Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_16.4003.488ON30430415630.0
YPR147C3.488ON30430413950.0
Skud_16.4423.488ON30430413690.0
Suva_16.4763.488ON30430412741e-178
TDEL0D055603.488ON3113107102e-92
TBLA0C044503.488ON3093097051e-91
KLTH0F14740g3.488ON3022936684e-86
CAGL0L08514g3.488ON3123126503e-83
NCAS0F035303.488ON3133166487e-83
TPHA0D042203.488ON3163186443e-82
Kpol_480.173.488ON3133126355e-81
Kwal_55.212193.488ON3022946215e-79
ZYRO0D10076g3.488ON3053085903e-74
SAKL0F02860g3.488ON3053065861e-73
NDAI0B058303.488ON3293335671e-70
AFR306C3.488ON3192824922e-59
Ecym_12413.488ON3053104895e-59
KAFR0E03110singletonON356116790.19
CAGL0M11462g8.284ON38679760.44
Kpol_543.498.284ON42983702.4
NCAS0E028307.357ON45736702.6
CAGL0K05489g5.679ON34088684.2
YLR099C (ICT1)8.284ON394127684.4
Smik_12.1588.284ON394149684.8
KLLA0F19624g8.284ON40952675.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_16.400
         (304 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_16.400 Chr16 complement(697593..698507) [915 bp, 304 aa] {O...   606   0.0  
YPR147C Chr16 complement(825645..826559) [915 bp, 304 aa] {ON} P...   541   0.0  
Skud_16.442 Chr16 complement(779364..780278) [915 bp, 304 aa] {O...   531   0.0  
Suva_16.476 Chr16 complement(822104..823018) [915 bp, 304 aa] {O...   495   e-178
TDEL0D05560 Chr4 complement(1004217..1005152) [936 bp, 311 aa] {...   278   2e-92
TBLA0C04450 Chr3 complement(1079139..1080068) [930 bp, 309 aa] {...   276   1e-91
KLTH0F14740g Chr6 complement(1208120..1209028) [909 bp, 302 aa] ...   261   4e-86
CAGL0L08514g Chr12 (932629..933567) [939 bp, 312 aa] {ON} simila...   254   3e-83
NCAS0F03530 Chr6 complement(706175..707116) [942 bp, 313 aa] {ON...   254   7e-83
TPHA0D04220 Chr4 complement(912211..913161) [951 bp, 316 aa] {ON...   252   3e-82
Kpol_480.17 s480 (35641..36582) [942 bp, 313 aa] {ON} (35641..36...   249   5e-81
Kwal_55.21219 s55 complement(734903..735811) [909 bp, 302 aa] {O...   243   5e-79
ZYRO0D10076g Chr4 (850134..851051) [918 bp, 305 aa] {ON} similar...   231   3e-74
SAKL0F02860g Chr6 (242683..243600) [918 bp, 305 aa] {ON} similar...   230   1e-73
NDAI0B05830 Chr2 complement(1415309..1416298) [990 bp, 329 aa] {...   223   1e-70
AFR306C Chr6 complement(996001..996960) [960 bp, 319 aa] {ON} Sy...   194   2e-59
Ecym_1241 Chr1 (494505..495422) [918 bp, 305 aa] {ON} similar to...   192   5e-59
KAFR0E03110 Chr5 (621949..623019) [1071 bp, 356 aa] {ON}               35   0.19 
CAGL0M11462g Chr13 complement(1129244..1130404) [1161 bp, 386 aa...    34   0.44 
Kpol_543.49 s543 complement(108945..110234) [1290 bp, 429 aa] {O...    32   2.4  
NCAS0E02830 Chr5 complement(556757..558130) [1374 bp, 457 aa] {O...    32   2.6  
CAGL0K05489g Chr11 (538801..539823) [1023 bp, 340 aa] {ON} simil...    31   4.2  
YLR099C Chr12 complement(339744..340928) [1185 bp, 394 aa] {ON} ...    31   4.4  
Smik_12.158 Chr12 complement(319660..320844) [1185 bp, 394 aa] {...    31   4.8  
KLLA0F19624g Chr6 complement(1817206..1818435) [1230 bp, 409 aa]...    30   5.8  

>Smik_16.400 Chr16 complement(697593..698507) [915 bp, 304 aa] {ON}
           YPR147C (REAL)
          Length = 304

 Score =  606 bits (1563), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/304 (96%), Positives = 292/304 (96%)

Query: 1   MPIQEYTKSKFPCSILNIKPTITRSDEDAALLVWIPGNPGXXXXXXXXXXXXHSKHPDWE 60
           MPIQEYTKSKFPCSILNIKPTITRSDEDAALLVWIPGNPG            HSKHPDWE
Sbjct: 1   MPIQEYTKSKFPCSILNIKPTITRSDEDAALLVWIPGNPGLLYYYQEMLQYLHSKHPDWE 60

Query: 61  ILGISHAGMTLNAHSNTPVYSLQDQVDHQVEVINNFSHENRKIIIMGHSVGAYILQKVCL 120
           ILGISHAGMTLNAHSNTPVYSLQDQVDHQVEVINNFSHENRKIIIMGHSVGAYILQKVCL
Sbjct: 61  ILGISHAGMTLNAHSNTPVYSLQDQVDHQVEVINNFSHENRKIIIMGHSVGAYILQKVCL 120

Query: 121 SHNLVGTVQKVGLVTPTVMDIHTSEMGVKLTTALHYIPPLAHVVSLFSYIFFYWILSEGF 180
           SHNLVGTVQKVGLVTPTVMDIHTSEMGVKLTTALHYIPPLAHVVSLFSYIFFYWILSEGF
Sbjct: 121 SHNLVGTVQKVGLVTPTVMDIHTSEMGVKLTTALHYIPPLAHVVSLFSYIFFYWILSEGF 180

Query: 181 SRFIIDKFMGCGSTSCQAVLSTRIFLTHKQFVRQSLGLASQEMEEITTNWEFQDKFINYC 240
           SRFIIDKFMGCGSTSCQAVLSTRIFLTHKQFVRQSLGLASQEMEEITTNWEFQDKFINYC
Sbjct: 181 SRFIIDKFMGCGSTSCQAVLSTRIFLTHKQFVRQSLGLASQEMEEITTNWEFQDKFINYC 240

Query: 241 EQNGTLIWFLFSSNDHWVSGKTRSHLSHYYKDKVDQNRLEIDVTDKIPHSFVVKHAKYAI 300
           EQNGTLIWFLFSSNDHWVSGKTRSHLSHYYKDKVDQNRLEIDVTDKIPHSFVVKHAKYAI
Sbjct: 241 EQNGTLIWFLFSSNDHWVSGKTRSHLSHYYKDKVDQNRLEIDVTDKIPHSFVVKHAKYAI 300

Query: 301 NTFF 304
           NTFF
Sbjct: 301 NTFF 304

>YPR147C Chr16 complement(825645..826559) [915 bp, 304 aa] {ON}
           Putative protein of unknown function; green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           and is induced in response to the DNA-damaging agent MMS
          Length = 304

 Score =  541 bits (1395), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 257/304 (84%), Positives = 275/304 (90%)

Query: 1   MPIQEYTKSKFPCSILNIKPTITRSDEDAALLVWIPGNPGXXXXXXXXXXXXHSKHPDWE 60
           M ++EYTKSK PCSILNIKPT+T+S EDA LLVWIPGNPG            H KHPDWE
Sbjct: 1   MTVKEYTKSKLPCSILNIKPTVTKSGEDAPLLVWIPGNPGLLYYYQEMLHHLHLKHPDWE 60

Query: 61  ILGISHAGMTLNAHSNTPVYSLQDQVDHQVEVINNFSHENRKIIIMGHSVGAYILQKVCL 120
           ILGISHAGMTLNAHSNTP++SLQDQVDHQVEVINNFS +NRKIIIMGHSVGAYI+QKVCL
Sbjct: 61  ILGISHAGMTLNAHSNTPIFSLQDQVDHQVEVINNFSCKNRKIIIMGHSVGAYIVQKVCL 120

Query: 121 SHNLVGTVQKVGLVTPTVMDIHTSEMGVKLTTALHYIPPLAHVVSLFSYIFFYWILSEGF 180
           S+ LVG+VQKVGLVTPTVMDIHTSEMG+K+T AL YIPPLAHVVSLFSYIFFYWILSEGF
Sbjct: 121 SNKLVGSVQKVGLVTPTVMDIHTSEMGIKMTAALRYIPPLAHVVSLFSYIFFYWILSEGF 180

Query: 181 SRFIIDKFMGCGSTSCQAVLSTRIFLTHKQFVRQSLGLASQEMEEITTNWEFQDKFINYC 240
           SRFIIDKFMGCGST  QAVLSTRIFLTH+QFVRQSLGLA+QEMEEITTNWEFQD+FINYC
Sbjct: 181 SRFIIDKFMGCGSTGYQAVLSTRIFLTHRQFVRQSLGLAAQEMEEITTNWEFQDRFINYC 240

Query: 241 EQNGTLIWFLFSSNDHWVSGKTRSHLSHYYKDKVDQNRLEIDVTDKIPHSFVVKHAKYAI 300
           E+NG  IWFLFSSNDHWVSGKTRSHLS YYKDKV Q RL+IDVTDKIPHSFVVKHA+YAI
Sbjct: 241 EENGISIWFLFSSNDHWVSGKTRSHLSDYYKDKVKQERLKIDVTDKIPHSFVVKHAEYAI 300

Query: 301 NTFF 304
           N FF
Sbjct: 301 NAFF 304

>Skud_16.442 Chr16 complement(779364..780278) [915 bp, 304 aa] {ON}
           YPR147C (REAL)
          Length = 304

 Score =  531 bits (1369), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 245/304 (80%), Positives = 270/304 (88%)

Query: 1   MPIQEYTKSKFPCSILNIKPTITRSDEDAALLVWIPGNPGXXXXXXXXXXXXHSKHPDWE 60
           MP+QEYTKS  PCSILNIKP++   +EDA LLVWIPGNPG            HSKHPDWE
Sbjct: 1   MPVQEYTKSTLPCSILNIKPSVATENEDAPLLVWIPGNPGLLYYYQEMLQHLHSKHPDWE 60

Query: 61  ILGISHAGMTLNAHSNTPVYSLQDQVDHQVEVINNFSHENRKIIIMGHSVGAYILQKVCL 120
           ILG+SHAGMTLNAHSNTP++SLQDQVDHQVEVINNFSHENRKIIIMGHSVGAYILQKVCL
Sbjct: 61  ILGVSHAGMTLNAHSNTPIFSLQDQVDHQVEVINNFSHENRKIIIMGHSVGAYILQKVCL 120

Query: 121 SHNLVGTVQKVGLVTPTVMDIHTSEMGVKLTTALHYIPPLAHVVSLFSYIFFYWILSEGF 180
           S  LVG+V+K+GL+TPTVMDIHTSEMGVK+T  LHYIPPLAHVVSL SY+FFYWILSEG 
Sbjct: 121 SDKLVGSVRKIGLITPTVMDIHTSEMGVKMTAVLHYIPPLAHVVSLLSYVFFYWILSEGL 180

Query: 181 SRFIIDKFMGCGSTSCQAVLSTRIFLTHKQFVRQSLGLASQEMEEITTNWEFQDKFINYC 240
           SRF+IDKFMGCGST  QAVLSTRI LTHKQFVRQSLGLASQEM+EITTNWEFQD+FINYC
Sbjct: 181 SRFVIDKFMGCGSTGYQAVLSTRILLTHKQFVRQSLGLASQEMKEITTNWEFQDEFINYC 240

Query: 241 EQNGTLIWFLFSSNDHWVSGKTRSHLSHYYKDKVDQNRLEIDVTDKIPHSFVVKHAKYAI 300
           ++N   IWFLFS+ DHWV+ KTR+HLSHYYKDK+ Q RL+IDVTDKIPHSFVVKHA+YA+
Sbjct: 241 QENEIFIWFLFSTKDHWVADKTRTHLSHYYKDKIKQERLKIDVTDKIPHSFVVKHAEYAV 300

Query: 301 NTFF 304
           NTFF
Sbjct: 301 NTFF 304

>Suva_16.476 Chr16 complement(822104..823018) [915 bp, 304 aa] {ON}
           YPR147C (REAL)
          Length = 304

 Score =  495 bits (1274), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 229/304 (75%), Positives = 259/304 (85%)

Query: 1   MPIQEYTKSKFPCSILNIKPTITRSDEDAALLVWIPGNPGXXXXXXXXXXXXHSKHPDWE 60
           M IQEYTKSK PCSILNIKPT+T  +EDA LLVWIPGNPG            H KHPDWE
Sbjct: 1   MSIQEYTKSKLPCSILNIKPTVTTDNEDAPLLVWIPGNPGLLHYYQEMIHHLHLKHPDWE 60

Query: 61  ILGISHAGMTLNAHSNTPVYSLQDQVDHQVEVINNFSHENRKIIIMGHSVGAYILQKVCL 120
           ILGISHAGM+ NA SNTP++SLQDQVDHQV+VINNFSH+NRKIIIMGHSVGAYI+QKVCL
Sbjct: 61  ILGISHAGMSSNARSNTPIFSLQDQVDHQVKVINNFSHDNRKIIIMGHSVGAYIVQKVCL 120

Query: 121 SHNLVGTVQKVGLVTPTVMDIHTSEMGVKLTTALHYIPPLAHVVSLFSYIFFYWILSEGF 180
           S+ LVG+V KVGL+TPTVMDIH SEMGVK+TTA HY+P LAHV+S  SY+FFYW+LSEG 
Sbjct: 121 SNELVGSVTKVGLITPTVMDIHASEMGVKMTTAFHYVPALAHVLSFISYVFFYWVLSEGL 180

Query: 181 SRFIIDKFMGCGSTSCQAVLSTRIFLTHKQFVRQSLGLASQEMEEITTNWEFQDKFINYC 240
           S+ IIDKFMGCG+   +AVLSTR+FLTH+QFVRQSLGLASQE++EITTNWEFQDKFIN+C
Sbjct: 181 SKLIIDKFMGCGTAGRRAVLSTRLFLTHRQFVRQSLGLASQELKEITTNWEFQDKFINHC 240

Query: 241 EQNGTLIWFLFSSNDHWVSGKTRSHLSHYYKDKVDQNRLEIDVTDKIPHSFVVKHAKYAI 300
           E+ G   WFLFS+ DHWV+ +TR HLSHYY DKV Q  L IDVTDK+PHSFVVKHA+YAI
Sbjct: 241 EEKGIFTWFLFSTKDHWVNDETRKHLSHYYHDKVKQEHLRIDVTDKMPHSFVVKHAEYAI 300

Query: 301 NTFF 304
           N FF
Sbjct: 301 NAFF 304

>TDEL0D05560 Chr4 complement(1004217..1005152) [936 bp, 311 aa] {ON}
           Anc_3.488 YPR147C
          Length = 311

 Score =  278 bits (710), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 137/310 (44%), Positives = 195/310 (62%), Gaps = 8/310 (2%)

Query: 1   MPIQEYTKSKFPCSILNIKPTITRSDEDAALLVWIPGNPGXXXXXXXXXXXXHSKHPDWE 60
           M  +EY K  +P SI++ K    R   +  L VWIPGNPG            H +HP+WE
Sbjct: 1   MAAREYIKCAYPTSIVHFKSISIRGKSECPLFVWIPGNPGLIEYYEEFLMLIHRQHPEWE 60

Query: 61  ILGISHAGMTLNAHSNTP------VYSLQDQVDHQVEVINNFSHENRKIIIMGHSVGAYI 114
           +LGISHAGM+  + S +       VYSL+ Q+DH++E+I +FS  NR +IIMGHSVGAY+
Sbjct: 61  VLGISHAGMSTASVSKSEKSERNDVYSLKQQIDHKLEIIKDFSSTNRPLIIMGHSVGAYM 120

Query: 115 LQKVCLSHNLVGTVQKVGLVTPTVMDIHTSEMGVKLTTALHYIPPLAHVVSLFSYIFFYW 174
           +Q + LS  LVG V K+GL+TPT++DIHTS+ GV LT  L+++  L  +   FS + F +
Sbjct: 121 VQHIVLSDKLVGKVAKMGLLTPTILDIHTSKKGVVLTKVLYWLKDLPQLAGWFSSLLFGF 180

Query: 175 ILSEGFSRFIIDKFMGCGSTSCQAVLSTRIFLTHKQFVRQSLGLASQEMEEITTNWEFQD 234
            L     R ++  FMGC   S   VL+T + L + +FV+Q+LGL+  EMEEI ++W FQ 
Sbjct: 181 FLPSFILRILLSFFMGCHRNS-SGVLTTTVLLENGEFVKQALGLSVYEMEEIRSDWAFQR 239

Query: 235 KFINYCEQNGTLIWFLFSSNDHWVSGKTRSHLSHYYKDKVDQNRLEIDVTDKIPHSFVVK 294
           + I +C + G   W LFS +DHWV+  TR  L  +Y+D    ++++I  T KIPHSFV+ 
Sbjct: 240 RLIVHCNERGISTWLLFSDSDHWVADTTREDLIKFYRDHYRADKIKIH-TCKIPHSFVLN 298

Query: 295 HAKYAINTFF 304
           H+KY I+ +F
Sbjct: 299 HSKYLISEYF 308

>TBLA0C04450 Chr3 complement(1079139..1080068) [930 bp, 309 aa] {ON}
           Anc_3.488 YPR147C
          Length = 309

 Score =  276 bits (705), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 136/309 (44%), Positives = 192/309 (62%), Gaps = 5/309 (1%)

Query: 1   MPIQEYTKSKFPCSILNIKPTIT-RSDEDAALLVWIPGNPGXXXXXXXXXXXXHSKHPDW 59
           M IQ Y  S++P SI++  P    +  ED  L +WIPGNPG            H K+P W
Sbjct: 1   MTIQIYPDSRYPTSIVHFPPAKDYKITEDTPLFIWIPGNPGLLEYYTKMLRSLHDKYPTW 60

Query: 60  EILGISHAGMT----LNAHSNTPVYSLQDQVDHQVEVINNFSHENRKIIIMGHSVGAYIL 115
           EILG+SHAGM+    +    +T VY+L +QV H+VEVINNFS   R IIIMGHSVGAY+ 
Sbjct: 61  EILGVSHAGMSNGNQIKNVLSTKVYTLDEQVSHKVEVINNFSSPKRNIIIMGHSVGAYMA 120

Query: 116 QKVCLSHNLVGTVQKVGLVTPTVMDIHTSEMGVKLTTALHYIPPLAHVVSLFSYIFFYWI 175
           Q+V +  NL+G V K+GLVTPTV+DIH S  G+K+T A +    L   + L S + F  +
Sbjct: 121 QRVIMDSNLIGNVIKLGLVTPTVVDIHRSVKGIKMTRAFNLFRELPIFLGLLSTLAFSKL 180

Query: 176 LSEGFSRFIIDKFMGCGSTSCQAVLSTRIFLTHKQFVRQSLGLASQEMEEITTNWEFQDK 235
               F+R+++   MGC +    A  ++ +FLT+  FV+Q LGLAS EM+ I  +W FQ +
Sbjct: 181 FPAIFTRWLLTIIMGCKNNDNHAADASTVFLTNGSFVKQCLGLASHEMKHIRDDWNFQKR 240

Query: 236 FINYCEQNGTLIWFLFSSNDHWVSGKTRSHLSHYYKDKVDQNRLEIDVTDKIPHSFVVKH 295
            I+YC +     WFLFSS DHWVS  TR+ L ++Y+     + L++ V++ IPHSFV+  
Sbjct: 241 LIDYCNKENVSTWFLFSSTDHWVSDDTRNELINFYRTNCKSDILDVSVSNIIPHSFVINF 300

Query: 296 AKYAINTFF 304
           + + +N++F
Sbjct: 301 SDFTVNSYF 309

>KLTH0F14740g Chr6 complement(1208120..1209028) [909 bp, 302 aa]
           {ON} similar to uniprot|Q06522 Saccharomyces cerevisiae
           YPR147C Hypothetical ORF
          Length = 302

 Score =  261 bits (668), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 132/293 (45%), Positives = 184/293 (62%), Gaps = 2/293 (0%)

Query: 12  PCSILNIKPTITRSDEDAALLVWIPGNPGXXXXXXXXXXXXHSKHPDWEILGISHAGMTL 71
           P SIL++K  ++    DA L V+IPGNPG            H K+PDWEILGISHAGM  
Sbjct: 12  PSSILHLKSGVSSLGSDACLFVFIPGNPGLIEYYVPFLQQVHEKNPDWEILGISHAGMNS 71

Query: 72  NAHSNTPVYSLQDQVDHQVEVINNFSHENRKIIIMGHSVGAYILQKVCLSHNLVGTVQKV 131
                 PVY+LQ+Q++H+V+VIN+++  N+KI IMGHSVGA+I QKV  S  L   V +V
Sbjct: 72  CNDIACPVYTLQEQINHKVDVINSYAQGNKKITIMGHSVGAFIAQKVVTSGLLNDEVARV 131

Query: 132 GLVTPTVMDIHTSEMGVKLTTALHYIPPLAHVVSLFSYIFFYWILSEGFSRFIIDKFMGC 191
           GL+TPTV+DIH SE G+KLT      P    +VS   +I F  +  +  + +II  F   
Sbjct: 132 GLLTPTVIDIHKSEKGLKLTAITERFPRFHQLVSALDWIAFEKLFPDFLTSWIISHFADD 191

Query: 192 GSTSCQAVLSTRIFLTHKQFVRQSLGLASQEMEEITTNWEFQDKFINYCEQNGTLIWFLF 251
             T   A  +TR+ LT+ +FV+Q+LGLA++EM+ I ++WE+Q  F++YCE  G  IW+LF
Sbjct: 192 PKTCLGA--ATRLLLTNSRFVKQALGLATEEMQVIRSDWEYQKDFLHYCETKGAKIWWLF 249

Query: 252 SSNDHWVSGKTRSHLSHYYKDKVDQNRLEIDVTDKIPHSFVVKHAKYAINTFF 304
           S NDHWVS +TR  L  +Y+       + IDV+  I H+FV +HA+  +  +F
Sbjct: 250 SDNDHWVSSETRKDLIQFYERHSSPELVSIDVSTAIEHAFVRRHAQVVVQHYF 302

>CAGL0L08514g Chr12 (932629..933567) [939 bp, 312 aa] {ON} similar
           to uniprot|Q06522 Saccharomyces cerevisiae YPR147c
          Length = 312

 Score =  254 bits (650), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 128/312 (41%), Positives = 182/312 (58%), Gaps = 8/312 (2%)

Query: 1   MPIQEYTKSKFPCSILNIKPTITRSDEDAALLVWIPGNPGXXXXXXXXXXXXHSKHPDWE 60
           M +Q Y  S  P  I++IKPT+T +DE + L VWIPGNPG            H K+P WE
Sbjct: 1   MSVQGYHDSALPTCIIHIKPTVTNNDESSPLFVWIPGNPGLLEYYQEFLAKVHDKNPTWE 60

Query: 61  ILGISHAGMTLNA-------HSNTPVYSLQDQVDHQVEVINNFSHE-NRKIIIMGHSVGA 112
           ILGISHAG  + +        +  P+Y L+ Q  H++++IN  +++ NR+++IMGHSVGA
Sbjct: 61  ILGISHAGTVIESSQLKKFRKNPLPIYDLKQQTQHKIDIINKINNDPNRELVIMGHSVGA 120

Query: 113 YILQKVCLSHNLVGTVQKVGLVTPTVMDIHTSEMGVKLTTALHYIPPLAHVVSLFSYIFF 172
           YI Q V  S +LVG V K+GL+TPT+ DIH S  G+  T   +YI  +   +S  S   F
Sbjct: 121 YIAQHVVSSPDLVGRVSKLGLITPTIRDIHKSSHGLIFTRVFNYISNVNEYLSFISSNIF 180

Query: 173 YWILSEGFSRFIIDKFMGCGSTSCQAVLSTRIFLTHKQFVRQSLGLASQEMEEITTNWEF 232
             ++   +++ +I   MGC       +L T + LT ++ +RQ LGLA+ EM EI  +W F
Sbjct: 181 NKLIPAYWTKLLISFAMGCSFDEYHIILGTFLLLTQRETLRQVLGLAAHEMLEIRDDWAF 240

Query: 233 QDKFINYCEQNGTLIWFLFSSNDHWVSGKTRSHLSHYYKDKVDQNRLEIDVTDKIPHSFV 292
           Q+  +  C+ NGT +W LFS NDHWVS  T++ L  + KD+  +  L +DV   I HSFV
Sbjct: 241 QENLLTKCKDNGTKLWLLFSDNDHWVSQHTQAELIKFLKDRYPELLLRVDVDKDIKHSFV 300

Query: 293 VKHAKYAINTFF 304
           VK        +F
Sbjct: 301 VKDVDLVTRRYF 312

>NCAS0F03530 Chr6 complement(706175..707116) [942 bp, 313 aa] {ON}
           Anc_3.488 YPR147C
          Length = 313

 Score =  254 bits (648), Expect = 7e-83,   Method: Compositional matrix adjust.
 Identities = 132/316 (41%), Positives = 189/316 (59%), Gaps = 15/316 (4%)

Query: 1   MPIQEYTKSKFPCSILNIKPTITRSDEDAALLVWIPGNPGXXXXXXXXXXXXHSKHPDWE 60
           M ++ Y   +FP  +++I P   ++ E   + VWIPGNPG            H KHP WE
Sbjct: 1   MSVEAYDDDEFPTCVVHILPI--KTAEINPVFVWIPGNPGILEYYQEMLINLHEKHPTWE 58

Query: 61  ILGISHAGMTLNAHS--------NTPVYSLQDQVDHQVEVINNFSHE-NRKIIIMGHSVG 111
           IL ISH GM     S        N+ V++L++Q+ H++++INNF  + N  I I GHSVG
Sbjct: 59  ILAISHIGMNTKTTSLFKGSHQDNSRVFTLKEQIQHKIKIINNFVKDSNVPIYISGHSVG 118

Query: 112 AYILQKVCLSHNLVGTVQKVGLVTPTVMDIHTSEMGVKLTTALHY-IPPLAHVVSLFSYI 170
           AY++QK+  S  L+G V K+GL+TPT++DIH SE G  +T    +    L H++S   YI
Sbjct: 119 AYMVQKIVASDELIGQVLKMGLITPTIIDIHLSEKGKSMTRYARWSCRQLPHILSFLCYI 178

Query: 171 FFYWILSEGFSRFIIDKFMGCGSTSCQAVLSTRIFLTHKQFVRQSLGLASQEMEEITTNW 230
            F W++      +II   MGC   S QA +ST +FLT   FVRQSLGLA +EM+ I  +W
Sbjct: 179 VFGWLVPGILRSYIIGYVMGCHHDS-QAAISTELFLTGPNFVRQSLGLAQEEMDTIHDDW 237

Query: 231 EFQDKFINYCEQNGTLIWFLFSSNDHWVSGKTRSHLSHYYKDKVDQNR--LEIDVTDKIP 288
           +FQ + I YC +N   I FLFS+ DHWV   TR  +  +Y+++    +  L+IDV+D+ P
Sbjct: 238 QFQAELIEYCLKNSIKIQFLFSATDHWVREATRKEIIQFYQERCKGAKALLKIDVSDQFP 297

Query: 289 HSFVVKHAKYAINTFF 304
           HSFVV+ +KY +  +F
Sbjct: 298 HSFVVRRSKYVVEHYF 313

>TPHA0D04220 Chr4 complement(912211..913161) [951 bp, 316 aa] {ON}
           Anc_3.488 YPR147C
          Length = 316

 Score =  252 bits (644), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 131/318 (41%), Positives = 196/318 (61%), Gaps = 16/318 (5%)

Query: 1   MPIQEYTKSKFPCSILNIKPT---------ITRSDEDAALLVWIPGNPGXXXXXXXXXXX 51
           M I  +  SKFP SIL+IK T         +T++D+ + L VWIPGNPG           
Sbjct: 1   MTITVFKDSKFPTSILSIKGTYVADELSVDLTKTDKLSPLFVWIPGNPGLLEYYEEFLKL 60

Query: 52  XHSKHPDWEILGISHAGMTLNAHSN-----TPVYSLQDQVDHQVEVINNFSHENRKIIIM 106
            H K+P+W+ILGISHAGM+ + +SN       VY+L +Q+ H++E+IN F+   R++I+M
Sbjct: 61  LHVKNPEWDILGISHAGMS-SGNSNLKENECSVYTLDEQIHHKIEIINKFAAYGRELIVM 119

Query: 107 GHSVGAYILQKVCLSHNLVGTVQKVGLVTPTVMDIHTSEMGVKLTTALHYIPPLAHVVSL 166
           GHSVGA++ QKV +S+ L G V+K+GL+ PTV+DIH SE G +++T L++IP L  +   
Sbjct: 120 GHSVGAFMAQKVVMSNKLEGKVKKIGLLMPTVIDIHLSEKGTQISTILNWIPNLPQLAGW 179

Query: 167 FSYIFFYWILSEGFSRFIIDKFMGCGSTSCQAVLSTRIFLTHKQFVRQSLGLASQEMEEI 226
            S   F   L     +FII  FM   + + +A  +T  FL    FV QSLGLA  EM+ I
Sbjct: 180 VSEKIFGGFLPITLVKFIISFFMELNNEN-KAAHATYTFLKDSNFVEQSLGLAKYEMQII 238

Query: 227 TTNWEFQDKFINYCEQNGTLIWFLFSSNDHWVSGKTRSHLSHYYKDKVDQNRLEIDVTDK 286
             +WEFQ + +  C  N   +W LF+ +DHWVS +TRS L   Y++ V+ +     +TD+
Sbjct: 239 RHDWEFQRELVKMCNVNQIELWTLFAESDHWVSNQTRSELIELYRNSVNSDYYSYSITDQ 298

Query: 287 IPHSFVVKHAKYAINTFF 304
           +PH+FV+K++ + ++ +F
Sbjct: 299 VPHAFVIKNSCHVVDNYF 316

>Kpol_480.17 s480 (35641..36582) [942 bp, 313 aa] {ON}
           (35641..36582) [942 nt, 314 aa]
          Length = 313

 Score =  249 bits (635), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 126/312 (40%), Positives = 187/312 (59%), Gaps = 12/312 (3%)

Query: 3   IQEYTKSKFPCSILNIKP-TITRSDEDAALLVWIPGNPGXXXXXXXXXXXXHSKHPDWEI 61
           ++ +  S +P SI+++ P T   S ED+ L VWIPGNPG            H K+P WE+
Sbjct: 4   VKVFEDSIYPTSIVHLDPLTKELSPEDSPLFVWIPGNPGLLEYYVDFLALVHKKNPTWEV 63

Query: 62  LGISHAGMTLNAHSNTP---------VYSLQDQVDHQVEVINNFSHENRKIIIMGHSVGA 112
           LGISHAGM+ + +             V+ L++QV H+V++IN FS +NR +IIMGHSVGA
Sbjct: 64  LGISHAGMSYDGNEKKKKTSSNDKFKVFDLEEQVQHKVDIINKFSSKNRPLIIMGHSVGA 123

Query: 113 YILQKVCLSHNLVGTVQKVGLVTPTVMDIHTSEMGVKLTTALHYIPPLAHVVSLFSYIFF 172
           Y+ Q+V +++ L G + KVG +TPTV+DIH S+ G+K+T   ++   L H V   S   F
Sbjct: 124 YLTQRVIMTNKLNGKLIKVGYLTPTVVDIHLSDKGIKMTKVFNWTSNLPHHVGWISQFIF 183

Query: 173 YWILSEGFSRFIIDKFMGCGSTSCQAVLSTRIFLTHKQFVRQSLGLASQEMEEITTNWEF 232
           + +L   F +F I K + C S    AVL++   L +   + Q+LGLA+ EME I  +W F
Sbjct: 184 HKLLPLFFVKFFISKMIKC-SEDSNAVLASGTLLRNANLIEQALGLATYEMEAIHDDWGF 242

Query: 233 QDKFINYCEQNGTLIWFLFSSNDHWVSGKTRSHLSHYYKDKVDQNRLEIDVTDKIPHSFV 292
             K I+YC + G   WFLF+ +DHWV+  TR  +  +Y+       + ID+ D IPH+FV
Sbjct: 243 HKKLIDYCNETGVKTWFLFAEDDHWVAHSTRKEVIDFYQYHNKPENIRIDI-DTIPHAFV 301

Query: 293 VKHAKYAINTFF 304
           +K +KY ++ +F
Sbjct: 302 IKKSKYIVDQYF 313

>Kwal_55.21219 s55 complement(734903..735811) [909 bp, 302 aa] {ON}
           YPR147C - Hypothetical ORF [contig 131] FULL
          Length = 302

 Score =  243 bits (621), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 121/294 (41%), Positives = 180/294 (61%), Gaps = 2/294 (0%)

Query: 11  FPCSILNIKPTITRSDEDAALLVWIPGNPGXXXXXXXXXXXXHSKHPDWEILGISHAGMT 70
            PCS+ +    +  S  +A L V+IPGNPG            H K+P WEILGISHAGM 
Sbjct: 11  LPCSLYHRNAGLNSSGGEAPLFVFIPGNPGLIEFYEPFLAQIHEKNPAWEILGISHAGMN 70

Query: 71  LNAHSNTPVYSLQDQVDHQVEVINNFSHENRKIIIMGHSVGAYILQKVCLSHNLVGTVQK 130
             +   +PVYSL+ Q+DH++E+IN +  + + IIIMGHSVGA+++QK+  S  L   V +
Sbjct: 71  SCSEEVSPVYSLEQQIDHKIEIINRYCLDGKPIIIMGHSVGAFMVQKITTSRRLKSKVIR 130

Query: 131 VGLVTPTVMDIHTSEMGVKLTTALHYIPPLAHVVSLFSYIFFYWILSEGFSRFIIDKFMG 190
           VGL+TPTV+DIH SE GVKLT+   + P   +VVS  ++  F  +L    ++ II   + 
Sbjct: 131 VGLLTPTVIDIHKSEKGVKLTSITRWCPSFHNVVSTLNWALFEKLLPTKITKSIISLLVD 190

Query: 191 CGSTSCQAVLSTRIFLTHKQFVRQSLGLASQEMEEITTNWEFQDKFINYCEQNGTLIWFL 250
               SC    +T + +T+ +FV+Q+LGLA++E+  I ++W +Q +F+  C++N T IW+L
Sbjct: 191 -DPQSCLGA-TTELLVTNSRFVKQALGLAAEEVRVIRSDWAYQKEFLLLCQENDTKIWWL 248

Query: 251 FSSNDHWVSGKTRSHLSHYYKDKVDQNRLEIDVTDKIPHSFVVKHAKYAINTFF 304
           FS  DHWVS  TR+ +  +Y+        +IDV+  I H+FV +HA   I  +F
Sbjct: 249 FSEKDHWVSPTTRNDIIDFYRQHSSPALSQIDVSSTIEHAFVRRHADLVIKQYF 302

>ZYRO0D10076g Chr4 (850134..851051) [918 bp, 305 aa] {ON} similar to
           uniprot|Q06522 Saccharomyces cerevisiae YPR147C
           Hypothetical ORF
          Length = 305

 Score =  231 bits (590), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 120/308 (38%), Positives = 179/308 (58%), Gaps = 7/308 (2%)

Query: 1   MPIQEYTKSKFPCSILNIKPTITRSDEDAALLVWIPGNPGXXXXXXXXXXXXHSKHPDWE 60
           M I+    ++ P S+L+I          + L VWIPGNPG            H K+  +E
Sbjct: 1   MSIRYLAGARLPTSVLHI--KPKSPSPSSPLFVWIPGNPGIVQYYEEFLNLLHEKYDSFE 58

Query: 61  ILGISHAGMTLN----AHSNTPVYSLQDQVDHQVEVINNFSHENRKIIIMGHSVGAYILQ 116
           IL ISHAGM             +Y+L DQ+ H+VE+IN FS ++R +I+MGHSVGAY+ Q
Sbjct: 59  ILAISHAGMATEDPDLQKRKATIYTLDDQIQHKVEIINQFSAKDRPLIVMGHSVGAYMAQ 118

Query: 117 KVCLSHNLVGTVQKVGLVTPTVMDIHTSEMGVKLTTALHYIPPLAHVVSLFSYIFFYWIL 176
            V L+  L+G V K+GL+TPTV+DIH S+ G +LT A +++  L  + +  S + F  + 
Sbjct: 119 HVVLAEKLLGRVVKLGLITPTVVDIHRSQKGTQLTRAFYWVKYLPDIAAWVSDMLFNKLS 178

Query: 177 SEGFSRFIIDKFMGCGSTSCQAVLSTRIFLTHKQFVRQSLGLASQEMEEITTNWEFQDKF 236
           S  F+  +I  FMG    S   V +++  + + + +RQ+LGLA+ EM++I   W FQ K 
Sbjct: 179 SIMFTDQVISLFMGVDKESV-PVATSKSLVQNPEIIRQALGLAALEMQQIRGCWPFQKKL 237

Query: 237 INYCEQNGTLIWFLFSSNDHWVSGKTRSHLSHYYKDKVDQNRLEIDVTDKIPHSFVVKHA 296
           I++C  N     F+FS+ND WVS  TR  L  +Y++      LEI V+  + HSF+VKH+
Sbjct: 238 IDHCNSNEIETKFVFSANDPWVSNATREALMVFYRENYRDRNLEISVSQDLAHSFIVKHS 297

Query: 297 KYAINTFF 304
           KY ++ +F
Sbjct: 298 KYIVDEYF 305

>SAKL0F02860g Chr6 (242683..243600) [918 bp, 305 aa] {ON} similar to
           uniprot|Q06522 Saccharomyces cerevisiae YPR147C
           Hypothetical ORF
          Length = 305

 Score =  230 bits (586), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 121/306 (39%), Positives = 181/306 (59%), Gaps = 5/306 (1%)

Query: 1   MPIQEYTKSKFPCSILNIKPTITRSDEDAALLVWIPGNPGXXXXXXXXXXXXHSKHPDWE 60
           M IQ Y+K+ F  S+ ++KP     +    L V+IPGNPG              KH +WE
Sbjct: 1   MHIQPYSKNGFFSSLYHLKPLNQEVNSQTPLFVFIPGNPGLIEFYKSFLDQIQKKHGNWE 60

Query: 61  ILGISHAGMTLNAHS---NTPVYSLQDQVDHQVEVINNFSHENRKIIIMGHSVGAYILQK 117
           ILGISHAGM          T VYSL+DQV H++ VIN+F   NR +II GHS+GAYI+QK
Sbjct: 61  ILGISHAGMITKCKGLKKPTKVYSLKDQVQHKIYVINDFCSSNRPLIIAGHSIGAYIVQK 120

Query: 118 VCLSHNLVGTVQKVGLVTPTVMDIHTSEMGVKLTTALHYIPPLAHVVSLFSYIFFYWILS 177
           + L  +L+GTV+K+ L+TPTV+DIH SE G KL     + P     V+  S++ F  +L 
Sbjct: 121 IALDVSLMGTVKKIMLLTPTVIDIHLSEKGRKLNWINEWCPNFHSYVATASWLVFEKMLP 180

Query: 178 EGFSRFIIDKFMGCGSTSCQAVLSTRIFLTHKQFVRQSLGLASQEMEEITTNWEFQDKFI 237
           +  +  I+  F+G   T  +   + ++ +T+ +FV+QSLGLA +EM+++  +W FQ  F+
Sbjct: 181 QTITEKILSLFVGSEQTCVRE--AAKLLVTNYEFVQQSLGLAREEMQKVRDDWNFQLSFL 238

Query: 238 NYCEQNGTLIWFLFSSNDHWVSGKTRSHLSHYYKDKVDQNRLEIDVTDKIPHSFVVKHAK 297
            +C+     + FLF+  DHWV+ +TR  L+ +Y     ++ L ID  +KI HSFV+   K
Sbjct: 239 QFCKSQEVELQFLFAFKDHWVNSQTRFDLAEFYNSNYYKDFLTIDEDEKISHSFVLNDTK 298

Query: 298 YAINTF 303
             ++ +
Sbjct: 299 SVVDRY 304

>NDAI0B05830 Chr2 complement(1415309..1416298) [990 bp, 329 aa] {ON}
           Anc_3.488 YPR147C
          Length = 329

 Score =  223 bits (567), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 124/333 (37%), Positives = 184/333 (55%), Gaps = 33/333 (9%)

Query: 1   MPIQEYTKSKFPCSILNIKPT--ITRSDEDAALLVWIPGNPGXXXXXXXXXXXXHSKHPD 58
           M ++ Y++SK+P SI++I+    I        L +WIPGNPG            H KHP 
Sbjct: 1   MLVKSYSESKYPTSIIHIEAEKLIENDPSLNPLFIWIPGNPGILQYYQQFLCSLHKKHPH 60

Query: 59  WEILGISHAGMTLN----AHSNTPVYSLQDQVDHQVEVINNFS---------HENRKIII 105
           WEIL I HAGM  +     H N  +Y L +Q++H++EVI  F           + R ++I
Sbjct: 61  WEILAIPHAGMDTSLPVYRHPNDRIYHLNEQIEHKIEVITTFLTKANSSDGIMKKRPLVI 120

Query: 106 MGHSVGAYILQKVCLSHNLVGTV-------QKVGLVTPTVMDIHTSEMGVKLTTALH--- 155
           MGHSVG Y++Q++ L+     T+       +K+G +TPT++DI+ S  G+ ++  L    
Sbjct: 121 MGHSVGTYMIQRMVLTKEFQDTILHNSFYLKKIGFITPTIIDINLSSKGILISHGLQLTH 180

Query: 156 -YIPPLAHVVSLFSYIFFYWILS--EGFSRFIIDKFMGCGSTSCQAVLSTRIFLTHKQFV 212
            Y+P   +++S  SY  F  IL   +   R +I   MGC  T   A+  T I LT+   V
Sbjct: 181 GYLP---YILSYLSYFVFSLILKYFDNIRRRLIAYIMGCQMTDFAAI-GTEILLTNSVLV 236

Query: 213 RQSLGLASQEMEEITTNWEFQDKFINYCEQNGTLIWFLFSSNDHWVSGKTRSHLSHYYKD 272
           +QSLGLAS EM+EI  NW+ Q +F+  C  N   +W LF   DHWV+  TR+ L  +Y+ 
Sbjct: 237 KQSLGLASIEMQEIRKNWDVQKQFVENCNHNDIQLWLLFCETDHWVNNVTRTDLIKFYQS 296

Query: 273 KV-DQNRLEIDVTDKIPHSFVVKHAKYAINTFF 304
              D +RL+I+V+ + PHSFVV H+ + +  FF
Sbjct: 297 NYKDISRLQIEVSSEFPHSFVVNHSDWVVERFF 329

>AFR306C Chr6 complement(996001..996960) [960 bp, 319 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR147C
          Length = 319

 Score =  194 bits (492), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 104/282 (36%), Positives = 159/282 (56%), Gaps = 11/282 (3%)

Query: 31  LLVWIPGNPGXXXXXXXXXXXXHSKHPDWEILGISHAGMTLNAHSN--TPVYSLQDQVDH 88
           +L+++PGNPG            H K+P WEI+GISH GM+          VY+L +QV+H
Sbjct: 41  ILIFLPGNPGLINFYREFLRSIHEKNPTWEIVGISHTGMSAKTGPEDLKRVYTLVEQVEH 100

Query: 89  QVEVINNFSHENR---KIIIMGHSVGAYILQKVCLSHNLVGTVQKVGLVTPTVMDIHTSE 145
           +V+ IN+F  ENR    + ++GHS+GAY+ QKV +   L   V+ VGL+TPT++DIH S 
Sbjct: 101 KVKAINDFV-ENRGNLAVKLVGHSIGAYMAQKVVVHPALRVNVEMVGLLTPTIIDIHRSP 159

Query: 146 MGVKLTTALHYIPPLAHVVSLFSYIFFYWILSEGFSRFIIDKFMGCGSTSCQAVLSTRIF 205
            GV+LT    + P     VS+   +   W+L   +  ++  K +G GS  C  + S    
Sbjct: 160 KGVQLTRISEWFPRFYEYVSIVDRVLLEWLLPATWISWLARKIIG-GSDEC-VLQSAEKL 217

Query: 206 LTHKQFVRQSLGLASQEMEEITTNWEFQDKFINYCEQNGTLIWFLFSSNDHWVSGKTRSH 265
           + +  +VRQ+LG+A  EM ++   W+FQ++FI  C++  + +W LFS +DHWV   T   
Sbjct: 218 VKNPSYVRQALGMAQLEMHQVRNQWDFQEEFIKTCQERRSSLWLLFSGHDHWVHSDTMKD 277

Query: 266 LSHYYKDKVDQNR---LEIDVTDKIPHSFVVKHAKYAINTFF 304
           +  +Y+ K   N    L I + + I HSFVVK     +N +F
Sbjct: 278 IVEFYEAKYGTNADSLLRITIDEHISHSFVVKDTTKVVNIYF 319

>Ecym_1241 Chr1 (494505..495422) [918 bp, 305 aa] {ON} similar to
           Ashbya gossypii AFR306C
          Length = 305

 Score =  192 bits (489), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 108/310 (34%), Positives = 173/310 (55%), Gaps = 13/310 (4%)

Query: 3   IQEYTKSKFPCSILNIKPTITRSDEDAALLVWIPGNPGXXXXXXXXXXXXHSKHPDWEIL 62
           ++ Y +      IL+I    ++S     LL++IPGNPG            H ++P WE++
Sbjct: 1   METYLREDIFADILHI---YSQSTPPGPLLLFIPGNPGLINFYEEFLKCIHERNPTWEVV 57

Query: 63  GISHAGMTLNAHSNT---PVYSLQDQVDHQVEVINNF--SHENRKIIIMGHSVGAYILQK 117
           GI H GM+    +N+    V++L +Q++ +V+VIN F  +  +R I ++GHS+GAY++QK
Sbjct: 58  GIGHTGMSSLRENNSLSGRVHTLDEQIEDKVKVINEFVDAGGDRCIKLIGHSIGAYMVQK 117

Query: 118 VCLSHNLVGTVQKVGLVTPTVMDIHTSEMGVKLTTALHYIPPLAHVVSLFSYIFFYWILS 177
           + L   L G +  V L+TPT++DIH S  GV+LT    + P       +   + F WIL 
Sbjct: 118 IALHKGLRGKIDMVMLLTPTIIDIHRSSKGVQLTRISDWFPKFYEYAYVVDRVLFKWILP 177

Query: 178 EGFSRFIIDKFMGCGSTSCQAVLSTRIFLTHKQFVRQSLGLASQEMEEITTNWEFQDKFI 237
             +  +I  K +G GS  C  + S +  ++  +FV+Q+LGLA  EM ++   W+FQD+FI
Sbjct: 178 TSWIEWIARKLIG-GSDEC-VLQSAQKLVSTPEFVKQALGLAQIEMYQVRNQWDFQDEFI 235

Query: 238 NYCEQNGTLIWFLFSSNDHWVSGKTRSHLSHYYKDKV---DQNRLEIDVTDKIPHSFVVK 294
           ++C+ N   + FLFS +DHWV   T   +   Y+ K    +++ L I +   I HSFVVK
Sbjct: 236 SFCQANKIKVRFLFSGHDHWVHPDTMKDIIELYEAKYSSDEKDLLNITIDGHINHSFVVK 295

Query: 295 HAKYAINTFF 304
                +N +F
Sbjct: 296 DTTKVVNIYF 305

>KAFR0E03110 Chr5 (621949..623019) [1071 bp, 356 aa] {ON} 
          Length = 356

 Score = 35.0 bits (79), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 28/116 (24%), Positives = 54/116 (46%), Gaps = 2/116 (1%)

Query: 21  TITRSDEDAALLVWIPGNPGXXXXXXXXXXXXHSKHPDWEILGISHAGMTLNAHSNTPVY 80
            + R D D+ L + IPG  G             + + ++  + +   G + + +SN  + 
Sbjct: 73  NVDRIDSDS-LFLCIPGLGGNLEQFEPLVRLIDASNKNFLAIDLPGFGKSED-YSNYSMT 130

Query: 81  SLQDQVDHQVEVINNFSHENRKIIIMGHSVGAYILQKVCLSHNLVGTVQKVGLVTP 136
            +   +D  +E +   + +N KI +MGHS+G ++        N   TV+K+ LV+P
Sbjct: 131 HIATLIDQMLETVIGTAPDNYKINVMGHSMGTHLALHFYELFNKKYTVEKLILVSP 186

>CAGL0M11462g Chr13 complement(1129244..1130404) [1161 bp, 386 aa]
           {ON} similar to uniprot|Q12385 Saccharomyces cerevisiae
           YLR099c ICT1
          Length = 386

 Score = 33.9 bits (76), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 39/79 (49%), Gaps = 7/79 (8%)

Query: 69  MTLNAHSNTPVYSLQDQVDHQVEVINNFSHENR--KIIIMGHSVGAYILQKVCLSHNLVG 126
           + L  H     Y LQ   D+ VE I  +  EN   K  ++GHS G Y+  K  L +    
Sbjct: 130 LMLRTHREKRRY-LQQYEDYYVESIEQWRKENNLDKFNLVGHSFGGYLSYKYALKY--PE 186

Query: 127 TVQKVGLVTPTVMD--IHT 143
           +V K+ L++P  M+  IH+
Sbjct: 187 SVNKLCLLSPLGMERNIHS 205

>Kpol_543.49 s543 complement(108945..110234) [1290 bp, 429 aa] {ON}
           complement(108945..110234) [1290 nt, 430 aa]
          Length = 429

 Score = 31.6 bits (70), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 38/83 (45%), Gaps = 4/83 (4%)

Query: 87  DHQVEVINNFSHENR--KIIIMGHSVGAYILQKVCLSHNLVGTVQKVGLVTPTVMDIHTS 144
           D+ VE I ++   N+  KI ++GHS G YI  K  + +     + ++ LV+P  M+ +  
Sbjct: 187 DYYVEKIEDWRKANKLEKINLVGHSFGGYISFKYAIKY--PDAINRLCLVSPLGMESNIH 244

Query: 145 EMGVKLTTALHYIPPLAHVVSLF 167
            +     T   Y   L    S F
Sbjct: 245 SVNNNFETKKEYPLDLEDPSSRF 267

>NCAS0E02830 Chr5 complement(556757..558130) [1374 bp, 457 aa] {ON}
           Anc_7.357 YLR195C
          Length = 457

 Score = 31.6 bits (70), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 23/36 (63%)

Query: 262 TRSHLSHYYKDKVDQNRLEIDVTDKIPHSFVVKHAK 297
           T+   SH++   VD+N+ E D+  KI  S+VV+ +K
Sbjct: 286 TKEEFSHWFLGNVDENKQEKDLEKKIVFSYVVEDSK 321

>CAGL0K05489g Chr11 (538801..539823) [1023 bp, 340 aa] {ON} similar
           to uniprot|P41834 Saccharomyces cerevisiae YOR075w
           syntaxin of the ER
          Length = 340

 Score = 30.8 bits (68), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 41/88 (46%), Gaps = 13/88 (14%)

Query: 68  GMTLNAHSNTPVYSLQDQVDHQVEVINNFSHENRKIIIMGHSVGAYILQKVCLSHNLVGT 127
            ++L    + PV  +QD++    E I+  + E  +++   H     I QK          
Sbjct: 205 SISLTVSQSQPVEHIQDEIKQYEETISQLTQEQLQVLETEHE--ELINQKN-------EQ 255

Query: 128 VQKVGLVTPTVMDIHTSEMGVKLTTALH 155
           ++KVGL+  T+M+I    +GV+   A H
Sbjct: 256 LKKVGLINKTIMEI----VGVQSELAAH 279

>YLR099C Chr12 complement(339744..340928) [1185 bp, 394 aa] {ON}
           ICT1Lysophosphatidic acid acyltransferase, responsible
           for enhanced phospholipid synthesis during organic
           solvent stress; null displays increased sensitivity to
           Calcofluor white; highly expressed during organic
           solvent stress
          Length = 394

 Score = 30.8 bits (68), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 57/127 (44%), Gaps = 27/127 (21%)

Query: 90  VEVINNFSHEN--RKIIIMGHSVGAYILQKVCLSHNLVGTVQKVGLVTPTVMDIHTSEMG 147
           V+ I  +  +N  RKI ++GHS G YI  K  L +    +++K+ L++P         +G
Sbjct: 162 VDRIEQWRKDNKLRKINVVGHSFGGYISFKYALKY--PDSIEKLCLISP---------LG 210

Query: 148 VKLTTALHYI-----PPLAHVVSLFSYIFFYWILSEGFSRFIID------KFMG-CGSTS 195
           V+   ++H I     P   + ++       Y+       RFI +      K+MG  GS  
Sbjct: 211 VE--NSIHAITHKWEPNTTYPLTFTDPSSRYYTRKLNVPRFIFENQLNVLKWMGPIGSKL 268

Query: 196 CQAVLST 202
           C   +ST
Sbjct: 269 CSNYIST 275

>Smik_12.158 Chr12 complement(319660..320844) [1185 bp, 394 aa] {ON}
           YLR099C (REAL)
          Length = 394

 Score = 30.8 bits (68), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 37/149 (24%), Positives = 63/149 (42%), Gaps = 27/149 (18%)

Query: 82  LQDQVDHQVEVINNFSHEN--RKIIIMGHSVGAYILQKVCLSHNLVGTVQKVGLVTPTVM 139
           L+   ++ V+ I  +  +N  RKI ++GHS G YI  K  L +    ++ K+ L++P   
Sbjct: 154 LEQYENYFVDRIEQWRKDNKLRKINVVGHSFGGYISFKYALKY--PNSIDKLCLISP--- 208

Query: 140 DIHTSEMGVKLTTALHYI-----PPLAHVVSLFSYIFFYWILSEGFSRFIID------KF 188
                 +GV+   ++H I     P   + ++       Y+       RFI +      K+
Sbjct: 209 ------LGVE--NSIHAITHKWEPNTTYPLTFTDPSSRYYTRKLNVPRFIFENQLNVLKW 260

Query: 189 MG-CGSTSCQAVLSTRIFLTHKQFVRQSL 216
           MG  GS  C   +ST       Q  +  L
Sbjct: 261 MGPIGSKLCSNYISTAYVKVPDQIYKDYL 289

>KLLA0F19624g Chr6 complement(1817206..1818435) [1230 bp, 409 aa]
           {ON} similar to uniprot|Q04623 Saccharomyces cerevisiae
           YDR125C ECM18 Protein of unknown function, similar to
           Rlp24p
          Length = 409

 Score = 30.4 bits (67), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 4/52 (7%)

Query: 87  DHQVEVINNFSHENR--KIIIMGHSVGAYILQKVCLSHNLVGTVQKVGLVTP 136
           D+ V+ +  +  EN+  KI ++GHS G Y+  K  L +     V K+ LV+P
Sbjct: 174 DYYVDALEKWRKENKLSKINLVGHSYGGYLTFKYSLKY--PDNVHKLCLVSP 223

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.136    0.423 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 32,323,748
Number of extensions: 1332610
Number of successful extensions: 3156
Number of sequences better than 10.0: 36
Number of HSP's gapped: 3196
Number of HSP's successfully gapped: 36
Length of query: 304
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 195
Effective length of database: 40,982,805
Effective search space: 7991646975
Effective search space used: 7991646975
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 65 (29.6 bits)