Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_16.3973.484ON83833683e-47
Skud_16.4403.484ON76652833e-34
YPR145C-A3.484ON78652573e-30
Suva_16.4753.484ON77622191e-24
NCAS0F035203.484ON7663680.11
Kpol_1030.308.758ON146953631.4
NOTE: 7 genes in the same pillar as Smik_16.397 were not hit in these BLAST results
LIST: Kpol_YGOB_YPR145C-A KAFR0G03675 KNAG0A07925 Agos_YGOB_YPR145C-A TPHA0D04205 NDAI0B05820 Cgla_YGOB_Anc_3.484

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_16.397
         (83 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_16.397 Chr16 complement(696642..696893) [252 bp, 83 aa] {ON...   146   3e-47
Skud_16.440 Chr16 complement(778385..778615) [231 bp, 76 aa] {ON...   113   3e-34
YPR145C-A Chr16 complement(824690..824926) [237 bp, 78 aa] {ON} ...   103   3e-30
Suva_16.475 Chr16 complement(821114..821347) [234 bp, 77 aa] {ON...    89   1e-24
NCAS0F03520 Chr6 complement(705454..705684) [231 bp, 76 aa] {ON}       31   0.11 
Kpol_1030.30 s1030 complement(60112..64521) [4410 bp, 1469 aa] {...    29   1.4  

>Smik_16.397 Chr16 complement(696642..696893) [252 bp, 83 aa] {ON}
          YPR145C-A (REAL)
          Length = 83

 Score =  146 bits (368), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 73/83 (87%), Positives = 73/83 (87%)

Query: 1  MSITFRKIKLIFKKNDSRYPQNYRAEMKSKNTVITRHDLLIAHEREQRASLDRTNSISNL 60
          MSITFRKIKLIFKKNDSRYPQNYRAEMKSKNTVITRHDLLIAHEREQRASLDRTNSISNL
Sbjct: 1  MSITFRKIKLIFKKNDSRYPQNYRAEMKSKNTVITRHDLLIAHEREQRASLDRTNSISNL 60

Query: 61 QSHXXXXXXXXXXAYKLVNDSIN 83
          QSH          AYKLVNDSIN
Sbjct: 61 QSHEKRREERSKRAYKLVNDSIN 83

>Skud_16.440 Chr16 complement(778385..778615) [231 bp, 76 aa] {ON}
          YPR145C-A (REAL)
          Length = 76

 Score =  113 bits (283), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 57/65 (87%), Positives = 60/65 (92%), Gaps = 2/65 (3%)

Query: 1  MSITFRKIKLIFKKNDSRYPQNYRAEMKSKN--TVITRHDLLIAHEREQRASLDRTNSIS 58
          MSITFRKIKLIFK+NDS YPQ+YRAEMKSKN  TVITRHDLLIAHEREQRASLDR +SIS
Sbjct: 1  MSITFRKIKLIFKRNDSEYPQSYRAEMKSKNKNTVITRHDLLIAHEREQRASLDRISSIS 60

Query: 59 NLQSH 63
          NLQS 
Sbjct: 61 NLQSQ 65

>YPR145C-A Chr16 complement(824690..824926) [237 bp, 78 aa] {ON}
          Putative protein of unknown function
          Length = 78

 Score =  103 bits (257), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 52/65 (80%), Positives = 58/65 (89%), Gaps = 2/65 (3%)

Query: 1  MSITFRKIKLIFKKNDSRYPQNYRAEMKS--KNTVITRHDLLIAHEREQRASLDRTNSIS 58
          MS  FRKIKLIFKK+DS+YPQNYRAE+KS  KNTVITRHDLLIAHE +QRASL+R+NSI 
Sbjct: 1  MSTAFRKIKLIFKKSDSQYPQNYRAEIKSRNKNTVITRHDLLIAHEMKQRASLERSNSIR 60

Query: 59 NLQSH 63
          NLQS 
Sbjct: 61 NLQSQ 65

>Suva_16.475 Chr16 complement(821114..821347) [234 bp, 77 aa] {ON}
          YPR145C-A (REAL)
          Length = 77

 Score = 89.0 bits (219), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 45/62 (72%), Positives = 53/62 (85%), Gaps = 2/62 (3%)

Query: 1  MSITFRKIKLIFKKNDSRYPQNYRAEMK--SKNTVITRHDLLIAHEREQRASLDRTNSIS 58
          MS TF+KIKL+FK+ND +Y  NY  EMK  +KNTVITRHDLLIA+E+EQRASLDR+NSI 
Sbjct: 1  MSATFKKIKLMFKRNDRQYSPNYGTEMKPKNKNTVITRHDLLIAYEKEQRASLDRSNSIR 60

Query: 59 NL 60
          NL
Sbjct: 61 NL 62

>NCAS0F03520 Chr6 complement(705454..705684) [231 bp, 76 aa] {ON}
          Length = 76

 Score = 30.8 bits (68), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 32/63 (50%), Gaps = 2/63 (3%)

Query: 1  MSITFRKIKLIFKKNDSRYPQNYRAEMKSKNTVITRHDLLIAHEREQRASLDRTNSISNL 60
          MS  F K+K IF+   + +  N   + ++K  V+TR+DLL  H R    S  R+ S S  
Sbjct: 8  MSNIFNKLKHIFETESTTHTDNRHVQKQTKPDVVTRYDLL--HGRNGAKSNLRSKSKSKG 65

Query: 61 QSH 63
            H
Sbjct: 66 GKH 68

>Kpol_1030.30 s1030 complement(60112..64521) [4410 bp, 1469 aa] {ON}
            complement(60112..64521) [4410 nt, 1470 aa]
          Length = 1469

 Score = 28.9 bits (63), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 1    MSITFRKIKLIFKKNDSRYPQNYRAEMKSKNTVITRHDLLIAHE-REQRASLD 52
            + +T    +L+FK ND+ Y + YR E+  K ++  R      HE  EQ  SLD
Sbjct: 1125 LGVTGEVFRLLFK-NDTDYSETYRNEVLLKTSIYARMSPDEKHELMEQLQSLD 1176

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.128    0.343 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 7,169,425
Number of extensions: 216835
Number of successful extensions: 653
Number of sequences better than 10.0: 12
Number of HSP's gapped: 650
Number of HSP's successfully gapped: 12
Length of query: 83
Length of database: 53,481,399
Length adjustment: 55
Effective length of query: 28
Effective length of database: 47,174,769
Effective search space: 1320893532
Effective search space used: 1320893532
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 59 (27.3 bits)