLKFDTMRYEVKAKEAQLDAQKP 288
           K EMD  MVKEFN+KL+ L+              E+   K  T+R +V+      D  K 
Sbjct: 214 KREMDQFMVKEFNEKLKHLL--------------EVEFKKGHTLRRKVEESRLTFDTLK- 258

Query: 289 GVTEEAHTKDVSANTATSLNEIPSTVDEKQKSNVNTEAESKKEANEQVADDAVVMXXXXX 348
               E H +D +         +    DE +++   T +    +++   AD A        
Sbjct: 259 ---YEQHERDAA---------LAKKQDEAKQAEGATPSTGVTQSS--TADLAFY------ 298

Query: 349 XXXXXXTPXXXXXXXXXXXXXXXXFVSNTTAAVETMEEIADSSEILGLIKLFQNFQLVYF 408
                                   FVSNT  AVE M  IAD+++++ L+KLFQNFQLVY 
Sbjct: 299 ---------------AQLEDAEDEFVSNTAEAVEFMTSIADATKLISLVKLFQNFQLVYH 343

Query: 409 RQCVQEVEANLKVLNGLE 426
           R+CVQE+E +L  L  LE
Sbjct: 344 RKCVQELEVSLNSLTSLE 361

>KNAG0A07930 Chr1 complement(1265981..1267339) [1359 bp, 452 aa]
           {ON} Anc_3.491 YPR148C
          Length = 452

 Score =  197 bits (502), Expect = 8e-58,   Method: Compositional matrix adjust.
 Identities = 117/280 (41%), Positives = 166/280 (59%), Gaps = 27/280 (9%)

Query: 5   FSSFSLNKITDSIATAAHKTHDTXXXXXXXXXXXXXDPQTRLSIKSRTRFVQESLGTISD 64
           FS+FSL+K+T +I  AA    DT             D QT+L     TR+ QE +GTIS+
Sbjct: 2   FSNFSLDKLTSTITNAAQSAQDTIHNTILSP-----DAQTKLQFLKTTRYFQEKVGTISE 56

Query: 65  --ISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKDGW 122
             I+KLP  YQ L++KS+++EKV KR+L+V+KTFE+EGYDYPPN+TES++ WW  N+D  
Sbjct: 57  DEIAKLPEGYQRLQEKSEAMEKVLKRLLVVTKTFELEGYDYPPNVTESLNHWW--NED-- 112

Query: 123 FGSKKSEITNKKKGSNH--DDAFLPRSFAQAISKAAVDCEFEFQNLENDEKAE------L 174
                    NKKK +    D + L RSFA AI KA +D ++   +L+  +K        +
Sbjct: 113 --------ENKKKKTQDFGDSSILNRSFAIAIGKAVLDSQYILSDLKEQQKTRGTEEKKV 164

Query: 175 KKKRESTKNAQTTGAQXXXXXXXXXXXXXXXXXLSNLIKVFDSWSTCYKNIDEGKTEMDS 234
           K++ E+    +   A                  ++N+I  F  WS CYKNID+ K EMDS
Sbjct: 165 KREEEAEAAEEEDEADDGEQEAEDEEEEEEDIDMNNMISAFGLWSNCYKNIDQSKAEMDS 224

Query: 235 MMVKEFNKKLEKLINQDFKRVHELRKKVEISRLKFDTMRY 274
           M+VKEFN+KL  ++  DFK VH+L  +V+ SRL+FDT+R+
Sbjct: 225 MIVKEFNQKLTDMLEIDFKTVHKLCTRVQDSRLEFDTLRH 264

 Score = 80.5 bits (197), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 36/54 (66%), Positives = 46/54 (85%)

Query: 373 FVSNTTAAVETMEEIADSSEILGLIKLFQNFQLVYFRQCVQEVEANLKVLNGLE 426
           FVSN TAAVE M E+ DSSE++ L+KLFQN QLV++RQCVQE+EA++K L+ LE
Sbjct: 393 FVSNITAAVEKMTELTDSSELISLVKLFQNIQLVHYRQCVQELEASMKSLDELE 446

>TDEL0H02240 Chr8 (377524..378540) [1017 bp, 338 aa] {ON} Anc_7.221
           YIL041W
          Length = 338

 Score = 84.7 bits (208), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 58/232 (25%), Positives = 108/232 (46%), Gaps = 49/232 (21%)

Query: 49  KSRTRFVQESLGTISDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLT 108
           +S  R VQE LG ++DIS+LP +Y  LE+K D+++ + +  L V+  +E E YDYP  +T
Sbjct: 38  QSTQRLVQERLGQVTDISQLPREYLELERKVDTIKLIYENFLHVTSIYENESYDYPKYVT 97

Query: 109 ESISDWWSLNKDGWFGSKKSEITNKKKGSNHDDAFL-------PRSFAQAISKAAVDCEF 161
           ES++D+  +        K  E+++    S   +  +       PR+   A+SK ++    
Sbjct: 98  ESVNDFSKI-----VAHKVQELSHASSASEAQNILITPTPAKEPRTLNYALSKVSLISSE 152

Query: 162 EFQNLENDEKAELKKKRESTKNAQTTGAQXXXXXXXXXXXXXXXXXLSNLIKVFDSWSTC 221
              ++ + ++A++                                  S L+K    +S  
Sbjct: 153 YLNHIGDHDEAQVA---------------------------------SVLLK----YSDL 175

Query: 222 YKNIDEGKTEMDSMMVKEFNKKLEKLINQDFKRVHELRKKVEISRLKFDTMR 273
              + + + + D+M+   FNK+L+  +  +FK+  + RK VE  RL++D  R
Sbjct: 176 QAKVAQARLQQDTMIQTRFNKQLKDNLEHNFKKAQKARKDVEYKRLQYDVAR 227

>Kwal_47.18148 s47 complement(708086..709057) [972 bp, 323 aa] {ON}
           YIL041W - Hypothetical ORF [contig 197] FULL
          Length = 323

 Score = 80.5 bits (197), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 69/257 (26%), Positives = 117/257 (45%), Gaps = 55/257 (21%)

Query: 49  KSRTRFVQESLGTISDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLT 108
           +S  R +QE LG ++DIS+LP  Y  LE K D ++ V +  L V++ +E E YDYP N+ 
Sbjct: 57  QSTQRLMQEKLGQVTDISQLPQDYVELENKIDRMKLVYENFLKVTQVYENESYDYPNNVR 116

Query: 109 ESISDWWSLNKDGWFGSKKSEITNKKKGSNHDDAFL--------PRSFAQAISKAAVDCE 160
           +S++++ S+      G+K  E++ +   +N   + L        P++   A+SK A+   
Sbjct: 117 DSVNEFSSI-----VGTKLHELS-RATSTNEAQSVLISPGPHKDPKTLNYALSKVALTSS 170

Query: 161 FEFQNLENDEKAELKKKRESTKNAQTTGAQXXXXXXXXXXXXXXXXXLSNLIKVFDSWST 220
            E+ N                   ++ GA+                  S+L+K    +S 
Sbjct: 171 -EYLN-------------------KSPGAEDSEVS-------------SSLLK----YSD 193

Query: 221 CYKNIDEGKTEMDSMMVKEFNKKLEKLINQDFKRVHELRKKVEISRLKFDTMRYEVK--- 277
               I + +   D+++  +FNKKL   +  D  R  + RK VE  RL++D  R  +    
Sbjct: 194 VQAKIAQARLHQDTLIQTKFNKKLRAALADDLNRAQKARKNVENKRLQYDIARANLANAR 253

Query: 278 -AKEAQLDAQKPGVTEE 293
             KEA L  Q   + +E
Sbjct: 254 PEKEASLRVQMESLEDE 270

>KLTH0A03894g Chr1 complement(328648..329619) [972 bp, 323 aa] {ON}
           similar to uniprot|P40531 Saccharomyces cerevisiae
           YIL041W GVP36 Golgi-vesicle protein of unknown function
           green fluorescent protein (GFP)-fusion protein localizes
           to the cytoplasm
          Length = 323

 Score = 78.6 bits (192), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 65/254 (25%), Positives = 112/254 (44%), Gaps = 49/254 (19%)

Query: 49  KSRTRFVQESLGTISDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLT 108
           +S  R VQE LG ++DIS+LP +Y  LE K D +  V +  L V++ +E E YDYP N+ 
Sbjct: 57  QSTQRLVQEKLGQVTDISQLPQEYVELENKIDRVRLVYENFLKVTQVYENESYDYPNNVR 116

Query: 109 ESISDWWSLNKDGWFGSKKSEITNKKKG-----SNHDDAFLPRSFAQAISKAAVDCEFEF 163
           +S++++ S+         ++  TN+ +        H D   P++   A+SK A+      
Sbjct: 117 DSVNEFSSVVAGKLHDLSRATSTNEAQSVLIAPGPHKD---PKTLNYALSKVALTS---- 169

Query: 164 QNLENDEKAELKKKRESTKNAQTTGAQXXXXXXXXXXXXXXXXXLSNLIKVFDSWSTCYK 223
                   +E   K     +++ + A                     L+K    +S    
Sbjct: 170 --------SEYLNKSVGGDDSEVSNA---------------------LLK----YSDVQA 196

Query: 224 NIDEGKTEMDSMMVKEFNKKLEKLINQDFKRVHELRKKVEISRLKFDTMRYEVK----AK 279
            + + + + D+++   FNKKL  ++  D     + RK VE  RL++D  R  +      K
Sbjct: 197 KVAQARLQQDTLIQTRFNKKLRDILANDLNEAQKARKNVEHKRLQYDIARSNLANAKPEK 256

Query: 280 EAQLDAQKPGVTEE 293
           EA L  Q   + +E
Sbjct: 257 EASLRVQMESLEDE 270

>KLLA0E04511g Chr5 complement(406764..407672) [909 bp, 302 aa] {ON}
           similar to uniprot|P40531 Saccharomyces cerevisiae
           YIL041W GVP36 Golgi-vesicle protein of unknown function
           green fluorescent protein (GFP)-fusion protein localizes
           to the cytoplasm
          Length = 302

 Score = 76.6 bits (187), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 70/284 (24%), Positives = 129/284 (45%), Gaps = 68/284 (23%)

Query: 1   MSGYFSSFS--LNKITDSIATAAHKTHDTXXXXXXXXXXXXXDPQTRLSI--KSRTRFVQ 56
           MS YF SFS  + +++ S++  A +                 D +T L +   S  R +Q
Sbjct: 1   MSQYFDSFSKKVQELSTSVSQKAQEAQ---------LDQKFKDLKTNLPLLANSTQRMLQ 51

Query: 57  ESLGTISDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWS 116
           E LG ++DIS+LP +Y  LE + ++++ + +  L V+K +E E YDYP N+ ES+ ++  
Sbjct: 52  EKLGQVTDISQLPDEYVQLEHRVETIKLIYENFLKVTKIYENESYDYPSNVKESVDEFSK 111

Query: 117 LNKDGWFGSKKSEITNKKKGSNHDDAFL-------PRSFAQAISKAAVDCEFEFQNLEND 169
           L   G      S++TN+++  N     L       P++   A+SK A+      +++E++
Sbjct: 112 LV--GGKLHDLSKVTNREQAQN---VLLSSPQMKEPKTLNYALSKVALTSS---EHVEDE 163

Query: 170 EKAELKKKRESTKNAQTTGAQXXXXXXXXXXXXXXXXXLSNLIKVFDSWSTCYKNIDEGK 229
                                                 L+N +     +S     I + +
Sbjct: 164 -------------------------------------SLANFLA---KYSDSQTKIAQLR 183

Query: 230 TEMDSMMVKEFNKKLEKLINQDFKRVHELRKKVEISRLKFDTMR 273
            + D+M+  +FNK +++ + QD +   + RK VE  RL++D +R
Sbjct: 184 LQQDTMIQTKFNKAIKEKLEQDIETSTKARKLVEQKRLQYDVVR 227

>CAGL0L00891g Chr12 (108801..109826) [1026 bp, 341 aa] {ON} similar
           to uniprot|P40531 Saccharomyces cerevisiae YIL041w
          Length = 341

 Score = 73.2 bits (178), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 60/249 (24%), Positives = 111/249 (44%), Gaps = 52/249 (20%)

Query: 49  KSRTRFVQESLGTISDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLT 108
           +S  R VQE LG ++DIS+LP +Y  LE K D+++ V +  L V+  +E E YDYP  ++
Sbjct: 38  QSTQRMVQEKLGQVTDISQLPQEYLELENKVDTIKIVYEHFLQVTAVYENESYDYPKYVS 97

Query: 109 ESISDWWSLNKDGWFGSKKSEITNKKKGSNHDDAFL-------PRSFAQAISKAAVDCEF 161
           ES++++          +K  E++     +   +  +       P++   A+SK A++   
Sbjct: 98  ESVNEF-----SKNMAAKVQELSKATSATEAQNILVAPGPVKEPKTLNYAMSKVALNAS- 151

Query: 162 EFQNLENDEKAELKKKRESTKNAQTTGAQXXXXXXXXXXXXXXXXXLSNLIKVFDSWSTC 221
           E+ N   D+  + K                                   L KV  ++S  
Sbjct: 152 EYLNHSFDDPMDAK-----------------------------------LSKVLLNYSDV 176

Query: 222 YKNIDEGKTEMDSMMVKEFNKKLEKLINQDFKRVHELRKKVEISRLKFDTMRYEVK---- 277
              + + + + D+ +  +FNK + + + +   R ++ RK V+  RL++D  R  ++    
Sbjct: 177 QTKVAQARLQQDTQIQTKFNKVIRENLAESIARANKARKDVQSKRLQYDVARTNLQNAKP 236

Query: 278 AKEAQLDAQ 286
            KEA L  Q
Sbjct: 237 EKEAGLRVQ 245

>ZYRO0D16522g Chr4 complement(1371404..1372480) [1077 bp, 358 aa]
           {ON} similar to uniprot|P40531 Saccharomyces cerevisiae
           YIL041W GVP36 Golgi-vesicle protein of unknown function
           green fluorescent protein (GFP)-fusion protein localizes
           to the cytoplasm
          Length = 358

 Score = 73.6 bits (179), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 64/254 (25%), Positives = 111/254 (43%), Gaps = 57/254 (22%)

Query: 53  RFVQESLGTISDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESIS 112
           R++QE LG  +DIS++P +Y  L  K D+++ +    L V++ ++ E YDYP  + ESI+
Sbjct: 37  RYMQEKLGHATDISEMPQEYIDLTTKVDAIKLIYNHFLQVTQVYDNESYDYPKYINESIN 96

Query: 113 DWWSLNKDGWFGSKKSEITNKKKGSNHDDAFL---------PRSFAQAISKAAVDCEFEF 163
           ++         GSK  E+++    S H+   +         P++   A+S+ ++      
Sbjct: 97  EF-----SRTVGSKIQELSH--ASSAHEAHSILSAPGPSKDPKTLNYALSRVSLVSSECM 149

Query: 164 QNLENDEKAELKKKRESTKNAQTTGAQXXXXXXXXXXXXXXXXXLSNLIKVFDSWSTCYK 223
           ++L   + A L                                  S L+K    +S    
Sbjct: 150 EHLSTHDDALLA---------------------------------SYLMK----YSDIQS 172

Query: 224 NIDEGKTEMDSMMVKEFNKKLEKLINQDFKRVHELRKKVEISRLKFDTMRYEVKA----K 279
            + + +   DS++   FN KL + I+ + KR H +R+ VE  RL +D  R  ++     K
Sbjct: 173 RVAQARLHQDSLVQTHFNAKLREEIDGNLKRAHRVRRDVENKRLTYDASRTHLEKAKPEK 232

Query: 280 EAQLDAQKPGVTEE 293
           EAQL  Q     EE
Sbjct: 233 EAQLRVQMETAEEE 246

>Kpol_1070.19 s1070 (45405..46340) [936 bp, 311 aa] {ON}
           (45405..46340) [936 nt, 312 aa]
          Length = 311

 Score = 72.8 bits (177), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 53/232 (22%), Positives = 104/232 (44%), Gaps = 49/232 (21%)

Query: 49  KSRTRFVQESLGTISDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLT 108
           +S  R VQE LG ++DIS+LP +Y  LE++ D+++ V +  L ++  +E E YDYP  ++
Sbjct: 37  ESTQRLVQEKLGNVTDISQLPQEYIELERQVDTIKLVYEHFLQITAIYENESYDYPKYVS 96

Query: 109 ESISDWWSLNKDGWFGSKKSEITNKKKGSNHDDAFL-------PRSFAQAISKAAVDCEF 161
           +S++D+  +     F +K +E+++        +  +       PR+   A+SK A++   
Sbjct: 97  DSVNDFSKV-----FANKVTELSHATSAQEAQNILVTPGPAKEPRTLNYALSKVALNSSE 151

Query: 162 EFQNLENDEKAELKKKRESTKNAQTTGAQXXXXXXXXXXXXXXXXXLSNLIKVFDSWSTC 221
               L +  +  +                                    L+K    +S  
Sbjct: 152 SLAQLADPNEGPVADA---------------------------------LLK----FSDV 174

Query: 222 YKNIDEGKTEMDSMMVKEFNKKLEKLINQDFKRVHELRKKVEISRLKFDTMR 273
              I + +   D+++  +FNK+L + +  D  +  + RK V+  RL++D  R
Sbjct: 175 QAKIAQTRLHQDTLIQTKFNKQLREKLELDIGKASKARKDVQYKRLQYDVAR 226

>KAFR0I01950 Chr9 (398299..399291) [993 bp, 330 aa] {ON} Anc_7.221
           YIL041W
          Length = 330

 Score = 72.0 bits (175), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 55/232 (23%), Positives = 106/232 (45%), Gaps = 48/232 (20%)

Query: 49  KSRTRFVQESLGTISDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLT 108
           +S  R VQE LG ++DIS+LP +Y  LEKK DS++ + +  L V+  +E E YDYP  + 
Sbjct: 38  QSTQRLVQEKLGQVTDISQLPQEYLELEKKVDSIKLIHEHFLQVTSIYENESYDYPKVIK 97

Query: 109 ESISDWWSLNKDGWFGSKKSEITNKKKGSNHDDAFL-------PRSFAQAISKAAVDCEF 161
           +S++D+          +K +++++    S   +  +       P++   A+SK ++    
Sbjct: 98  DSVNDF-----SKTMAAKITDLSHASSASEAQNILISPGPIRDPKTLNYALSKVSLTA-- 150

Query: 162 EFQNLENDEKAELKKKRESTKNAQTTGAQXXXXXXXXXXXXXXXXXLSNLIKVFDSWSTC 221
                     +E+  +  ST N                         S L++    +S  
Sbjct: 151 ----------SEVINQVGSTPNESALS--------------------SKLLE----FSNV 176

Query: 222 YKNIDEGKTEMDSMMVKEFNKKLEKLINQDFKRVHELRKKVEISRLKFDTMR 273
              I + + + D+++  +FNK L   ++    + ++ RK+V+  RL++D  R
Sbjct: 177 QSKIAQARLQQDTLIQTKFNKALRDDLSTSLAKANKFRKEVQNKRLQYDVAR 228

>Suva_9.159 Chr9 (265174..266151) [978 bp, 325 aa] {ON} YIL041W
           (REAL)
          Length = 325

 Score = 71.6 bits (174), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 56/232 (24%), Positives = 104/232 (44%), Gaps = 49/232 (21%)

Query: 49  KSRTRFVQESLGTISDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLT 108
           +S  R VQE LG ++DIS+LP +Y  LE K D+++ +    L V+  +E   YDYP  + 
Sbjct: 33  QSTQRMVQERLGQVTDISQLPREYTELEDKVDTIKLIYNHFLGVTAIYENGSYDYPKYIN 92

Query: 109 ESISDWWSLNKDGWFGSKKSEITNKKKGSNHDDAFL-------PRSFAQAISKAAVDCEF 161
           ES++++ S        SK +E+T+    S   +  +       P++   A+SK A++   
Sbjct: 93  ESVNEFSS-----SLASKLTELTHATSASQAQNILVAPGPIKEPKTLNYALSKVALNSSE 147

Query: 162 EFQNLENDEKAELKKKRESTKNAQTTGAQXXXXXXXXXXXXXXXXXLSNLIKVFDSWSTC 221
               +   E+  L                                  S+L++    +S  
Sbjct: 148 CLNKMFPTEEQPLA---------------------------------SSLLQ----FSDV 170

Query: 222 YKNIDEGKTEMDSMMVKEFNKKLEKLINQDFKRVHELRKKVEISRLKFDTMR 273
              I + + + D+++  +FNKKL + ++ +  +  + RK+V   RL++D  R
Sbjct: 171 QAKIAQARIQQDTLIQTKFNKKLRERVSFEIGKADKCRKEVHSMRLRYDVAR 222

>SAKL0F08162g Chr6 complement(622302..623294) [993 bp, 330 aa] {ON}
           highly similar to uniprot|Q75AN7 Ashbya gossypii ADL115W
           ADL115Wp and similar to YIL041W uniprot|P40531
           Saccharomyces cerevisiae YIL041W GVP36 Golgi-vesicle
           protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm
          Length = 330

 Score = 71.2 bits (173), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 63/257 (24%), Positives = 112/257 (43%), Gaps = 56/257 (21%)

Query: 49  KSRTRFVQESLGTISDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLT 108
           +S  R VQE LG ++DIS+LP +Y  LE + D +  V +  L V++ +E E YDYP N+ 
Sbjct: 57  QSTQRLVQERLGQVTDISQLPQEYLELENRIDRIRLVYENFLKVTQVYEHESYDYPNNVR 116

Query: 109 ESISDWWSLNKDGWFGSKKSEITNKKKGSNHDDAFL-------PRSFAQAISKAAV-DCE 160
           +S++++          SK  E+++        +  +       P++   A+SK A+   E
Sbjct: 117 DSVNEF-----SKTVSSKLHELSHASSTDEAQNILISPGPAKDPKTLNYALSKVALTSSE 171

Query: 161 FEFQNLENDEKAELKKKRESTKNAQTTGAQXXXXXXXXXXXXXXXXXLSNLIKVFDSWST 220
           +  ++   DE                                      + L+K    +S 
Sbjct: 172 YLSKSGHEDE-----------------------------------TIATALLK----YSD 192

Query: 221 CYKNIDEGKTEMDSMMVKEFNKKLEKLINQDFKRVHELRKKVEISRLKFDTMRYEVK--- 277
               I + + + D+++  +FNKKL + +  D  +  + RK+VE  RL++D  R  +    
Sbjct: 193 VQAKIAQARLQQDTLIQTKFNKKLRETLASDLNKAVKARKEVENKRLQYDIARANLANAK 252

Query: 278 -AKEAQLDAQKPGVTEE 293
             KEA L  Q   + +E
Sbjct: 253 PEKEASLRVQMESLEDE 269

>NDAI0A02660 Chr1 (599113..600207) [1095 bp, 364 aa] {ON} Anc_7.221
          Length = 364

 Score = 71.2 bits (173), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 68/250 (27%), Positives = 114/250 (45%), Gaps = 46/250 (18%)

Query: 49  KSRTRFVQESLGTISDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLT 108
           +S  R VQE LG ++DIS+LP +Y  LE+K D+++ V    L V+ TFE + YDYP    
Sbjct: 41  QSTQRMVQERLGQVTDISQLPEEYLQLERKIDTIKSVYDNFLSVTNTFEHQSYDYPNVAR 100

Query: 109 ESISDWWSLNKDGWFGSKKSEITNKKKGS--------NHDDAFLPRSFAQAISKAAVDCE 160
           ES+ ++   +K     SK  E+++    S        N +    P++   A+SKA++   
Sbjct: 101 ESVIEF---SKSAV--SKVEELSHATSASEAQQILTNNSNQIKEPKTLNYALSKASLIS- 154

Query: 161 FEFQNLENDEKAELKKKRESTKNAQTTGAQXXXXXXXXXXXXXXXXXLSNLIKVFDSWST 220
                      +E   K+ ST +   + +                   S L+K    +S 
Sbjct: 155 -----------SEQLNKQFSTDDDNNSNSDFKLVS-------------SILLK----FSD 186

Query: 221 CYKNIDEGKTEMDSMMVKEFNKKLEKLINQDFKRVHELRKKVEISRLKFDTMRYEV---- 276
               I + + + D ++ ++FN  L   +N  F+R  ++RK V+  RL++D  R  +    
Sbjct: 187 IQAKIAQARLQQDLLIKQKFNNNLRNDLNTSFERAQKVRKDVQNKRLQYDVARTNLLNAK 246

Query: 277 KAKEAQLDAQ 286
             KEA L  Q
Sbjct: 247 PEKEASLRVQ 256

>Kpol_478.22 s478 (67833..68885) [1053 bp, 350 aa] {ON}
           (67833..68885) [1053 nt, 351 aa]
          Length = 350

 Score = 70.9 bits (172), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 59/227 (25%), Positives = 98/227 (43%), Gaps = 47/227 (20%)

Query: 49  KSRTRFVQESLGTISDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLT 108
           +S  R V+E LG + DIS LP +Y  LE K D+ + V +  L ++  +E E YDYP   +
Sbjct: 33  QSTHRMVKEKLGQVDDISPLPQEYLDLELKIDTYKSVYEHFLKITSIYERESYDYPKEFS 92

Query: 109 ESISDWWSLNKDGWFGSKKSEITN--KKKGSNHDDAFLPRSFAQAISKAAVDCEFEFQNL 166
           ES++++         G+K  E +N    +GS+      PR+   A+SK ++    +FQ L
Sbjct: 93  ESVNEFTD-----SIGNKMYEFSNGVSTEGSS---GKTPRTLNYAVSKVSMGASEQFQKL 144

Query: 167 ENDEKAELKKKRESTKNAQTTGAQXXXXXXXXXXXXXXXXXLSNLIKVFDSWSTCYKNID 226
            + +   +     +  NA+ +                                     I 
Sbjct: 145 HDTDDKRIANLLTNVGNAEAS-------------------------------------IA 167

Query: 227 EGKTEMDSMMVKEFNKKLEKLINQDFKRVHELRKKVEISRLKFDTMR 273
           E +   D  +  +FN +L + I Q  +R  + RK+V   RLK+D  R
Sbjct: 168 EARLLQDHSIQAKFNFQLREEIAQSIERASKYRKEVYHKRLKYDIAR 214

>KNAG0D01760 Chr4 (296169..297197) [1029 bp, 342 aa] {ON} Anc_7.221
           YIL041W
          Length = 342

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 56/228 (24%), Positives = 101/228 (44%), Gaps = 46/228 (20%)

Query: 53  RFVQESLGTISDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESIS 112
           R VQE LG ++DIS+LP +Y  LEK+ D+L+ V +  L V+  +E E YDYP  + +S++
Sbjct: 42  RLVQEKLGQVTDISQLPQEYLELEKRVDALKLVHEHFLQVTAIYENESYDYPKYVRDSVN 101

Query: 113 DWWSLNKDGWFGSKKSEITNKKKGSNHDDAFL-------PRSFAQAISKAAVDCEFEFQN 165
           +W          ++ SE+ +    +              P++   A+SK A++      N
Sbjct: 102 EW-----SRTVATRVSELRHVSSAAEAQHVIAAPTQETEPKTLHYALSKVALNGSQLVDN 156

Query: 166 LENDEKAELKKKRESTKNAQTTGAQXXXXXXXXXXXXXXXXXLSNLIKVFDSWSTCYKNI 225
           L+       +  RE+  +                         S L++    +S     +
Sbjct: 157 LDAP-----RTPRETQLS-------------------------SGLLE----FSGVEAEL 182

Query: 226 DEGKTEMDSMMVKEFNKKLEKLINQDFKRVHELRKKVEISRLKFDTMR 273
            + + E D+ +  +FN+KL   ++ +  R    RK+V   RL++D  R
Sbjct: 183 AQARLEQDAAVKAQFNEKLRGQLSGEIARAAAARKEVFQKRLQYDVAR 230

>Smik_9.150 Chr9 (250717..251697) [981 bp, 326 aa] {ON} YIL041W
           (REAL)
          Length = 326

 Score = 66.2 bits (160), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 54/232 (23%), Positives = 101/232 (43%), Gaps = 49/232 (21%)

Query: 49  KSRTRFVQESLGTISDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLT 108
           +S  R VQE LG ++DIS+LP +Y  LE+K D+++ +    L V+  +E   YDYP  + 
Sbjct: 33  QSTQRMVQERLGQVTDISQLPREYTELEEKVDTIKLIYNHFLGVTAIYENGSYDYPKYIN 92

Query: 109 ESISDWWSLNKDGWFGSKKSEITNKKKGSNHDDAFL-------PRSFAQAISKAAVDCEF 161
           ES++++          SK +E+T+    S   +  +       P++   A+SK A++   
Sbjct: 93  ESVNEF-----SRSVASKLTELTHATSASEAQNILVAPGPIKEPKTLNYALSKVALNSSE 147

Query: 162 EFQNLENDEKAELKKKRESTKNAQTTGAQXXXXXXXXXXXXXXXXXLSNLIKVFDSWSTC 221
               +   E+  L                                  S L++    +S  
Sbjct: 148 CLNKMLPTEEQPLA---------------------------------SALLQ----FSDV 170

Query: 222 YKNIDEGKTEMDSMMVKEFNKKLEKLINQDFKRVHELRKKVEISRLKFDTMR 273
              I + + + D+++  +FNK L + ++ +  +  + RK V   RL++D  R
Sbjct: 171 QAKIAQARIQQDTLIQTKFNKNLRERLSFEIGKADKTRKDVHSMRLRYDVAR 222

>TPHA0C01230 Chr3 (280944..281861) [918 bp, 305 aa] {ON} Anc_7.221
           YIL041W
          Length = 305

 Score = 65.1 bits (157), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 39/119 (32%), Positives = 66/119 (55%), Gaps = 13/119 (10%)

Query: 47  SIKSRT-RFVQESLGTISDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPP 105
           SI S T R VQE LG ++DIS+LP +Y  LEK+ D+++ V +  L ++  ++ E YDYP 
Sbjct: 34  SIASSTQRLVQEKLGNVTDISQLPQEYLELEKEIDTIKLVYEHFLKITSIYDNESYDYPK 93

Query: 106 NLTESISDWWSLNKDGWFGSKKSEITNKKKGSNHDDAFL-------PRSFAQAISKAAV 157
            +++S++D+  L     F SK  +++         +  +       PR+   A+SK A+
Sbjct: 94  YVSDSVNDYSKL-----FQSKIEDLSRATSAEEAQNILVTPGPITEPRTLNYALSKVAL 147

>TBLA0D04200 Chr4 (1038483..1039478) [996 bp, 331 aa] {ON} Anc_7.221
           YIL041W
          Length = 331

 Score = 64.7 bits (156), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 52/229 (22%), Positives = 96/229 (41%), Gaps = 49/229 (21%)

Query: 53  RFVQESLGTISDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESIS 112
           R  QE LG I+DIS++P +Y  LE + D+L+   + +L V++ +E   YD+P +  ES+ 
Sbjct: 41  RLAQEKLGQITDISQMPREYIDLEDRIDNLQNSIQVLLHVTRVYEEPAYDWPYSTQESVQ 100

Query: 113 DWWSLNKDGWFGSKKSEITNKKKGSNHDDAF--------LPRSFAQAISKAAVDCEFEFQ 164
           DW         GS+  E++     S   +           PR+   A+S+A++       
Sbjct: 101 DW-----SRAIGSRVQELSRASSASEAGNLLKSPVGPENGPRTLNYALSQASLAV----- 150

Query: 165 NLENDEKAELKKKRESTKNAQTTGAQXXXXXXXXXXXXXXXXXLSNLIKVFDSWSTCYKN 224
                  + L        N +                       S LI    ++S     
Sbjct: 151 -------STLTSSNMPGPNGEGLS--------------------SGLI----AYSDTQAK 179

Query: 225 IDEGKTEMDSMMVKEFNKKLEKLINQDFKRVHELRKKVEISRLKFDTMR 273
           + + +   D+ +  +FNK+L +++N    + ++ RK V+  R+ +D  R
Sbjct: 180 LAQIRIAQDTQVQTKFNKQLREILNNPIAKANKYRKDVQYKRVLYDIAR 228

>YIL041W Chr9 (276525..277505) [981 bp, 326 aa] {ON}  GVP36BAR
           domain-containing protein that localizes to both early
           and late Golgi vesicles; required for adaptation to
           varying nutrient concentrations, fluid-phase
           endocytosis, polarization of the actin cytoskeleton, and
           vacuole biogenesis
          Length = 326

 Score = 64.7 bits (156), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 55/232 (23%), Positives = 101/232 (43%), Gaps = 49/232 (21%)

Query: 49  KSRTRFVQESLGTISDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLT 108
           +S  R VQE LG ++DIS+LP +Y  LE K D+++ +    L V+  +E   YDYP  + 
Sbjct: 33  QSTQRMVQERLGQVTDISQLPREYTELEDKVDTIKLIYNHFLGVTAIYENGSYDYPKYIN 92

Query: 109 ESISDWWSLNKDGWFGSKKSEITNKKKGSNHDDAFL-------PRSFAQAISKAAVDCEF 161
           ES++++          SK +E+T+    S   +  +       P++   A+SK A++   
Sbjct: 93  ESVNEF-----SRSVASKLTELTHATSASEAQNILVAPGPIKEPKTLNYALSKVALNS-- 145

Query: 162 EFQNLENDEKAELKKKRESTKNAQTTGAQXXXXXXXXXXXXXXXXXLSNLIKVFDSWSTC 221
                     +E   K   T+      A                     L++    +S  
Sbjct: 146 ----------SECLNKMFPTEEQPLASA---------------------LLQ----FSDV 170

Query: 222 YKNIDEGKTEMDSMMVKEFNKKLEKLINQDFKRVHELRKKVEISRLKFDTMR 273
              I + + + D+++  +FNK L + ++ +  +  + RK V   RL++D  R
Sbjct: 171 QAKIAQARIQQDTLIQTKFNKNLRERLSFEIGKADKCRKDVHSMRLRYDVAR 222

>Skud_9.128 Chr9 (245338..246327) [990 bp, 329 aa] {ON} YIL041W
           (REAL)
          Length = 329

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 54/232 (23%), Positives = 101/232 (43%), Gaps = 49/232 (21%)

Query: 49  KSRTRFVQESLGTISDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLT 108
           +S  R VQE LG ++DIS+LP +Y  LE K D+++ +    L V+  +E   YDYP  + 
Sbjct: 33  QSTQRMVQERLGQVTDISQLPREYTELEDKVDTIKLIYNHFLGVTAIYENGSYDYPKYIN 92

Query: 109 ESISDWWSLNKDGWFGSKKSEITNKKKGSNHDDAFL-------PRSFAQAISKAAVDCEF 161
           ES++++          SK +E+T+    S   +  +       P++   A+SK +++   
Sbjct: 93  ESVNEF-----SRSVASKLTELTHATSASEAQNILVAPGPIKEPKTLNYALSKVSLNSSE 147

Query: 162 EFQNLENDEKAELKKKRESTKNAQTTGAQXXXXXXXXXXXXXXXXXLSNLIKVFDSWSTC 221
               +   E+  L                                  S L++    +S  
Sbjct: 148 CLNKMFPAEEQPLA---------------------------------SALLQ----FSDV 170

Query: 222 YKNIDEGKTEMDSMMVKEFNKKLEKLINQDFKRVHELRKKVEISRLKFDTMR 273
              I + + + D+++  +FNKKL + ++ +  +  + RK V   RL++D  R
Sbjct: 171 QAKIAQTRIQQDTLIQTKFNKKLRERLSFEIGKADKCRKDVHSMRLRYDVAR 222

>Ecym_4377 Chr4 complement(796971..797972) [1002 bp, 333 aa] {ON}
           similar to Ashbya gossypii ADL115W
          Length = 333

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 43/61 (70%)

Query: 53  RFVQESLGTISDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESIS 112
           R VQE LG I+DIS++P +Y  +EK+ D +  + +  L V++ +E E YDYP +++ES++
Sbjct: 61  RMVQEKLGQITDISQMPEEYVHMEKRVDKIRLIYENFLKVTQIYESETYDYPQHVSESVN 120

Query: 113 D 113
           +
Sbjct: 121 E 121

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 47/97 (48%), Gaps = 5/97 (5%)

Query: 218 WSTCYKNIDEGKTEMDSMMVKEFNKKLEKLINQDFKRVHELRKKVEISRLKFDTMRYEVK 277
           +S     I + + + D ++   FNK+L++ +N +F      RK+V+  RL++D  R    
Sbjct: 190 YSDIQAQIAQARLQQDMLIRTRFNKQLKEKLNNEFAAAARARKEVDNKRLQYDIARANFS 249

Query: 278 A----KEAQLDAQKPGVTEE-AHTKDVSANTATSLNE 309
           A    K+A L      + +E A   DVS +   S+ E
Sbjct: 250 AAKPEKQASLRVHMETLEDEFAEAMDVSISFMQSVME 286

>NCAS0A13380 Chr1 complement(2633641..2634630) [990 bp, 329 aa] {ON}
           Anc_7.221
          Length = 329

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 61/250 (24%), Positives = 103/250 (41%), Gaps = 53/250 (21%)

Query: 49  KSRTRFVQESLGTISDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLT 108
           +S  R VQE LG ++DIS+LP +Y  LE K DS++++    L VS  +E + YDYP    
Sbjct: 38  QSTQRMVQERLGQVTDISQLPEEYLELEMKLDSIKQIYDNFLAVSSVYEQQSYDYPYVAK 97

Query: 109 ESISDWWSLNKDGWFGSKKSEITNKKKGSNHDDAFL--------PRSFAQAISKAAVDCE 160
           ES+ ++          SK  E+++        +           P++   A+SK A+   
Sbjct: 98  ESLIEF-----SKTAASKVEELSHASSAHEAQNILTTSSTQIKEPKTLNFALSKVALKSS 152

Query: 161 FEFQNLENDEKAELKKKRESTKNAQTTGAQXXXXXXXXXXXXXXXXXLSNLIKVFDSWST 220
            E  N  ND +A  K    +  N                                  +S 
Sbjct: 153 -EHLNQFNDNEA-FKSSASALLN----------------------------------FSN 176

Query: 221 CYKNIDEGKTEMDSMMVKEFNKKLEKLINQDFKRVHELRKKVEISRLKFDTMRYEV---- 276
               I + + + D ++ ++FN  L   +  +  +  ++RK+V+  RL++D  R  +    
Sbjct: 177 IQAKIAQARLQQDLLIKQKFNDALRHDLATNIAKATKVRKEVQSKRLQYDIARTNLMNAK 236

Query: 277 KAKEAQLDAQ 286
             KEA L  Q
Sbjct: 237 PEKEASLRVQ 246

>ADL115W Chr4 (483164..484165) [1002 bp, 333 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL041W
          Length = 333

 Score = 59.3 bits (142), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 43/62 (69%)

Query: 53  RFVQESLGTISDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESIS 112
           R VQE LG ++DIS++P +Y  LE++ D  + +    L VS+ +E E YDYP ++++S++
Sbjct: 61  RRVQERLGQVTDISQMPEEYVELEQRVDRTKLIYDNFLKVSQIYESESYDYPQHISDSVN 120

Query: 113 DW 114
           D+
Sbjct: 121 DF 122

 Score = 37.0 bits (84), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 15/56 (26%), Positives = 31/56 (55%)

Query: 218 WSTCYKNIDEGKTEMDSMMVKEFNKKLEKLINQDFKRVHELRKKVEISRLKFDTMR 273
           +S     I + + + D+++   FN++L + +N  F    + RK+V+  RL++D  R
Sbjct: 190 YSDVQAKIAQARLQQDTLIQTRFNRRLREKLNTQFAEAMQSRKQVDQKRLQYDIAR 245

>TPHA0B02750 Chr2 (627808..628899) [1092 bp, 363 aa] {ON} Anc_7.221
           YIL041W
          Length = 363

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 58/238 (24%), Positives = 98/238 (41%), Gaps = 49/238 (20%)

Query: 53  RFVQESLGTISDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESIS 112
           R ++E LG   DIS LP +Y  LE K D+++++ +  L V+  +E E YDYP    ES  
Sbjct: 37  RLMKEKLGQAKDISTLPQEYVELETKIDTMKEIYEHFLKVTMVYEKESYDYPKEFGESFW 96

Query: 113 DWWSLNKDGWFGSKKSEITNKKKGSNHDDAFLPRSFAQAISKAAVDCEFEFQNLENDEKA 172
           ++     + +     SE  NK K        +P++   A+    +           +EK 
Sbjct: 97  EFTDSVGEKFSALNISEHNNKVK--------IPKTLNYALHNVFLTA---------NEKV 139

Query: 173 ELKKKRESTKNAQTTGAQXXXXXXXXXXXXXXXXXLSNLIKVFDSWSTCYKNIDEGKTEM 232
           +L    E   N+                          L +   S S    +I E +   
Sbjct: 140 KL--LHEPLDNS--------------------------LSETLASLSETEADIAEARLHQ 171

Query: 233 DSMMVKEFNKKLEKLINQDFKRVHELRKKVEISRLKFDTMR----YEVKAKEAQLDAQ 286
           DS++    N +L++ ++Q+F+R  + RK V   R  +D  +    +    K+A L AQ
Sbjct: 172 DSLVKSRINYQLKEELSQNFERAAKYRKAVHHKRFNYDVAKTNFEHAKPEKQATLSAQ 229

>TBLA0B01580 Chr2 (345206..346366) [1161 bp, 386 aa] {ON} Anc_7.221
           YIL041W
          Length = 386

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 71/312 (22%), Positives = 122/312 (39%), Gaps = 105/312 (33%)

Query: 55  VQESLGTISDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDW 114
           +QE  G ++DIS LP +Y  LE++ DS++ V    L ++  +E E YDYP ++ +SI+++
Sbjct: 1   MQEKFGQVTDISPLPQEYLDLEQQVDSIKLVYDHFLRITTVYENESYDYPKDVRDSITEF 60

Query: 115 WSLNKDGWFGSKKSEITNK----------------------KKGS-NHDDAFLPRSFAQA 151
                     S+  E+  K                        GS N+ +   PR+   A
Sbjct: 61  Q-----KTASSRVQELQTKISNSSDNSHSSGSVEPMRTSVSSVGSINNYNQNSPRTLNNA 115

Query: 152 ISKAAVDCEFEFQNLENDEKAELKKKRESTKNAQTTGAQXXXXXXXXXXXXXXXXXLSNL 211
           +SKAA+   F  + L+ D            K++ T                         
Sbjct: 116 LSKAAL---FAAEQLKMD------------KDSST------------------------- 135

Query: 212 IKVFDSWSTCYKNIDEGKTEMDSMMVKEFNKKLEKLINQDFKRVHELRKKVEISRLKFDT 271
             VF S+S     I + + + D ++ K FN +L+ ++       ++ RK V+  RL++D 
Sbjct: 136 --VFHSFSEAESIISDERIKQDKIIQKSFNTELKNVLTNRIDVANKHRKDVQNKRLQYDI 193

Query: 272 MRYEVKAKEAQLDAQKPGVTEEAHTKDVSANTATSLNEIPSTVDEKQKSNVNTEAESKKE 331
            R        +LD                               E ++S++    E  K+
Sbjct: 194 SR-------TKLDH----------------------------ASEDKESSLRVAMEQHKQ 218

Query: 332 ANEQVADDAVVM 343
           A EQ  DDA++M
Sbjct: 219 AFEQSIDDAIIM 230

>AEL006W Chr5 (621384..628859) [7476 bp, 2491 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YBL004W (UTP20)
          Length = 2491

 Score = 34.3 bits (77), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 32/74 (43%), Gaps = 6/74 (8%)

Query: 224  NIDEGKTEMDSMMVKEFNKKLEKLINQDFKRVHELRKKVEISRLKFDTMRYEVKAKEAQL 283
            +I E   E+  M  +  N   EKL   DF R +   K+V I R      R E +AK AQL
Sbjct: 2395 DISEQFAELQQMSQEALNMLEEKLSTSDFTRAYTAAKQVVIKR------RQERRAKRAQL 2448

Query: 284  DAQKPGVTEEAHTK 297
                P +  E   K
Sbjct: 2449 AVTAPAIAAEKKLK 2462

>NCAS0B08230 Chr2 (1566310..1569045) [2736 bp, 911 aa] {ON}
           Anc_1.193 YJL154C
          Length = 911

 Score = 31.6 bits (70), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 45/93 (48%), Gaps = 7/93 (7%)

Query: 235 MMVKEFNKKLEKLINQD----FKRVHELRKKVEISRLKFDTMRYEVKAKEAQLD---AQK 287
           +M++  N+ L   I+ D    F  V  +   +E+ +    T+R + + +E  +D   AQ+
Sbjct: 783 LMIEILNRCLYYFIHGDESKTFITVKYINGLIELIKTNLKTLRLDKEEEENNMDSTDAQE 842

Query: 288 PGVTEEAHTKDVSANTATSLNEIPSTVDEKQKS 320
             +T  A  +D S    ++L  IPSTV  K  S
Sbjct: 843 RRLTTYAFGQDGSCIHLSNLKGIPSTVSNKITS 875

>ABL136C Chr2 complement(137983..138894) [912 bp, 303 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL177C
          Length = 303

 Score = 30.4 bits (67), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 32/59 (54%)

Query: 260 KKVEISRLKFDTMRYEVKAKEAQLDAQKPGVTEEAHTKDVSANTATSLNEIPSTVDEKQ 318
           KK  + +L   ++RY+VK    +LDA +P V   ++  + S   AT L  + S +D K+
Sbjct: 127 KKDTVVKLPGSSVRYQVKLTRDELDALEPSVYVRSYRIESSIKKATVLLRLLSGLDVKK 185

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.310    0.125    0.343 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 38,073,651
Number of extensions: 1503884
Number of successful extensions: 7422
Number of sequences better than 10.0: 167
Number of HSP's gapped: 7663
Number of HSP's successfully gapped: 212
Length of query: 427
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 315
Effective length of database: 40,638,807
Effective search space: 12801224205
Effective search space used: 12801224205
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 67 (30.4 bits)