Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_16.398singletonON46462355e-28
YPR146CsingletonOFF10946790.001
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_16.398
         (46 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_16.398 Chr16 complement(697286..697366,697370..697426) [138...    95   5e-28
YPR146C Chr16 complement(825347..825676) [330 bp, 109 aa] {OFF} ...    35   0.001

>Smik_16.398 Chr16 complement(697286..697366,697370..697426) [138
          bp, 46 aa] {ON}  YPR146C (REAL)
          Length = 46

 Score = 95.1 bits (235), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 46/46 (100%), Positives = 46/46 (100%)

Query: 1  IYITIKRSEALIAPRTSTMGCLFFFNTMEIVLASFGGVDFLCKDLA 46
          IYITIKRSEALIAPRTSTMGCLFFFNTMEIVLASFGGVDFLCKDLA
Sbjct: 1  IYITIKRSEALIAPRTSTMGCLFFFNTMEIVLASFGGVDFLCKDLA 46

>YPR146C Chr16 complement(825347..825676) [330 bp, 109 aa] {OFF}
           Dubious open reading frame unlikely to encode a
           functional protein, based on available experimental and
           comparative sequence data
          Length = 109

 Score = 35.0 bits (79), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/46 (45%), Positives = 25/46 (54%)

Query: 1   IYITIKRSEALIAPRTSTMGCLFFFNTMEIVLASFGGVDFLCKDLA 46
           +YI+   SEA IA R ST+    F  TM    ASFG   F  +DLA
Sbjct: 64  MYISTNGSEASIASRMSTLESCLFLITMNKGSASFGKRRFFYRDLA 109

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.333    0.145    0.434 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 3,713,961
Number of extensions: 74769
Number of successful extensions: 182
Number of sequences better than 10.0: 2
Number of HSP's gapped: 184
Number of HSP's successfully gapped: 2
Length of query: 46
Length of database: 53,481,399
Length adjustment: 20
Effective length of query: 26
Effective length of database: 51,188,079
Effective search space: 1330890054
Effective search space used: 1330890054
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.5 bits)
S2: 59 (27.3 bits)