Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_16.3963.483ON57257230110.0
YPR145W (ASN1)3.483ON57257229280.0
Skud_16.4393.483ON57257229270.0
Suva_16.4743.483ON57257229120.0
Smik_6.2203.483ON57257226630.0
YGR124W (ASN2)3.483ON57257126520.0
Kpol_480.193.483ON57457126430.0
CAGL0I10648g3.483ON57457226240.0
Suva_7.4103.483ON57257226220.0
Skud_7.4353.483ON57257326190.0
TDEL0D055203.483ON57357125990.0
NCAS0F035103.483ON57557325980.0
KLLA0B10868g3.483ON57457225970.0
KNAG0A079203.483ON57857625970.0
KAFR0G036703.483ON57257125960.0
SAKL0F02970g3.483ON57357125920.0
NDAI0B058103.483ON57757625790.0
Kwal_55.211873.483ON57357125680.0
KLTH0F14630g3.483ON57357225660.0
TPHA0D042003.483ON57457125310.0
ZYRO0B04136g3.483ON57257224950.0
TBLA0C044303.483ON58057924860.0
AFR303W3.483ON57157124820.0
Ecym_12443.483ON57357124110.0
ZYRO0A00528g8.875ON5121031351e-07
Kpol_455.78.875ON518941261e-06
ADL350C8.875ON508891223e-06
NCAS0C001908.875ON5171051207e-06
KLLA0D10285g8.875ON5151061171e-05
Skud_13.468.875ON5191011171e-05
SAKL0D00352g8.875ON515891171e-05
KAFR0L021108.875ON514951172e-05
TPHA0C049508.875ON525991162e-05
Suva_13.528.875ON519991152e-05
KNAG0J002008.875ON5151021153e-05
NDAI0K001808.875ON522941143e-05
YML096W8.875ON525951125e-05
TDEL0B004408.875ON516941126e-05
TBLA0C063008.875ON5181241118e-05
Smik_13.398.875ON521961119e-05
Skud_7.311singletonON8189981e-04
Kwal_27.97058.875ON515871082e-04
Ecym_81558.875ON513911072e-04
KLTH0E16412g8.875ON515951010.001
CAGL0H06963g8.875ON51780980.003
TDEL0C032007.456ON19662713.0
Smik_4.2393.198ON46162706.2
YDR004W (RAD57)3.198ON46032697.5
ADR413C7.10ON60027697.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_16.396
         (572 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_16.396 Chr16 (694650..696368) [1719 bp, 572 aa] {ON} YPR145...  1164   0.0  
YPR145W Chr16 (822620..824338) [1719 bp, 572 aa] {ON}  ASN1Aspar...  1132   0.0  
Skud_16.439 Chr16 (776317..778035) [1719 bp, 572 aa] {ON} YPR145...  1132   0.0  
Suva_16.474 Chr16 (819031..820749) [1719 bp, 572 aa] {ON} YGR124...  1126   0.0  
Smik_6.220 Chr6 (357844..359562) [1719 bp, 572 aa] {ON} YGR124W ...  1030   0.0  
YGR124W Chr7 (739944..741662) [1719 bp, 572 aa] {ON}  ASN2Aspara...  1026   0.0  
Kpol_480.19 s480 complement(42251..43975) [1725 bp, 574 aa] {ON}...  1022   0.0  
CAGL0I10648g Chr9 complement(1053030..1054754) [1725 bp, 574 aa]...  1015   0.0  
Suva_7.410 Chr7 (709927..711645) [1719 bp, 572 aa] {ON} YPR145W ...  1014   0.0  
Skud_7.435 Chr7 (719202..720920) [1719 bp, 572 aa] {ON} YGR124W ...  1013   0.0  
TDEL0D05520 Chr4 (996468..998189) [1722 bp, 573 aa] {ON} Anc_3.4...  1005   0.0  
NCAS0F03510 Chr6 (703369..705096) [1728 bp, 575 aa] {ON} Anc_3.4...  1005   0.0  
KLLA0B10868g Chr2 complement(951111..952835) [1725 bp, 574 aa] {...  1004   0.0  
KNAG0A07920 Chr1 (1262894..1264630) [1737 bp, 578 aa] {ON} Anc_3...  1004   0.0  
KAFR0G03670 Chr7 (758115..759833) [1719 bp, 572 aa] {ON} Anc_3.4...  1004   0.0  
SAKL0F02970g Chr6 complement(252336..254057) [1722 bp, 573 aa] {...  1003   0.0  
NDAI0B05810 Chr2 (1412089..1413822) [1734 bp, 577 aa] {ON} Anc_3...   998   0.0  
Kwal_55.21187 s55 (723404..725125) [1722 bp, 573 aa] {ON} YPR145...   993   0.0  
KLTH0F14630g Chr6 (1198036..1199757) [1722 bp, 573 aa] {ON} high...   993   0.0  
TPHA0D04200 Chr4 (904705..906429) [1725 bp, 574 aa] {ON} Anc_3.4...   979   0.0  
ZYRO0B04136g Chr2 complement(345085..346803) [1719 bp, 572 aa] {...   965   0.0  
TBLA0C04430 Chr3 (1072027..1073769) [1743 bp, 580 aa] {ON} Anc_3...   962   0.0  
AFR303W Chr6 (989036..990751) [1716 bp, 571 aa] {ON} Syntenic ho...   960   0.0  
Ecym_1244 Chr1 complement(501719..503440) [1722 bp, 573 aa] {ON}...   933   0.0  
ZYRO0A00528g Chr1 (35425..36963) [1539 bp, 512 aa] {ON} similar ...    57   1e-07
Kpol_455.7 s455 complement(6566..8122) [1557 bp, 518 aa] {ON} co...    53   1e-06
ADL350C Chr4 complement(90152..91678) [1527 bp, 508 aa] {ON} Syn...    52   3e-06
NCAS0C00190 Chr3 complement(17177..18730) [1554 bp, 517 aa] {ON}...    51   7e-06
KLLA0D10285g Chr4 (869754..871301) [1548 bp, 515 aa] {ON} simila...    50   1e-05
Skud_13.46 Chr13 (79277..80836) [1560 bp, 519 aa] {ON} YML096W (...    50   1e-05
SAKL0D00352g Chr4 (31387..32934) [1548 bp, 515 aa] {ON} similar ...    50   1e-05
KAFR0L02110 Chr12 complement(400443..401987) [1545 bp, 514 aa] {...    50   2e-05
TPHA0C04950 Chr3 complement(1067043..1068620) [1578 bp, 525 aa] ...    49   2e-05
Suva_13.52 Chr13 (81009..82568) [1560 bp, 519 aa] {ON} YML096W (...    49   2e-05
KNAG0J00200 Chr10 complement(24044..25591) [1548 bp, 515 aa] {ON...    49   3e-05
NDAI0K00180 Chr11 (27899..29467) [1569 bp, 522 aa] {ON} Anc_8.87...    49   3e-05
YML096W Chr13 (79909..81486) [1578 bp, 525 aa] {ON} Putative pro...    48   5e-05
TDEL0B00440 Chr2 complement(78116..79666) [1551 bp, 516 aa] {ON}...    48   6e-05
TBLA0C06300 Chr3 (1523556..1525112) [1557 bp, 518 aa] {ON} Anc_8...    47   8e-05
Smik_13.39 Chr13 (77004..78569) [1566 bp, 521 aa] {ON} YML096W (...    47   9e-05
Skud_7.311 Chr7 complement(535445..535513,535517..535621,535625....    42   1e-04
Kwal_27.9705 s27 (28837..30384) [1548 bp, 515 aa] {ON} YML096W -...    46   2e-04
Ecym_8155 Chr8 complement(324050..325591) [1542 bp, 513 aa] {ON}...    46   2e-04
KLTH0E16412g Chr5 complement(1455298..1456845) [1548 bp, 515 aa]...    44   0.001
CAGL0H06963g Chr8 (689948..691501) [1554 bp, 517 aa] {ON} simila...    42   0.003
TDEL0C03200 Chr3 complement(566646..567236) [591 bp, 196 aa] {ON...    32   3.0  
Smik_4.239 Chr4 (434533..435918) [1386 bp, 461 aa] {ON} YDR004W ...    32   6.2  
YDR004W Chr4 (455201..456583) [1383 bp, 460 aa] {ON}  RAD57Prote...    31   7.5  
ADR413C Chr4 complement(1448030..1449832) [1803 bp, 600 aa] {ON}...    31   7.8  

>Smik_16.396 Chr16 (694650..696368) [1719 bp, 572 aa] {ON} YPR145W
           (REAL)
          Length = 572

 Score = 1164 bits (3011), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 560/572 (97%), Positives = 560/572 (97%)

Query: 1   MCGIFAAFKHEDVHNYKPKALQLSKRIRHRGPDWSGNAIKNSTIFVHERLAIVGLESGAQ 60
           MCGIFAAFKHEDVHNYKPKALQLSKRIRHRGPDWSGNAIKNSTIFVHERLAIVGLESGAQ
Sbjct: 1   MCGIFAAFKHEDVHNYKPKALQLSKRIRHRGPDWSGNAIKNSTIFVHERLAIVGLESGAQ 60

Query: 61  PITSPDEDYMLCVNGEIYNHIQLREECPEYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF 120
           PITSPDEDYMLCVNGEIYNHIQLREECPEYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF
Sbjct: 61  PITSPDEDYMLCVNGEIYNHIQLREECPEYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF 120

Query: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180
           AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV
Sbjct: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPY          
Sbjct: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETANATNDVDPSTYDSKARHLAGVDDDGKLHTAGWTSLHSFAIGLPNAPDL 300
             IASIAARETANATNDVDPSTYDSKARHLAGVDDDGKLHTAGWTSLHSFAIGLPNAPDL
Sbjct: 241 SLIASIAARETANATNDVDPSTYDSKARHLAGVDDDGKLHTAGWTSLHSFAIGLPNAPDL 300

Query: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDKEFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQKE 480
           VPFLDKEFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQKE
Sbjct: 421 VPFLDKEFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDTAETVISDEMFASPKAEWGSDIPSTKEAFWYRLKFDALFPQKTV 540
           QFSDGVGYSWIDGLKDTAETVISDEMFASPKAEWGSDIPSTKEAFWYRLKFDALFPQKTV
Sbjct: 481 QFSDGVGYSWIDGLKDTAETVISDEMFASPKAEWGSDIPSTKEAFWYRLKFDALFPQKTV 540

Query: 541 ADTVMRWIPKADWGCAEDPSGRYAQIHEKHID 572
           ADTVMRWIPKADWGCAEDPSGRYAQIHEKHID
Sbjct: 541 ADTVMRWIPKADWGCAEDPSGRYAQIHEKHID 572

>YPR145W Chr16 (822620..824338) [1719 bp, 572 aa] {ON}
           ASN1Asparagine synthetase, isozyme of Asn2p; catalyzes
           the synthesis of L-asparagine from L-aspartate in the
           asparagine biosynthetic pathway
          Length = 572

 Score = 1132 bits (2928), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 541/572 (94%), Positives = 552/572 (96%)

Query: 1   MCGIFAAFKHEDVHNYKPKALQLSKRIRHRGPDWSGNAIKNSTIFVHERLAIVGLESGAQ 60
           MCGIFAAF+HEDVH YKPKALQLSKRIRHRGPDWSGNAIKNSTIFVHERLAIVG+ESGAQ
Sbjct: 1   MCGIFAAFRHEDVHRYKPKALQLSKRIRHRGPDWSGNAIKNSTIFVHERLAIVGVESGAQ 60

Query: 61  PITSPDEDYMLCVNGEIYNHIQLREECPEYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF 120
           PITS D +YMLCVNGEIYNHIQLREEC +Y+F TLSDCEPIIPMYLKHDIDAPKYLDGMF
Sbjct: 61  PITSSDGEYMLCVNGEIYNHIQLREECADYEFGTLSDCEPIIPMYLKHDIDAPKYLDGMF 120

Query: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180
           AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV
Sbjct: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSKTDKITRYFTPDWLDEKRIPSTPIDY+AIRHSLEKAVRKRLMAEVPY          
Sbjct: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYMAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETANATNDVDPSTYDSKARHLAGVDDDGKLHTAGWTSLHSFAIGLPNAPDL 300
             IASIAARETA ATNDV+PSTYDSKARHLAG+DDDGKLHTAGWTSLHSFAIGLPNAPDL
Sbjct: 241 SLIASIAARETAKATNDVEPSTYDSKARHLAGIDDDGKLHTAGWTSLHSFAIGLPNAPDL 300

Query: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           QAARKVAKFIGS HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDKEFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQKE 480
           VPFLD+EFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQKE
Sbjct: 421 VPFLDREFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDTAETVISDEMFASPKAEWGSDIPSTKEAFWYRLKFDALFPQKTV 540
           QFSDGVGYSWIDGLKDTAE VISDEMFASPKAEWGSDIP+TKEAFWYRLKFDALFPQKTV
Sbjct: 481 QFSDGVGYSWIDGLKDTAEAVISDEMFASPKAEWGSDIPTTKEAFWYRLKFDALFPQKTV 540

Query: 541 ADTVMRWIPKADWGCAEDPSGRYAQIHEKHID 572
           ADTVMRWIPKADWGCAEDPSGRYAQIHEKHI+
Sbjct: 541 ADTVMRWIPKADWGCAEDPSGRYAQIHEKHIE 572

>Skud_16.439 Chr16 (776317..778035) [1719 bp, 572 aa] {ON} YPR145W
           (REAL)
          Length = 572

 Score = 1132 bits (2927), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 540/572 (94%), Positives = 551/572 (96%)

Query: 1   MCGIFAAFKHEDVHNYKPKALQLSKRIRHRGPDWSGNAIKNSTIFVHERLAIVGLESGAQ 60
           MCGIFAA+KHEDVH YK KALQLSKRIRHRGPDWSGNA KNSTIFVHERLAIVGLESGAQ
Sbjct: 1   MCGIFAAYKHEDVHRYKQKALQLSKRIRHRGPDWSGNATKNSTIFVHERLAIVGLESGAQ 60

Query: 61  PITSPDEDYMLCVNGEIYNHIQLREECPEYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF 120
           PITSPDEDYMLCVNGEIYNHIQLREECP+YQFKTLSDCEPIIPMYLKHDI+APKYLDGMF
Sbjct: 61  PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIEAPKYLDGMF 120

Query: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180
           AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV
Sbjct: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSKTDKITRYFTPDWLDEKRIPSTPIDY+AIRHSLEKAVRKRLMAEVP+          
Sbjct: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYMAIRHSLEKAVRKRLMAEVPFGVLLSGGLDS 240

Query: 241 XXIASIAARETANATNDVDPSTYDSKARHLAGVDDDGKLHTAGWTSLHSFAIGLPNAPDL 300
             IASIAARETANATNDV+PSTYDSKARHLAGVDDDG LHTAGWTSLHSFAIGLPNAPDL
Sbjct: 241 SLIASIAARETANATNDVEPSTYDSKARHLAGVDDDGNLHTAGWTSLHSFAIGLPNAPDL 300

Query: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDKEFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQKE 480
           VPFLD+EFLQLCMNIDP EKMI+ KEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQKE
Sbjct: 421 VPFLDREFLQLCMNIDPKEKMIRAKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDTAETVISDEMFASPKAEWGSDIPSTKEAFWYRLKFDALFPQKTV 540
           QFSDGVGYSWID LKD AE VISDEMFASPKAEWGSDIP+TKEAFWYRLKFDALFPQKTV
Sbjct: 481 QFSDGVGYSWIDSLKDNAEAVISDEMFASPKAEWGSDIPTTKEAFWYRLKFDALFPQKTV 540

Query: 541 ADTVMRWIPKADWGCAEDPSGRYAQIHEKHID 572
           ADTVMRW+PKADWGCAEDPSGRYAQIHEKHI+
Sbjct: 541 ADTVMRWVPKADWGCAEDPSGRYAQIHEKHIE 572

>Suva_16.474 Chr16 (819031..820749) [1719 bp, 572 aa] {ON} YGR124W
           (REAL)
          Length = 572

 Score = 1126 bits (2912), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 534/572 (93%), Positives = 552/572 (96%)

Query: 1   MCGIFAAFKHEDVHNYKPKALQLSKRIRHRGPDWSGNAIKNSTIFVHERLAIVGLESGAQ 60
           MCGIFAAFKHEDVH YKPKALQLSKRIRHRGPDWSGNA+KNSTIFVHERLAIVGL+SGAQ
Sbjct: 1   MCGIFAAFKHEDVHRYKPKALQLSKRIRHRGPDWSGNAVKNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PITSPDEDYMLCVNGEIYNHIQLREECPEYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF 120
           PITSPDEDYMLCVNGEIYNHIQLREECP+YQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF
Sbjct: 61  PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF 120

Query: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180
           AWTLYDAKQDRI+AARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV
Sbjct: 121 AWTLYDAKQDRIIAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVP+          
Sbjct: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPFGVLLSGGLDS 240

Query: 241 XXIASIAARETANATNDVDPSTYDSKARHLAGVDDDGKLHTAGWTSLHSFAIGLPNAPDL 300
             IA+IAARETA ATNDV+PSTYD+KARHLAGVDD+G LHTAGWTSLHSFAIGLPNAPDL
Sbjct: 241 SLIAAIAARETAKATNDVEPSTYDNKARHLAGVDDEGNLHTAGWTSLHSFAIGLPNAPDL 300

Query: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDKEFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQKE 480
           VPFLD+EFLQLCMNIDP+EKMI+PKEGRIEKYILRKAFDTT EP+ KPYLPEEILWRQKE
Sbjct: 421 VPFLDREFLQLCMNIDPSEKMIRPKEGRIEKYILRKAFDTTDEPETKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDTAETVISDEMFASPKAEWGSDIPSTKEAFWYRLKFDALFPQKTV 540
           QFSDGVGYSWID LKDTAE VISDEMFA+PKAEWG+DIP+TKEA+WYRLKFD LFPQKTV
Sbjct: 481 QFSDGVGYSWIDSLKDTAEAVISDEMFANPKAEWGNDIPTTKEAYWYRLKFDGLFPQKTV 540

Query: 541 ADTVMRWIPKADWGCAEDPSGRYAQIHEKHID 572
           ADTVMRW+PKADWGCAEDPSGRYAQIHEKHID
Sbjct: 541 ADTVMRWVPKADWGCAEDPSGRYAQIHEKHID 572

>Smik_6.220 Chr6 (357844..359562) [1719 bp, 572 aa] {ON} YGR124W
           (REAL)
          Length = 572

 Score = 1030 bits (2663), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 489/572 (85%), Positives = 526/572 (91%), Gaps = 3/572 (0%)

Query: 1   MCGIFAAFKHEDVHNYKPKALQLSKRIRHRGPDWSGNAIKNSTIFVHERLAIVGLESGAQ 60
           MCGIFAAFKH+D+H++KPKALQLSKRIRHRGPDWSGNA+ NSTIFVHERLAIVGL+SGAQ
Sbjct: 1   MCGIFAAFKHDDIHSFKPKALQLSKRIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PITSPDEDYMLCVNGEIYNHIQLREECPEYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF 120
           PITS D +YML VNGEIYNHIQLREEC +Y+F+T SDCEPIIP+YL+HDIDAPKYLDGMF
Sbjct: 61  PITSADGEYMLGVNGEIYNHIQLREECSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120

Query: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180
           A+ +YDAK+DRIVAARDPIG+ TLYMGRSS SPKTVYFASELKCLTD CD+I AFPPGHV
Sbjct: 121 AFCIYDAKKDRIVAARDPIGVVTLYMGRSSKSPKTVYFASELKCLTDVCDSIIAFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TDKITRYFTPDWLDEKRIPSTP+DYLAIRHSLEKAVRKRLMAEVPY          
Sbjct: 181 YDSQTDKITRYFTPDWLDEKRIPSTPVDYLAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETANATNDVDP-STYDSKARHLAGVDDDGKLHTAGWTSLHSFAIGLPNAPD 299
             IA+IAARET  A  DV+  S+ D K   LAG+DD G LHT+GW+ LHSFAIGLPNAPD
Sbjct: 241 SLIAAIAARETEKANADVNEESSVDEK--QLAGIDDQGHLHTSGWSRLHSFAIGLPNAPD 298

Query: 300 LQAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 359
           LQAARKVAKFIGS HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ
Sbjct: 299 LQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 358

Query: 360 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEA 419
           GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEA
Sbjct: 359 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEA 418

Query: 420 RVPFLDKEFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQK 479
           RVPFLDK+FLQLCMNIDP +KMIKPKEG+IEKYILRKAFDTT EPD KPYLPEEILWRQK
Sbjct: 419 RVPFLDKDFLQLCMNIDPKDKMIKPKEGKIEKYILRKAFDTTNEPDVKPYLPEEILWRQK 478

Query: 480 EQFSDGVGYSWIDGLKDTAETVISDEMFASPKAEWGSDIPSTKEAFWYRLKFDALFPQKT 539
           EQFSDGVGYSWIDGL+DTAE VISD MFA+PKA+WG DIP+TKEA+WYRLKFDA FPQKT
Sbjct: 479 EQFSDGVGYSWIDGLRDTAERVISDTMFANPKADWGDDIPTTKEAYWYRLKFDAWFPQKT 538

Query: 540 VADTVMRWIPKADWGCAEDPSGRYAQIHEKHI 571
            A+TVMRW+PKADWGCAEDPSGRYA+IHEKH+
Sbjct: 539 AANTVMRWVPKADWGCAEDPSGRYAKIHEKHV 570

>YGR124W Chr7 (739944..741662) [1719 bp, 572 aa] {ON}
           ASN2Asparagine synthetase, isozyme of Asn1p; catalyzes
           the synthesis of L-asparagine from L-aspartate in the
           asparagine biosynthetic pathway
          Length = 572

 Score = 1026 bits (2652), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 486/571 (85%), Positives = 521/571 (91%), Gaps = 1/571 (0%)

Query: 1   MCGIFAAFKHEDVHNYKPKALQLSKRIRHRGPDWSGNAIKNSTIFVHERLAIVGLESGAQ 60
           MCGIFAAFKHED+HN+KPKALQLSK+IRHRGPDWSGNA+ NSTIFVHERLAIVGL+SGAQ
Sbjct: 1   MCGIFAAFKHEDIHNFKPKALQLSKKIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PITSPDEDYMLCVNGEIYNHIQLREECPEYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF 120
           PITS D +YML VNGEIYNHIQLRE C +Y+F+T SDCEPIIP+YL+HDIDAPKYLDGMF
Sbjct: 61  PITSADGEYMLGVNGEIYNHIQLREMCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120

Query: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180
           A+ LYD+K+DRIVAARDPIG+ TLYMGRSS SP+TVYFASELKCLTD CD+I +FPPGHV
Sbjct: 121 AFCLYDSKKDRIVAARDPIGVVTLYMGRSSQSPETVYFASELKCLTDVCDSIISFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TDKITRYFTPDWLDEKRIPSTP+DY AIRHSLEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDKITRYFTPDWLDEKRIPSTPVDYHAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETANATNDVDPSTYDSKARHLAGVDDDGKLHTAGWTSLHSFAIGLPNAPDL 300
             IA+IAARET  A  D +    +   + LAG+DD G LHT+GW+ LHSFAIGLPNAPDL
Sbjct: 241 SLIAAIAARETEKANADANEDN-NVDEKQLAGIDDQGHLHTSGWSRLHSFAIGLPNAPDL 299

Query: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           QAARKVAKFIGS HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 300 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 359

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 360 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 419

Query: 421 VPFLDKEFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQKE 480
           VPFLDK+FLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTT EPD KPYLPEEILWRQKE
Sbjct: 420 VPFLDKDFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 479

Query: 481 QFSDGVGYSWIDGLKDTAETVISDEMFASPKAEWGSDIPSTKEAFWYRLKFDALFPQKTV 540
           QFSDGVGYSWIDGL+DTAE  ISD MFA+PKA+WG DIP+TKEA+WYRLKFDA FPQKT 
Sbjct: 480 QFSDGVGYSWIDGLRDTAERAISDAMFANPKADWGDDIPTTKEAYWYRLKFDAWFPQKTA 539

Query: 541 ADTVMRWIPKADWGCAEDPSGRYAQIHEKHI 571
           ADTVMRWIPKADWGCAEDPSGRYA+IHEKH+
Sbjct: 540 ADTVMRWIPKADWGCAEDPSGRYAKIHEKHV 570

>Kpol_480.19 s480 complement(42251..43975) [1725 bp, 574 aa] {ON}
           complement(42251..43975) [1725 nt, 575 aa]
          Length = 574

 Score = 1022 bits (2643), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 478/571 (83%), Positives = 521/571 (91%)

Query: 1   MCGIFAAFKHEDVHNYKPKALQLSKRIRHRGPDWSGNAIKNSTIFVHERLAIVGLESGAQ 60
           MCGIFAA+KHE+   +KP+ALQLSKRIRHRGPDWSGN +KNSTI VHERLAIVGL+SGAQ
Sbjct: 1   MCGIFAAYKHENAEAFKPRALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLDSGAQ 60

Query: 61  PITSPDEDYMLCVNGEIYNHIQLREECPEYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF 120
           PITSP  DY+LCVNGEIYNHIQLRE CP+Y++KTLSDCEPIIP+YLKHDIDAPKYLDGMF
Sbjct: 61  PITSPCGDYVLCVNGEIYNHIQLRESCPDYKYKTLSDCEPIIPLYLKHDIDAPKYLDGMF 120

Query: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180
           AW LYDAK+DRI+AARDPIGITTLYMGR+S SPKTV+FASELKCLTDDCD+I AFPPGHV
Sbjct: 121 AWCLYDAKKDRIIAARDPIGITTLYMGRNSKSPKTVFFASELKCLTDDCDSIMAFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TD+ITRYF+PDW+DE+RIP+ P+ Y AIR SLEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDQITRYFSPDWIDEQRIPTEPVSYKAIRESLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETANATNDVDPSTYDSKARHLAGVDDDGKLHTAGWTSLHSFAIGLPNAPDL 300
             IASIAARET  A  ++D + YDS+ +HL G+DD G LHTAGW+ LHSFAIGLPNAPDL
Sbjct: 241 SLIASIAARETEKAMKEMDTTAYDSEDKHLTGIDDQGNLHTAGWSRLHSFAIGLPNAPDL 300

Query: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
            AARKVAKFIGS HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 LAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHLADCLRANKSTM+WGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMSWGLEAR 420

Query: 421 VPFLDKEFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQKE 480
           VPFLD+EFLQLCMNIDP EKMI   EGRIEKYILRKAFDT+ EPD KPYLPEEILWRQKE
Sbjct: 421 VPFLDREFLQLCMNIDPAEKMINASEGRIEKYILRKAFDTSDEPDEKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDTAETVISDEMFASPKAEWGSDIPSTKEAFWYRLKFDALFPQKTV 540
           QFSDGVGYSWIDGLKDTAE VISDE+F++PK  WG+DIP+TKEA+WYRLKFDALFPQKT 
Sbjct: 481 QFSDGVGYSWIDGLKDTAERVISDELFSTPKEHWGADIPTTKEAYWYRLKFDALFPQKTA 540

Query: 541 ADTVMRWIPKADWGCAEDPSGRYAQIHEKHI 571
           A+TVMRWIPKADWGCAEDPSGRYA+IHE+HI
Sbjct: 541 AETVMRWIPKADWGCAEDPSGRYAKIHEQHI 571

>CAGL0I10648g Chr9 complement(1053030..1054754) [1725 bp, 574 aa]
           {ON} highly similar to uniprot|P49090 Saccharomyces
           cerevisiae YGR124w asparagine synthetase or
           uniprot|P49089 Saccharomyces cerevisiae YPR145w ASN1
          Length = 574

 Score = 1015 bits (2624), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 480/572 (83%), Positives = 515/572 (90%), Gaps = 1/572 (0%)

Query: 1   MCGIFAAFKHEDVHNYKPKALQLSKRIRHRGPDWSGNAIKNSTIFVHERLAIVGLESGAQ 60
           MCGIFAA+KH+DVH +KPKALQLSKRIRHRGPDWSGN +KNSTI VHERLAIVGL+SGAQ
Sbjct: 1   MCGIFAAYKHQDVHAFKPKALQLSKRIRHRGPDWSGNVVKNSTIMVHERLAIVGLDSGAQ 60

Query: 61  PITSPDEDYMLCVNGEIYNHIQLREECPEYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF 120
           PITS D DY LCVNGEIYNHIQLRE+ P+Y+FKTLSDCEPIIP YL+HDIDAPKYLDGMF
Sbjct: 61  PITSEDGDYTLCVNGEIYNHIQLREQFPDYKFKTLSDCEPIIPAYLEHDIDAPKYLDGMF 120

Query: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180
           AW LYDAKQDRIVAARDP+GITTLYMGR S+SPKTV+FASELKCLTDDCD ITAFPPGHV
Sbjct: 121 AWCLYDAKQDRIVAARDPVGITTLYMGRCSSSPKTVFFASELKCLTDDCDEITAFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSKTD+ITRYFTPDW+DE RIP+TP+++  IR SLEKAVRKRLMAEVPY          
Sbjct: 181 YDSKTDQITRYFTPDWIDESRIPTTPVNFKDIRESLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETANATNDVDPSTYDSKA-RHLAGVDDDGKLHTAGWTSLHSFAIGLPNAPD 299
             IASIAARET  A  + D +  D+ A + LAG+D+ G LHTAGW+ LHSFAIGLPNAPD
Sbjct: 241 SLIASIAARETEKANEENDAADNDASASKQLAGIDNQGHLHTAGWSRLHSFAIGLPNAPD 300

Query: 300 LQAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 359
           LQAARKVAKFIGS HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ
Sbjct: 301 LQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 360

Query: 360 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEA 419
           GVKMVLSGEGSDEIFGGYLYFAQAPSA EFH ESV+RVKNLHLADCLRANKSTMAWGLEA
Sbjct: 361 GVKMVLSGEGSDEIFGGYLYFAQAPSATEFHIESVKRVKNLHLADCLRANKSTMAWGLEA 420

Query: 420 RVPFLDKEFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQK 479
           RVPFLDKEFLQLCMNIDP +KMI    GRIEKYILRKAFDT+ EPD KPYLPEEILWRQK
Sbjct: 421 RVPFLDKEFLQLCMNIDPKDKMIDQSAGRIEKYILRKAFDTSDEPDVKPYLPEEILWRQK 480

Query: 480 EQFSDGVGYSWIDGLKDTAETVISDEMFASPKAEWGSDIPSTKEAFWYRLKFDALFPQKT 539
           EQFSDGVGYSWIDGLKDTAE VISD MF++PK EWG DIP+TKEA+WYRLKFDALFPQKT
Sbjct: 481 EQFSDGVGYSWIDGLKDTAERVISDTMFSNPKIEWGEDIPTTKEAYWYRLKFDALFPQKT 540

Query: 540 VADTVMRWIPKADWGCAEDPSGRYAQIHEKHI 571
            A TVMRWIPKADWGCAEDPSGRYA+IHE+H+
Sbjct: 541 AASTVMRWIPKADWGCAEDPSGRYAKIHEQHV 572

>Suva_7.410 Chr7 (709927..711645) [1719 bp, 572 aa] {ON} YPR145W
           (REAL)
          Length = 572

 Score = 1014 bits (2622), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 478/572 (83%), Positives = 518/572 (90%), Gaps = 1/572 (0%)

Query: 1   MCGIFAAFKHEDVHNYKPKALQLSKRIRHRGPDWSGNAIKNSTIFVHERLAIVGLESGAQ 60
           MCGIFAAFKHED+ ++KPKALQLSKRIRHRGPDWSGNAI NSTIFVHERLAIVGL+SGAQ
Sbjct: 1   MCGIFAAFKHEDIEDFKPKALQLSKRIRHRGPDWSGNAIMNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PITSPDEDYMLCVNGEIYNHIQLREECPEYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF 120
           PITS D DYML VNGEIYNHIQLRE+C +Y+F+T SDCEPIIP+YL+HDIDAPKYLDGMF
Sbjct: 61  PITSSDGDYMLGVNGEIYNHIQLREQCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120

Query: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180
           A+ LYD+K+DR++AARDPIG+ TLYMGR S SPKTVYFASELKCLTD CD+I AFPPGHV
Sbjct: 121 AFCLYDSKKDRVIAARDPIGVVTLYMGRCSKSPKTVYFASELKCLTDVCDSIIAFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TDKITRYFTPDWLDEKR+P+TP+DY AIRHSLEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDKITRYFTPDWLDEKRVPTTPVDYRAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETANATNDVDPSTYDSKARHLAGVDDDGKLHTAGWTSLHSFAIGLPNAPDL 300
             IA+IAARET  A  + +      K++ LAG+DD G LHT+GW+ LHSFA+GLPNAPDL
Sbjct: 241 SLIAAIAARETETANVEANEEASAEKSK-LAGIDDQGHLHTSGWSRLHSFAVGLPNAPDL 299

Query: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           QAARKVAKFIGS HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 300 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 359

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKST+AWGLEAR
Sbjct: 360 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTLAWGLEAR 419

Query: 421 VPFLDKEFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQKE 480
           VPFLDK+FLQLCMNIDP +KMI  KEGRIEKYILRKAFDTT EPD KPYLPEEILWRQKE
Sbjct: 420 VPFLDKDFLQLCMNIDPKDKMINSKEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 479

Query: 481 QFSDGVGYSWIDGLKDTAETVISDEMFASPKAEWGSDIPSTKEAFWYRLKFDALFPQKTV 540
           QFSDGVGYSWID L+DTAE VISD MFA+PKA WG DIP+TKEA+WYRLKFDA FPQKT 
Sbjct: 480 QFSDGVGYSWIDSLRDTAERVISDAMFANPKASWGDDIPTTKEAYWYRLKFDAWFPQKTA 539

Query: 541 ADTVMRWIPKADWGCAEDPSGRYAQIHEKHID 572
           ADTVMRW+PKADWGCAEDPSGRYAQIHEKH++
Sbjct: 540 ADTVMRWVPKADWGCAEDPSGRYAQIHEKHVN 571

>Skud_7.435 Chr7 (719202..720920) [1719 bp, 572 aa] {ON} YGR124W
           (REAL)
          Length = 572

 Score = 1013 bits (2619), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 480/573 (83%), Positives = 522/573 (91%), Gaps = 5/573 (0%)

Query: 1   MCGIFAAFKHEDVHNYKPKALQLSKRIRHRGPDWSGNAIKNSTIFVHERLAIVGLESGAQ 60
           MCGIFAAFKHED++++KPKALQLSKRIRHRGPDWSGNA+ NSTIFVHERLAIVGL+SGAQ
Sbjct: 1   MCGIFAAFKHEDINSFKPKALQLSKRIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PITSPDEDYMLCVNGEIYNHIQLREECPEYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF 120
           PI S D +YML VNGEIYNHIQLRE+C  Y+F+T SDCEPIIP+YL+HDIDAPK+LDGMF
Sbjct: 61  PIASADGEYMLGVNGEIYNHIQLREKCSGYKFQTFSDCEPIIPLYLEHDIDAPKHLDGMF 120

Query: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180
           A+ LYDAK+DR+VAARDPIG+ TLYMGRSS SPKTVYFASELKCLTD CD+I +FPPGHV
Sbjct: 121 AFCLYDAKKDRVVAARDPIGVVTLYMGRSSKSPKTVYFASELKCLTDVCDSIISFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TDKITRYFTP+WLDEKRIPS P+DY AIRHSLEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDKITRYFTPNWLDEKRIPSVPVDYHAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARET--ANATNDVDPSTYDSKARHLAGVDDDGKLHTAGWTSLHSFAIGLPNAP 298
             IA+IAARET  ANA  D D S  +   + LAG+DD G LHT+GW+ LHSFA+GLPNAP
Sbjct: 241 SLIAAIAARETEKANADADGDASVNN---KQLAGIDDQGHLHTSGWSRLHSFAVGLPNAP 297

Query: 299 DLQAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKA 358
           DLQAARKVAKFIGS HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKA
Sbjct: 298 DLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKA 357

Query: 359 QGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLE 418
           QGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLE
Sbjct: 358 QGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLE 417

Query: 419 ARVPFLDKEFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQ 478
           ARVPFLD++FLQLCMNIDP +KMI PKEGRIEKYILRKAFDTT EP+ KPYLPEEILWRQ
Sbjct: 418 ARVPFLDRDFLQLCMNIDPKDKMINPKEGRIEKYILRKAFDTTDEPEVKPYLPEEILWRQ 477

Query: 479 KEQFSDGVGYSWIDGLKDTAETVISDEMFASPKAEWGSDIPSTKEAFWYRLKFDALFPQK 538
           KEQFSDGVGYSWIDGL+DTAE VISD MFA+PKA+WG+DIP+TKEA+WYRLKFDA FPQK
Sbjct: 478 KEQFSDGVGYSWIDGLRDTAERVISDTMFANPKADWGNDIPTTKEAYWYRLKFDAWFPQK 537

Query: 539 TVADTVMRWIPKADWGCAEDPSGRYAQIHEKHI 571
           T ADTVMRW+PKADWGCAEDPSGRYA+IHEKH+
Sbjct: 538 TAADTVMRWVPKADWGCAEDPSGRYAKIHEKHV 570

>TDEL0D05520 Chr4 (996468..998189) [1722 bp, 573 aa] {ON} Anc_3.483
           YPR145W
          Length = 573

 Score = 1005 bits (2599), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 470/571 (82%), Positives = 514/571 (90%)

Query: 1   MCGIFAAFKHEDVHNYKPKALQLSKRIRHRGPDWSGNAIKNSTIFVHERLAIVGLESGAQ 60
           MCGIFAA KHEDV  YK KALQLSKRIRHRGPDWSGN ++N+T+ VHERLAIVGL+SGAQ
Sbjct: 1   MCGIFAAHKHEDVQAYKQKALQLSKRIRHRGPDWSGNVLRNNTLLVHERLAIVGLDSGAQ 60

Query: 61  PITSPDEDYMLCVNGEIYNHIQLREECPEYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF 120
           PITSP  +Y LCVNGEIYNHI+LREE  +Y+F TLSDCEPIIP+Y K+DID PKYLDGMF
Sbjct: 61  PITSPCGNYTLCVNGEIYNHIKLREEFSDYKFSTLSDCEPIIPLYEKYDIDTPKYLDGMF 120

Query: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180
           AW LYDAKQDRI+AARDP+GITTLYMGR+S SPKTV+FASELKCLTDDCD I AFPPGH+
Sbjct: 121 AWCLYDAKQDRIIAARDPVGITTLYMGRNSLSPKTVFFASELKCLTDDCDNIVAFPPGHI 180

Query: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSKTDKITRYFTPDWLDE RIPS P+DY AIRHSLEKAVRKRLMAEVPY          
Sbjct: 181 YDSKTDKITRYFTPDWLDETRIPSNPVDYKAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETANATNDVDPSTYDSKARHLAGVDDDGKLHTAGWTSLHSFAIGLPNAPDL 300
             IASIAARET  A  ++D   YDS+ +HLAG+DD G LH+AGW+ LHSFAIGLP APDL
Sbjct: 241 SLIASIAARETEKANAEIDAQKYDSEDKHLAGIDDSGNLHSAGWSRLHSFAIGLPGAPDL 300

Query: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           +AA KVAKFIGS HHEHTFTLQEGLDALDDVI+HLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 KAASKVAKFIGSIHHEHTFTLQEGLDALDDVIWHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAP+A EFHTE+V+RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPNANEFHTEAVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDKEFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQKE 480
           VPFLD+EFLQLCMNIDP +KMI  +EGR+EKYILRKAFDTT EPD KPYLPEEILWRQKE
Sbjct: 421 VPFLDREFLQLCMNIDPKDKMINKEEGRMEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDTAETVISDEMFASPKAEWGSDIPSTKEAFWYRLKFDALFPQKTV 540
           QFSDGVGYSWIDGLKDTAE VISD++FA+PK+ WG D+P+TKEAFWYRLKFDALFPQKT 
Sbjct: 481 QFSDGVGYSWIDGLKDTAERVISDDIFAAPKSAWGDDVPTTKEAFWYRLKFDALFPQKTA 540

Query: 541 ADTVMRWIPKADWGCAEDPSGRYAQIHEKHI 571
           ADTVMRW+PKADWGCAEDPSGR+AQIH++H+
Sbjct: 541 ADTVMRWVPKADWGCAEDPSGRFAQIHDQHV 571

>NCAS0F03510 Chr6 (703369..705096) [1728 bp, 575 aa] {ON} Anc_3.483
           YGR124W
          Length = 575

 Score = 1005 bits (2598), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 475/573 (82%), Positives = 513/573 (89%), Gaps = 1/573 (0%)

Query: 1   MCGIFAAFKHEDVHNYKPKALQLSKRIRHRGPDWSGNAIKNSTIFVHERLAIVGLESGAQ 60
           MCGIFAAF+HEDV  YKPKALQL+KRIRHRGPDWSGN +KN+TI  HERL+IVGL+SGAQ
Sbjct: 1   MCGIFAAFRHEDVKAYKPKALQLTKRIRHRGPDWSGNVVKNTTILAHERLSIVGLDSGAQ 60

Query: 61  PITSPDEDYMLCVNGEIYNHIQLREECPEYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF 120
           PITSP  +Y LCVNGEIYNHIQ+REEC +YQFKTLSDCEPIIP+YLK+D+DAPK+LDGMF
Sbjct: 61  PITSPCGNYTLCVNGEIYNHIQIREECADYQFKTLSDCEPIIPLYLKYDLDAPKHLDGMF 120

Query: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180
           AW LYDAKQDRIVAARDPIGITTLYMGR S +P+TVYFASELKCLTDDCD+I AFPPGHV
Sbjct: 121 AWCLYDAKQDRIVAARDPIGITTLYMGRQSKTPQTVYFASELKCLTDDCDSIVAFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TD+ITRYF PDWLDE RIPSTP+D  AIR +LEKAVRKRLMAEVPY          
Sbjct: 181 YDSNTDQITRYFNPDWLDEDRIPSTPVDLKAIRETLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETANATNDVDPSTYDSKA-RHLAGVDDDGKLHTAGWTSLHSFAIGLPNAPD 299
             IASIAARET  A  DVD    + +  +HL GVDD+G LHT GW+ LHSFAIGLPNAPD
Sbjct: 241 SLIASIAARETEKAMQDVDVEDENGEHHKHLTGVDDEGHLHTGGWSRLHSFAIGLPNAPD 300

Query: 300 LQAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 359
           LQAARKVAKFIGS HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ
Sbjct: 301 LQAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 360

Query: 360 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEA 419
           GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHLADCLRANKSTMAWGLEA
Sbjct: 361 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEA 420

Query: 420 RVPFLDKEFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQK 479
           RVPFLDKEFLQLCMNIDP +KMI    G+IEKYILRKAFDTT +P+ KPYLP+EILWRQK
Sbjct: 421 RVPFLDKEFLQLCMNIDPKDKMIDQASGKIEKYILRKAFDTTDDPEEKPYLPQEILWRQK 480

Query: 480 EQFSDGVGYSWIDGLKDTAETVISDEMFASPKAEWGSDIPSTKEAFWYRLKFDALFPQKT 539
           EQFSDGVGYSWIDGLKDTAE VISD MF +PK  WG+D+P+TKEA+WYRLKFDAL+PQKT
Sbjct: 481 EQFSDGVGYSWIDGLKDTAERVISDAMFENPKPHWGNDVPTTKEAYWYRLKFDALYPQKT 540

Query: 540 VADTVMRWIPKADWGCAEDPSGRYAQIHEKHID 572
            ADTVMRWIPKADWGCAEDPSGRYA+IHEKH+D
Sbjct: 541 AADTVMRWIPKADWGCAEDPSGRYAKIHEKHVD 573

>KLLA0B10868g Chr2 complement(951111..952835) [1725 bp, 574 aa] {ON}
           highly similar to uniprot|P49089 Saccharomyces
           cerevisiae YPR145W ASN1 Asparagine synthetase isozyme of
           Asn2p catalyzes the synthesis of L-asparagine from L-
           aspartate in the asparagine biosynthetic pathway
          Length = 574

 Score = 1004 bits (2597), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 473/572 (82%), Positives = 511/572 (89%)

Query: 1   MCGIFAAFKHEDVHNYKPKALQLSKRIRHRGPDWSGNAIKNSTIFVHERLAIVGLESGAQ 60
           MCGIFA+F++ DV  YKPKALQLSKRIRHRGPDWSGN +KNSTI VHERLAIVGL+SGAQ
Sbjct: 1   MCGIFASFRNPDVQAYKPKALQLSKRIRHRGPDWSGNIVKNSTILVHERLAIVGLDSGAQ 60

Query: 61  PITSPDEDYMLCVNGEIYNHIQLREECPEYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF 120
           PITS D  Y L VNGEIYNHI LREEC  Y FKTLSDCEPIIP+Y K+DIDAPK+LDGMF
Sbjct: 61  PITSEDGSYTLAVNGEIYNHIMLREECASYPFKTLSDCEPIIPLYEKYDIDAPKHLDGMF 120

Query: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180
           AW LYD+K+DRI+AARDPIGITTLYMGRSSASPK+V+F+SELKCLTDDCD I AFPPGHV
Sbjct: 121 AWCLYDSKKDRIIAARDPIGITTLYMGRSSASPKSVWFSSELKCLTDDCDEIIAFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TDK+TRYFTPDWLDE RIP+TP+D+ A+R SLEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDKLTRYFTPDWLDESRIPTTPVDFKAVRESLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETANATNDVDPSTYDSKARHLAGVDDDGKLHTAGWTSLHSFAIGLPNAPDL 300
             IA+IAARET     ++DP  YDS    LAG+D+ G LH AGW+ LHSFA+GLPNAPDL
Sbjct: 241 SLIAAIAARETEKTNAELDPVVYDSDPHQLAGLDEQGHLHAAGWSRLHSFAVGLPNAPDL 300

Query: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           QAARKVA FIGS HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVATFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFH ESV+RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDKEFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQKE 480
           VPFLD++FLQLCMNIDPN+KMIKP EG+IEKYILRKAFDTT EPD KPYLPEEILWRQKE
Sbjct: 421 VPFLDRDFLQLCMNIDPNDKMIKPAEGKIEKYILRKAFDTTDEPDLKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDTAETVISDEMFASPKAEWGSDIPSTKEAFWYRLKFDALFPQKTV 540
           QFSDGVGYSWIDGLKD AE+ ISDE FA PKAEWG DIP+TKEA+WYRLKFDALFPQKT 
Sbjct: 481 QFSDGVGYSWIDGLKDAAESTISDEQFAQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540

Query: 541 ADTVMRWIPKADWGCAEDPSGRYAQIHEKHID 572
           A TVMRWIPKADWGCAEDPSGRYA+IHE+H+D
Sbjct: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHVD 572

>KNAG0A07920 Chr1 (1262894..1264630) [1737 bp, 578 aa] {ON}
           Anc_3.483 YPR145W
          Length = 578

 Score = 1004 bits (2597), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 476/576 (82%), Positives = 516/576 (89%), Gaps = 4/576 (0%)

Query: 1   MCGIFAAFKHEDVHNYKPKALQLSKRIRHRGPDWSGNAIKNSTIFVHERLAIVGLESGAQ 60
           MCGIFA F+HEDV  +KP+ALQLSKRIRHRGPDWSGN IKNSTI  HERLAIVGL+SGAQ
Sbjct: 1   MCGIFATFRHEDVQAFKPRALQLSKRIRHRGPDWSGNIIKNSTIMAHERLAIVGLDSGAQ 60

Query: 61  PITSPDEDYMLCVNGEIYNHIQLREECPEYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF 120
           PITSP  DY+L VNGEIYNHIQLREECPEYQ+K+LSDCEPIIPMYLK+D+DAPK+LDGMF
Sbjct: 61  PITSPCGDYILSVNGEIYNHIQLREECPEYQYKSLSDCEPIIPMYLKYDLDAPKHLDGMF 120

Query: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180
           AW LYDAK+DRIVAARDPIGITTLYMGRSS  PKTV+FASELKCLTDDCD I AFPPGHV
Sbjct: 121 AWCLYDAKKDRIVAARDPIGITTLYMGRSSMCPKTVFFASELKCLTDDCDNIIAFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TDKITRY+TP+WLDE +IPSTP+D   IRH+LEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDKITRYYTPNWLDETKIPSTPVDLKQIRHTLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETANATNDVDPSTYD----SKARHLAGVDDDGKLHTAGWTSLHSFAIGLPN 296
             IA+IAARET  A  ++DP  YD    ++  HLAG+DD+G L +A W+ LHSFAIGLP 
Sbjct: 241 SLIAAIAARETEKANKELDPRKYDEQEEAEGHHLAGIDDEGNLLSATWSRLHSFAIGLPG 300

Query: 297 APDLQAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 356
           APDL AARKVAKFIGS HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI
Sbjct: 301 APDLVAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 360

Query: 357 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWG 416
           KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHL+DCLRANKSTMAWG
Sbjct: 361 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLSDCLRANKSTMAWG 420

Query: 417 LEARVPFLDKEFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTGEPDAKPYLPEEILW 476
           LEARVPFLDKEFL LCMNIDP +K+I  KEGRIEKYILRKAFDT  EPD KPYLPEEILW
Sbjct: 421 LEARVPFLDKEFLDLCMNIDPKDKLINQKEGRIEKYILRKAFDTCDEPDVKPYLPEEILW 480

Query: 477 RQKEQFSDGVGYSWIDGLKDTAETVISDEMFASPKAEWGSDIPSTKEAFWYRLKFDALFP 536
           RQKEQFSDGVGYSWIDGLKDTAETVISDEMFA+PKA WG D+P+TKEAFWYRLKFDALFP
Sbjct: 481 RQKEQFSDGVGYSWIDGLKDTAETVISDEMFAAPKAHWGIDVPTTKEAFWYRLKFDALFP 540

Query: 537 QKTVADTVMRWIPKADWGCAEDPSGRYAQIHEKHID 572
           Q T A+TVMRWIPKADWGCAEDPSGR+A+IHE+H++
Sbjct: 541 QPTAAETVMRWIPKADWGCAEDPSGRFAKIHEQHVE 576

>KAFR0G03670 Chr7 (758115..759833) [1719 bp, 572 aa] {ON} Anc_3.483
           YPR145W
          Length = 572

 Score = 1004 bits (2596), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/571 (82%), Positives = 516/571 (90%)

Query: 1   MCGIFAAFKHEDVHNYKPKALQLSKRIRHRGPDWSGNAIKNSTIFVHERLAIVGLESGAQ 60
           MCGIFAAF+HEDV ++K KALQLSKRIRHRGPDWSGN +KNSTI VHERLAIVGL+SGAQ
Sbjct: 1   MCGIFAAFRHEDVTSFKSKALQLSKRIRHRGPDWSGNVVKNSTIMVHERLAIVGLDSGAQ 60

Query: 61  PITSPDEDYMLCVNGEIYNHIQLREECPEYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF 120
           PITSP  +Y LCVNGEIYNHIQLRE+ P+Y+FKTLSDCEPIIP+YL+ DIDAPK LDGMF
Sbjct: 61  PITSPCGNYTLCVNGEIYNHIQLREQFPDYKFKTLSDCEPIIPLYLRDDIDAPKSLDGMF 120

Query: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180
           AWTLYD+K+DRI+AARDPIG+TTLYMGRSS SPKTV+FASELKCL DDCD+I AFPPGH+
Sbjct: 121 AWTLYDSKKDRILAARDPIGVTTLYMGRSSMSPKTVFFASELKCLVDDCDSIVAFPPGHI 180

Query: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TDKITRYFTP+W+DE +IP+TP+DY AIRHSLEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDKITRYFTPNWIDENKIPTTPVDYTAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETANATNDVDPSTYDSKARHLAGVDDDGKLHTAGWTSLHSFAIGLPNAPDL 300
             IASIAARET  A  ++D S Y  +  HLAG+DD+G L T+GW+ LHSFAIGLP APDL
Sbjct: 241 SLIASIAARETEAANRELDASQYAEEGSHLAGIDDEGHLRTSGWSRLHSFAIGLPGAPDL 300

Query: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
            AA+KVAKFIGS HHEHTFTLQEG+DALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 IAAKKVAKFIGSIHHEHTFTLQEGIDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDKEFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQKE 480
           VPFLD+EFL LCMNIDPN+K+I  KEGRIEKYILRKAFDT  +P AKPYLP+EILWRQKE
Sbjct: 421 VPFLDREFLDLCMNIDPNDKLINQKEGRIEKYILRKAFDTKDDPSAKPYLPDEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDTAETVISDEMFASPKAEWGSDIPSTKEAFWYRLKFDALFPQKTV 540
           QFSDGVGYSWID LKDTAE VISDEMFA+PK+ WG DIP+TKEA+WYRLKFDALFPQ T 
Sbjct: 481 QFSDGVGYSWIDCLKDTAEKVISDEMFANPKSHWGKDIPTTKEAYWYRLKFDALFPQPTA 540

Query: 541 ADTVMRWIPKADWGCAEDPSGRYAQIHEKHI 571
           A+TVMRWIPKADWGCAEDPSGRYAQIHEKHI
Sbjct: 541 AETVMRWIPKADWGCAEDPSGRYAQIHEKHI 571

>SAKL0F02970g Chr6 complement(252336..254057) [1722 bp, 573 aa] {ON}
           highly similar to uniprot|P49089 Saccharomyces
           cerevisiae YPR145W ASN1 Asparagine synthetase isozyme of
           Asn2p catalyzes the synthesis of L-asparagine from L-
           aspartate in the asparagine biosynthetic pathway
          Length = 573

 Score = 1003 bits (2592), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 474/571 (83%), Positives = 503/571 (88%)

Query: 1   MCGIFAAFKHEDVHNYKPKALQLSKRIRHRGPDWSGNAIKNSTIFVHERLAIVGLESGAQ 60
           MCGIFA +KHE V  +KPKALQLSKRIRHRGPDWSGN +KN+TI  HERLAIVGL+SGAQ
Sbjct: 1   MCGIFACYKHESVQEFKPKALQLSKRIRHRGPDWSGNVVKNTTILAHERLAIVGLDSGAQ 60

Query: 61  PITSPDEDYMLCVNGEIYNHIQLREECPEYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF 120
           PITS D DY LCVNGEIYNHI+LREE   Y FKTLSDCEPIIP+Y K+DID PKYLDGMF
Sbjct: 61  PITSEDGDYTLCVNGEIYNHIKLREELTSYPFKTLSDCEPIIPLYQKYDIDTPKYLDGMF 120

Query: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180
           AW LYDAK+DRI+AARDPIGITTLYMGRSS+SP TV+FASELKCL DDCD ITAFPPGHV
Sbjct: 121 AWCLYDAKKDRIIAARDPIGITTLYMGRSSSSPSTVFFASELKCLVDDCDEITAFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TDKITRY+TPDWLDE+RIP TP+DY  IR+SLE AVRKRLMAEVPY          
Sbjct: 181 YDSATDKITRYYTPDWLDEERIPKTPLDYKLIRNSLESAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETANATNDVDPSTYDSKARHLAGVDDDGKLHTAGWTSLHSFAIGLPNAPDL 300
             IA+IAARET  A  D+DP  YD + +HLAGVDD G LH AGW+ LHSFAIGLPNAPDL
Sbjct: 241 SLIAAIAARETEKANKDLDPVAYDDEDKHLAGVDDKGNLHAAGWSRLHSFAIGLPNAPDL 300

Query: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           QAARKVAKFI S HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFISSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFH ESV+RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDKEFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQKE 480
           VPFLD++FL +CMNIDP EKMI   EGRIEKYILRKAFDTT EPD KPYLPEEILWRQKE
Sbjct: 421 VPFLDRDFLDVCMNIDPAEKMINQSEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDTAETVISDEMFASPKAEWGSDIPSTKEAFWYRLKFDALFPQKTV 540
           QFSDGVGYSWIDGLKD AE  ISDE FA PK EWG DIP+TKEA+WYRLKFDALFPQKT 
Sbjct: 481 QFSDGVGYSWIDGLKDAAEAAISDEQFAQPKPEWGDDIPTTKEAYWYRLKFDALFPQKTA 540

Query: 541 ADTVMRWIPKADWGCAEDPSGRYAQIHEKHI 571
           A TVMRWIPKADWGCAEDPSGRYA+IHE+HI
Sbjct: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHI 571

>NDAI0B05810 Chr2 (1412089..1413822) [1734 bp, 577 aa] {ON}
           Anc_3.483 YGR124W
          Length = 577

 Score =  998 bits (2579), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/576 (81%), Positives = 513/576 (89%), Gaps = 4/576 (0%)

Query: 1   MCGIFAAFKHEDVHNYKPKALQLSKRIRHRGPDWSGNAIKNSTIFVHERLAIVGLESGAQ 60
           MCGIFAAFKHEDVH +KP+ALQLSKRIRHRGPDWSGN IKN+TI  HERLAIVGL+SGAQ
Sbjct: 1   MCGIFAAFKHEDVHAFKPRALQLSKRIRHRGPDWSGNVIKNTTILAHERLAIVGLDSGAQ 60

Query: 61  PITSPDEDYMLCVNGEIYNHIQLREECPEYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF 120
           PITSP  +Y LCVNGEIYNHIQ+RE+ P+Y FKTLSDCEPIIP+YLKHDID PK+LDGMF
Sbjct: 61  PITSPCGNYTLCVNGEIYNHIQIREQFPDYPFKTLSDCEPIIPLYLKHDIDTPKHLDGMF 120

Query: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180
           AW LYD+KQDRI+AARDPIGITTLYMGR+S +P+TV+FASELKCLTDDCD+I AFPPGHV
Sbjct: 121 AWCLYDSKQDRIIAARDPIGITTLYMGRNSKTPQTVFFASELKCLTDDCDSIIAFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSKTD+ITRYFTPDWLDE+RIP   +D  AIR SLE AVRKRLMAEVP+          
Sbjct: 181 YDSKTDQITRYFTPDWLDEQRIPENKLDLTAIRESLESAVRKRLMAEVPFGVLLSGGLDS 240

Query: 241 XXIASIAARET----ANATNDVDPSTYDSKARHLAGVDDDGKLHTAGWTSLHSFAIGLPN 296
             IASIAARET    A AT D + +  ++   HL GVDD+G LH  GW+ LHSFAIGLPN
Sbjct: 241 SLIASIAARETEKANAQATLDNENANDETSKAHLTGVDDEGHLHNGGWSKLHSFAIGLPN 300

Query: 297 APDLQAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 356
           APDLQAARKVAKFIGS HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI
Sbjct: 301 APDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 360

Query: 357 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWG 416
           KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RV NLHLADCLRANKSTMAWG
Sbjct: 361 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVNNLHLADCLRANKSTMAWG 420

Query: 417 LEARVPFLDKEFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTGEPDAKPYLPEEILW 476
           LEARVPFLD++FLQLCMNIDP EKMI   EGRIEKYILRKAFDT+ +P+AKPYLPEEILW
Sbjct: 421 LEARVPFLDRDFLQLCMNIDPKEKMINQAEGRIEKYILRKAFDTSDDPEAKPYLPEEILW 480

Query: 477 RQKEQFSDGVGYSWIDGLKDTAETVISDEMFASPKAEWGSDIPSTKEAFWYRLKFDALFP 536
           RQKEQFSDGVGYSWIDGLKDTAE VISD MF +PK  WG+DIP+TKEA+WYRLKFDAL+P
Sbjct: 481 RQKEQFSDGVGYSWIDGLKDTAERVISDAMFENPKDHWGTDIPTTKEAYWYRLKFDALYP 540

Query: 537 QKTVADTVMRWIPKADWGCAEDPSGRYAQIHEKHID 572
           QKT ADTVMRWIPKADWGCAEDPSGRYA+IHEKH++
Sbjct: 541 QKTAADTVMRWIPKADWGCAEDPSGRYAKIHEKHVN 576

>Kwal_55.21187 s55 (723404..725125) [1722 bp, 573 aa] {ON} YPR145W
           (ASN1) - asparagine synthetase [contig 295] FULL
          Length = 573

 Score =  993 bits (2568), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 465/571 (81%), Positives = 509/571 (89%)

Query: 1   MCGIFAAFKHEDVHNYKPKALQLSKRIRHRGPDWSGNAIKNSTIFVHERLAIVGLESGAQ 60
           MCGIF  F+HEDV  +KP ALQL+KRIRHRGPDWSGN I+NST+  HERLAIVGL++GAQ
Sbjct: 1   MCGIFTCFRHEDVDKFKPDALQLAKRIRHRGPDWSGNVIRNSTLLAHERLAIVGLDTGAQ 60

Query: 61  PITSPDEDYMLCVNGEIYNHIQLREECPEYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF 120
           P+ S ++DY+L VNGEIYNHIQLREE  +Y FKTLSDCEPIIP+Y K+ IDAPKYLDGMF
Sbjct: 61  PMVSEEKDYILAVNGEIYNHIQLREEFSDYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF 120

Query: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180
           AW LYD K+DR++AARDPIGITTLYMGR S SPKTVYFASELKCLTD+CD+I AFPPGHV
Sbjct: 121 AWALYDTKKDRMIAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TD+ITRY+TP+WLDE RIPS P+D L IR+SLEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDQITRYYTPNWLDENRIPSEPLDLLKIRNSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETANATNDVDPSTYDSKARHLAGVDDDGKLHTAGWTSLHSFAIGLPNAPDL 300
             IA+IAARET  A  +++P  YDS+ +HLAGVDD GKLH+AGW+ LHSFA+GLPNAPDL
Sbjct: 241 SLIAAIAARETEKANTEMNPVEYDSEDKHLAGVDDSGKLHSAGWSRLHSFAVGLPNAPDL 300

Query: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           +AARKVAKFIGS HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 EAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDKEFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQKE 480
           VPFLD+EFL LCMN+DP EKMI   EGRIEKYILRKAFDT+ EP AKPYLPEEILWRQKE
Sbjct: 421 VPFLDREFLDLCMNLDPKEKMINQAEGRIEKYILRKAFDTSDEPGAKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDTAETVISDEMFASPKAEWGSDIPSTKEAFWYRLKFDALFPQKTV 540
           QFSDGVGYSWIDGLKDTAE  ISDE F  PKAEWG DIP+TKEA+WYRLKFDALFPQKT 
Sbjct: 481 QFSDGVGYSWIDGLKDTAEATISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540

Query: 541 ADTVMRWIPKADWGCAEDPSGRYAQIHEKHI 571
           A TVMRWIPKADWGCAEDPSGRYA+IH++HI
Sbjct: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHDQHI 571

>KLTH0F14630g Chr6 (1198036..1199757) [1722 bp, 573 aa] {ON} highly
           similar to uniprot|P49089 Saccharomyces cerevisiae
           YPR145W ASN1 Asparagine synthetase isozyme of Asn2p
           catalyzes the synthesis of L-asparagine from L-
           aspartate in the asparagine biosynthetic pathway
          Length = 573

 Score =  993 bits (2566), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 470/572 (82%), Positives = 502/572 (87%)

Query: 1   MCGIFAAFKHEDVHNYKPKALQLSKRIRHRGPDWSGNAIKNSTIFVHERLAIVGLESGAQ 60
           MCGIF  F+H+ V  +KP AL+L KRIRHRGPDWSGN IKNST+  HERLAIVGL+SGAQ
Sbjct: 1   MCGIFTCFRHQSVEEFKPDALRLVKRIRHRGPDWSGNIIKNSTLMAHERLAIVGLDSGAQ 60

Query: 61  PITSPDEDYMLCVNGEIYNHIQLREECPEYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF 120
           P  S D +Y+L VNGE+YNHIQLREE   Y FKTLSDCEPIIP+Y K+ IDAPKYLDGMF
Sbjct: 61  PFVSEDNNYILGVNGEVYNHIQLREEFSSYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF 120

Query: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180
           AW LYDAK+DRIVAARDPIGITTLYMGR S SPKTVYFASELKCLTD+CD+I AFPPGHV
Sbjct: 121 AWALYDAKKDRIVAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TD+ITRYF PDW+DE RIPS P+D L IRHSLEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDQITRYFNPDWIDEDRIPSEPLDLLKIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETANATNDVDPSTYDSKARHLAGVDDDGKLHTAGWTSLHSFAIGLPNAPDL 300
             IASIAARET  A + +DP  YDS+ +HLAGVDD G L +AGW+ LHSFAIGLPNAPDL
Sbjct: 241 SLIASIAARETEKANSQMDPVKYDSEDKHLAGVDDAGNLRSAGWSHLHSFAIGLPNAPDL 300

Query: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           QAARKVAKFIGS HHEHTFTLQEGLDAL DVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFIGSIHHEHTFTLQEGLDALSDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDKEFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQKE 480
           VPFLD+EFLQLCMN+DP EKMI   EGRIEKYILRKAFDT+ EP AKPYLPEEILWRQKE
Sbjct: 421 VPFLDREFLQLCMNLDPKEKMINAAEGRIEKYILRKAFDTSDEPGAKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDTAETVISDEMFASPKAEWGSDIPSTKEAFWYRLKFDALFPQKTV 540
           QFSDGVGYSWIDGLKD AE  ISDE F  PKAEWG DIP+TKEA+WYRLKFDALFPQKT 
Sbjct: 481 QFSDGVGYSWIDGLKDAAEAAISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540

Query: 541 ADTVMRWIPKADWGCAEDPSGRYAQIHEKHID 572
           A TVMRWIPKADWGCAEDPSGRYA+IHE+HID
Sbjct: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHID 572

>TPHA0D04200 Chr4 (904705..906429) [1725 bp, 574 aa] {ON} Anc_3.483
           YPR145W
          Length = 574

 Score =  979 bits (2531), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/571 (80%), Positives = 504/571 (88%)

Query: 1   MCGIFAAFKHEDVHNYKPKALQLSKRIRHRGPDWSGNAIKNSTIFVHERLAIVGLESGAQ 60
           MCGIF  +KHE+   +KP+ALQLSKRIRHRGPDWSGN +KNSTI  HERLAIVGL+SGAQ
Sbjct: 1   MCGIFTVYKHENAEAFKPRALQLSKRIRHRGPDWSGNVVKNSTIMAHERLAIVGLDSGAQ 60

Query: 61  PITSPDEDYMLCVNGEIYNHIQLREECPEYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF 120
           PITS D D++LCVNGEIYNHIQ+RE+ P+YQFKTLSDCEPIIP+Y+K+  +APK+LDGMF
Sbjct: 61  PITSQDGDHILCVNGEIYNHIQIREQFPDYQFKTLSDCEPIIPLYMKYGAEAPKHLDGMF 120

Query: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180
           AWTLYDAKQDRI+AARDPIGITTLYMGRSS SPKTVYFASELKCLTDDCD+I AFPPGHV
Sbjct: 121 AWTLYDAKQDRIIAARDPIGITTLYMGRSSKSPKTVYFASELKCLTDDCDSIVAFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TD+ITRY+TPDW+DE RI + P+D + IRHSLEKAVRKRLMAEVPY          
Sbjct: 181 YDSVTDQITRYYTPDWIDENRIANQPLDLMKIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETANATNDVDPSTYDSKARHLAGVDDDGKLHTAGWTSLHSFAIGLPNAPDL 300
             IASIAARET  A       +  S    L G+DD+G L ++GW+ LHSFAIGLP APDL
Sbjct: 241 SLIASIAARETEKAMKTASSDSLSSSVNQLTGIDDNGNLRSSGWSRLHSFAIGLPGAPDL 300

Query: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
            AA+KVAKFIGS HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 IAAKKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHL+DCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLSDCLRANKSTMAWGLEAR 420

Query: 421 VPFLDKEFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQKE 480
           VPFLD+EFL LCMNIDP+EKMI  KEGRIEKYILRKAFDTT EP+ KPYLP+EILWRQKE
Sbjct: 421 VPFLDREFLDLCMNIDPSEKMINQKEGRIEKYILRKAFDTTDEPNEKPYLPDEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDTAETVISDEMFASPKAEWGSDIPSTKEAFWYRLKFDALFPQKTV 540
           QFSDGVGYSWIDGLKDTAE VISDE+F +P+  WGSDIP+TKEA+WYRLKFDALFPQ T 
Sbjct: 481 QFSDGVGYSWIDGLKDTAERVISDELFENPREHWGSDIPTTKEAYWYRLKFDALFPQPTA 540

Query: 541 ADTVMRWIPKADWGCAEDPSGRYAQIHEKHI 571
           A TVMRWIPKADWGCAEDPSGRYA+IHE+HI
Sbjct: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHI 571

>ZYRO0B04136g Chr2 complement(345085..346803) [1719 bp, 572 aa] {ON}
           highly similar to uniprot|P49089 Saccharomyces
           cerevisiae YPR145W ASN1 Asparagine synthetase isozyme of
           Asn2p catalyzes the synthesis of L-asparagine from L-
           aspartate in the asparagine biosynthetic pathway
          Length = 572

 Score =  965 bits (2495), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 454/572 (79%), Positives = 496/572 (86%), Gaps = 1/572 (0%)

Query: 1   MCGIFAAFKHEDVHNYKPKALQLSKRIRHRGPDWSGNAIKNSTIFVHERLAIVGLESGAQ 60
           MCGIFAAF+H DV  Y+P ALQLSKRIRHRGPDWSGN +KNSTI VHERLAIVGLESG+Q
Sbjct: 1   MCGIFAAFRHTDVQEYRPHALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLESGSQ 60

Query: 61  PITSPDEDYMLCVNGEIYNHIQLREECPEYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF 120
           PI SP  +Y LCVNGEIYNHIQLREEC +Y F++LSDCEPIIP+YLK+ +DAPK LDGMF
Sbjct: 61  PIKSPCGNYTLCVNGEIYNHIQLREECSDYPFQSLSDCEPIIPLYLKYGLDAPKKLDGMF 120

Query: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180
           AW LYD+K+DRIVAARDPIGITTLYMG+SS SPKT +FASELKCL DDCD I AFPPGHV
Sbjct: 121 AWCLYDSKEDRIVAARDPIGITTLYMGKSSKSPKTRFFASELKCLIDDCDEIVAFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSK+D+ITRYF P WLDE  +PSTP+DY  +RHSLEK+VRKRLMAEVPY          
Sbjct: 181 YDSKSDQITRYFNPQWLDESYMPSTPLDYKVLRHSLEKSVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETANATNDVDPSTYDSKARHLAGVDDDGKLHTAGWTSLHSFAIGLPNAPDL 300
             IASIAARET  A  ++DP  YDS+ +HLAG+D  G LHT GW+ LHSFAIGLP APDL
Sbjct: 241 SLIASIAARETERANEELDPVNYDSEEKHLAGIDAQGNLHTGGWSRLHSFAIGLPGAPDL 300

Query: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
            AARKVAKFIGS HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 LAARKVAKFIGSLHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSA EF  E   RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAKEFQAECASRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDKEFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQKE 480
           VPFLD++FL LCM +DPNEKMIKP+EGRIEKYILRKAFDTT EP+ KPYLPE+ILWRQKE
Sbjct: 421 VPFLDRDFLNLCMELDPNEKMIKPEEGRIEKYILRKAFDTTDEPNVKPYLPEDILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDTAETVISDEMFASPKAEWGSDIPSTKEAFWYRLKFDALFPQKTV 540
           QFSDGVGYSWIDGLKD AE  ISDEM A+P+ EWG D P+TKEA+WYRLKFD  FP K+ 
Sbjct: 481 QFSDGVGYSWIDGLKDAAEEAISDEMLATPRPEWGDDQPTTKEAYWYRLKFDKFFP-KSA 539

Query: 541 ADTVMRWIPKADWGCAEDPSGRYAQIHEKHID 572
           A+TVMRWIPKADWGC  DPSGR+A+IHE+HID
Sbjct: 540 ANTVMRWIPKADWGCHGDPSGRFAKIHEQHID 571

>TBLA0C04430 Chr3 (1072027..1073769) [1743 bp, 580 aa] {ON}
           Anc_3.483 YPR145W
          Length = 580

 Score =  962 bits (2486), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/579 (77%), Positives = 506/579 (87%), Gaps = 7/579 (1%)

Query: 1   MCGIFAAFKHEDVHNYKPKALQLSKRIRHRGPDWSGNAIKNSTIFVHERLAIVGLESGAQ 60
           MCGIFAA+KH +V+ +KP+ALQL+KRIRHRGPDWSGN +KN+T+F HERLAIVGL+SGAQ
Sbjct: 1   MCGIFAAYKHPEVNAFKPRALQLTKRIRHRGPDWSGNVVKNTTLFAHERLAIVGLDSGAQ 60

Query: 61  PITSPDEDYMLCVNGEIYNHIQLREECPEYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF 120
           PITSP  +YML VNGEIYNHIQLREE  +Y++KTL DCEPIIPMYLK+D+DAP +LDGMF
Sbjct: 61  PITSPCGNYMLTVNGEIYNHIQLREETTDYKYKTLGDCEPIIPMYLKYDVDAPNHLDGMF 120

Query: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180
           A+ LYD+++DR++AARDP+GITTLYMGR+S +PKTVYFASELKCL DDCD+I AFPPGHV
Sbjct: 121 AFVLYDSQKDRVIAARDPVGITTLYMGRNSKTPKTVYFASELKCLVDDCDSIIAFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TDKI RYF P+W+DE  IP+TP+D   +R +LE+AVRKRLMAEVPY          
Sbjct: 181 YDSETDKIERYFKPNWIDESIIPTTPVDLKQVRETLERAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETANATNDVDPSTYDSKA-------RHLAGVDDDGKLHTAGWTSLHSFAIG 293
             IASIAARET    ++ +   Y+ ++       + L G+DD G L T  W+ LHSFAIG
Sbjct: 241 SLIASIAARETEKVMDETNTIDYEKQSDDAADASKKLTGLDDSGNLQTQSWSKLHSFAIG 300

Query: 294 LPNAPDLQAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLS 353
           LP APDL+AARKVA FIGS HHEH FT+QEGLDALDDVIYHLETYDVTTIRASTPMFLLS
Sbjct: 301 LPGAPDLKAARKVANFIGSIHHEHNFTIQEGLDALDDVIYHLETYDVTTIRASTPMFLLS 360

Query: 354 RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTM 413
           RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFH ESV+RVKNLHLAD LRANKSTM
Sbjct: 361 RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADNLRANKSTM 420

Query: 414 AWGLEARVPFLDKEFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTGEPDAKPYLPEE 473
           AWGLEARVPFLD++FL LCMNIDPN+KMIKPKEG+IEKY+LRKAFDT+ EPD KPYLPEE
Sbjct: 421 AWGLEARVPFLDRDFLNLCMNIDPNDKMIKPKEGKIEKYLLRKAFDTSDEPDVKPYLPEE 480

Query: 474 ILWRQKEQFSDGVGYSWIDGLKDTAETVISDEMFASPKAEWGSDIPSTKEAFWYRLKFDA 533
           ILWRQKEQFSDGVGYSWID LKDTAE VISDEMFA+PK  WGSDIP+TKEA+WYRLKFDA
Sbjct: 481 ILWRQKEQFSDGVGYSWIDSLKDTAERVISDEMFANPKDHWGSDIPTTKEAYWYRLKFDA 540

Query: 534 LFPQKTVADTVMRWIPKADWGCAEDPSGRYAQIHEKHID 572
           LFPQKT ADTVMRWIPKADWGCAEDPSGRYA+IHE+HID
Sbjct: 541 LFPQKTAADTVMRWIPKADWGCAEDPSGRYAKIHEQHID 579

>AFR303W Chr6 (989036..990751) [1716 bp, 571 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR124W (ASN2) and
           YPR145W (ASN1)
          Length = 571

 Score =  960 bits (2482), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 450/571 (78%), Positives = 498/571 (87%), Gaps = 2/571 (0%)

Query: 1   MCGIFAAFKHEDVHNYKPKALQLSKRIRHRGPDWSGNAIKNSTIFVHERLAIVGLESGAQ 60
           MCGIFA ++ +D+ ++KP AL+LSKR+RHRGPDWSGN IKN TI VHERLAIVGL+SGAQ
Sbjct: 1   MCGIFACYRKDDIESFKPTALRLSKRVRHRGPDWSGNVIKNDTILVHERLAIVGLDSGAQ 60

Query: 61  PITSPDEDYMLCVNGEIYNHIQLREECPEYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF 120
           PI SPD +Y+LCVNGEIYNHI LREEC +Y+F +LSDCEPIIP+YLK+D++ P++LDGMF
Sbjct: 61  PINSPDGNYVLCVNGEIYNHIHLREECSDYEFTSLSDCEPIIPLYLKYDVETPQHLDGMF 120

Query: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180
           AW LYD ++DRIVAARDPIG+TTLYMG+SS+SP+T YFASELKCL D+CD ITAFPPGHV
Sbjct: 121 AWCLYDVQRDRIVAARDPIGVTTLYMGKSSSSPRTRYFASELKCLVDECDEITAFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TDK+TRYF PDW+DE RIPS P+DY A+R +LEKAVRKRLMAEVPY          
Sbjct: 181 YDSDTDKLTRYFKPDWIDETRIPSQPVDYKAVRTTLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETANATNDVDPSTYDSKARHLAGVDDDGKLHTAGWTSLHSFAIGLPNAPDL 300
             IASIAARET  A  +      D K  HLAG+DD G LHT GW+ LHSFAIGLPNAPDL
Sbjct: 241 SLIASIAARETERANREAGDVYADGK--HLAGMDDRGLLHTGGWSRLHSFAIGLPNAPDL 298

Query: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           QAARKVAKFIGS HHEHTFTLQEGLDALDDVI+HLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 299 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIHHLETYDVTTIRASTPMFLLSRKIKAQG 358

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPS AEFHTE+V+RV NLHLADCLRANKSTMAWGLEAR
Sbjct: 359 VKMVLSGEGSDEIFGGYLYFAQAPSPAEFHTETVKRVNNLHLADCLRANKSTMAWGLEAR 418

Query: 421 VPFLDKEFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQKE 480
           VPFLD+EFLQLCMNIDP EKMI P++GRIEKYILRKAFDT+ EP   PYLPEEILWRQKE
Sbjct: 419 VPFLDREFLQLCMNIDPAEKMIAPQKGRIEKYILRKAFDTSDEPGVDPYLPEEILWRQKE 478

Query: 481 QFSDGVGYSWIDGLKDTAETVISDEMFASPKAEWGSDIPSTKEAFWYRLKFDALFPQKTV 540
           QFSDGVGYSWIDGLKD AE  ISDE FA+P   WG DIP+TKEAFWYRLKFDALFPQ T 
Sbjct: 479 QFSDGVGYSWIDGLKDAAERAISDEQFANPNPAWGDDIPTTKEAFWYRLKFDALFPQPTA 538

Query: 541 ADTVMRWIPKADWGCAEDPSGRYAQIHEKHI 571
           A TVMRW+PKADWGCAEDPSGRYA+IH++HI
Sbjct: 539 AATVMRWVPKADWGCAEDPSGRYAKIHDQHI 569

>Ecym_1244 Chr1 complement(501719..503440) [1722 bp, 573 aa] {ON}
           similar to Ashbya gossypii AFR303W
          Length = 573

 Score =  933 bits (2411), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/571 (75%), Positives = 489/571 (85%)

Query: 1   MCGIFAAFKHEDVHNYKPKALQLSKRIRHRGPDWSGNAIKNSTIFVHERLAIVGLESGAQ 60
           MCGIFA ++ + + ++KP ALQLSKRIRHRGPDWSGN +KN TIFVHERLAIVGL++GAQ
Sbjct: 1   MCGIFACYRRDGIESFKPVALQLSKRIRHRGPDWSGNVVKNDTIFVHERLAIVGLDTGAQ 60

Query: 61  PITSPDEDYMLCVNGEIYNHIQLREECPEYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF 120
           PI S D +Y+LCVNGEIYNHI LR+ C +Y F TLSDCEPIIP++ K+ ++ P YLDGMF
Sbjct: 61  PIVSDDGNYVLCVNGEIYNHIHLRDICADYPFSTLSDCEPIIPLFKKYGVETPNYLDGMF 120

Query: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180
           AW LYDAK DRIVAARDPIG+TTLYMG+ S SP+T YFASELKCL ++CD I +FPPGHV
Sbjct: 121 AWCLYDAKDDRIVAARDPIGVTTLYMGKCSKSPRTRYFASELKCLVEECDEIISFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TD+ITRYF P WL +   P+ P+DY  +R  LEKAVRKRLM EVPY          
Sbjct: 181 YDSDTDQITRYFKPSWLVDSITPTKPVDYKKLRGGLEKAVRKRLMTEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETANATNDVDPSTYDSKARHLAGVDDDGKLHTAGWTSLHSFAIGLPNAPDL 300
             IA+IAARET  A  ++D   YDS+ R+L GVDD+  LH +GW+ LHSFAIGLPNAPDL
Sbjct: 241 SLIAAIAARETEKANKEMDVVKYDSQVRNLVGVDDELHLHASGWSKLHSFAIGLPNAPDL 300

Query: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           QAARKVAKFIGS HHEHTFT+QEGLDALDDVI+HLET+DVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFIGSIHHEHTFTIQEGLDALDDVIHHLETFDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420
           +KMVLSGEGSDEIFGGYLYFAQAPSA +FH ESV+RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 IKMVLSGEGSDEIFGGYLYFAQAPSAKDFHNESVERVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDKEFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQKE 480
           VPFLD++FL+LCMNIDP EKMIKPKEG+IEKYILRKAFDT+ EPD +PYLP+EILWRQKE
Sbjct: 421 VPFLDRDFLELCMNIDPEEKMIKPKEGKIEKYILRKAFDTSDEPDVEPYLPQEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDTAETVISDEMFASPKAEWGSDIPSTKEAFWYRLKFDALFPQKTV 540
           QFSDGVGYSWID LKD AE  ISDE FA PK EWG DIPSTKEA+WYR+KFDALFPQ T 
Sbjct: 481 QFSDGVGYSWIDALKDAAENAISDEQFAQPKPEWGDDIPSTKEAYWYRMKFDALFPQPTA 540

Query: 541 ADTVMRWIPKADWGCAEDPSGRYAQIHEKHI 571
           A TVMRW+PKA+WGC+EDPSGR+A+IHEKHI
Sbjct: 541 ASTVMRWVPKAEWGCSEDPSGRFAKIHEKHI 571

>ZYRO0A00528g Chr1 (35425..36963) [1539 bp, 512 aa] {ON} similar to
           uniprot|Q04489 Saccharomyces cerevisiae YML096W
           Hypothetical ORF
          Length = 512

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 35/103 (33%), Positives = 56/103 (54%), Gaps = 9/103 (8%)

Query: 354 RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTM 413
           +K + QG+ ++ SG G+DE++GGY  FA+  S  E   E  +++ N++  +  R +K   
Sbjct: 378 KKYQRQGI-VLFSGLGADELYGGYYKFAR-KSTDELVEELTRQINNIYNRNLNRDDKVIA 435

Query: 414 AWGLEARVPFLDKEFLQLCMNIDPNEKMIKPKEGRIEKYILRK 456
           A G+E R PFLD+  ++  M          P   +I K ILRK
Sbjct: 436 ANGVEVRYPFLDRHVIEFSMQ-------SIPINWKINKLILRK 471

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 38/170 (22%), Positives = 74/170 (43%), Gaps = 29/170 (17%)

Query: 69  YMLCVNGEIYNHIQLREECPEYQFKTLSDCEPIIPMYLKHD----IDAPKYLDGMFAWTL 124
           Y+L  NGE+YN             + L +    +   L++D     +   +L+G FA+T+
Sbjct: 88  YILQFNGELYNE------------EILDNDTSFVASLLENDKMSVFEVISFLEGEFAYTI 135

Query: 125 YDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPG--HVYD 182
           YD  + ++   RD IG  +L   R   +   +Y AS    +T   +  T    G  ++YD
Sbjct: 136 YDMHEHKLYFGRDDIGKRSLSY-RLDQAIGDIYVAS----VTGQQEGFTDCLAGIVYIYD 190

Query: 183 SKTDKITRYFTPDWLDEKRIPSTPI----DYLAIRHSLEKAVRKRLMAEV 228
            +   + +   P  +  + + S  I    ++  I H+L + ++  ++  V
Sbjct: 191 VEDKSLNQQMLP--ILNREVSSEIIEDEDEFQRITHALYEQLKSAIVKRV 238

>Kpol_455.7 s455 complement(6566..8122) [1557 bp, 518 aa] {ON}
           complement(6566..8122) [1557 nt, 519 aa]
          Length = 518

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 50/94 (53%), Gaps = 8/94 (8%)

Query: 363 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEARVP 422
           ++ SG G+DE++GGY  FA   S  E   E  +++ N+H  +  R +K     G+E R P
Sbjct: 391 VLFSGLGADELYGGYHSFAN-KSIEELTVELTRQINNIHDRNLNRDDKVIADNGVEVRYP 449

Query: 423 FLDKEFLQLCMNIDPNEKMIKPKEGRIEKYILRK 456
           FLD+E +Q  ++         P   ++ K ILRK
Sbjct: 450 FLDEEVIQYSVS-------QIPISYKVNKGILRK 476

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 57/214 (26%), Positives = 91/214 (42%), Gaps = 28/214 (13%)

Query: 27  IRHRGPDWSGNAIKNSTIFVHERLAIVGLESGAQPITSP----DEDYMLCVNGEIYNHIQ 82
           I  RGP++S   +       H       + S  QP T      DE Y+L  NGE+YN  +
Sbjct: 50  IVSRGPNYSSLRVNRE----HGISWFSSILSLRQPFTRQSIVVDERYVLQFNGELYNS-E 104

Query: 83  LREECPEYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMFAWTLYDAKQDRIVAARDPIGIT 142
           +     +Y    L  C+  +       +   + LDG FA+T+YD K+  I   RD IG  
Sbjct: 105 ISGNDTQYIVSLLKSCDGDV-------VSLVRKLDGGFAYTIYDLKEGNIYFGRDTIGKR 157

Query: 143 TLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHVYDSKT-----DKITR--YFTPD 195
           +L       S + ++ +S         D +      + YD+KT      K+ R  Y   D
Sbjct: 158 SLCYSIDENSGE-LFISSVTGTRGTFVDCLGGVI--YTYDTKTHTLDDTKVIRDKYVVTD 214

Query: 196 WLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVP 229
             DE    S  ++ L    +L ++V+KR+++  P
Sbjct: 215 MTDELENESQYMELLY--GTLYESVKKRVLSIHP 246

>ADL350C Chr4 complement(90152..91678) [1527 bp, 508 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML096W
          Length = 508

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 50/89 (56%), Gaps = 4/89 (4%)

Query: 363 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEARVP 422
           ++ +G G+DE++GGY  FA   S  E   E  +++ N+H  +  R +K     G+EAR P
Sbjct: 382 VLFNGLGADELYGGYHKFANK-STEELVVELTRQINNIHDRNLNRDDKVLACHGVEARYP 440

Query: 423 FLDKEFLQLCMNID---PNEKMIKPKEGR 448
           FLD++ ++  + +     N+KMI  K  R
Sbjct: 441 FLDEKVIKASVALPISYKNDKMILRKLAR 469

>NCAS0C00190 Chr3 complement(17177..18730) [1554 bp, 517 aa] {ON}
           Anc_8.875
          Length = 517

 Score = 50.8 bits (120), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 55/105 (52%), Gaps = 9/105 (8%)

Query: 352 LSRKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKS 411
           +  K + +G+ ++ SG G+DE++GGY  FA   S  +   E  +++ N++  +  R +K 
Sbjct: 380 IKEKYQRKGI-VLFSGLGADELYGGYHKFANK-SPDDLAIELTRQINNIYDRNLNRDDKV 437

Query: 412 TMAWGLEARVPFLDKEFLQLCMNIDPNEKMIKPKEGRIEKYILRK 456
               G+E R PFLD+E ++          M  P   ++ K ILRK
Sbjct: 438 IANNGVEVRYPFLDEEVIKFST-------MEIPINYKVNKMILRK 475

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/124 (29%), Positives = 57/124 (45%), Gaps = 20/124 (16%)

Query: 27  IRHRGPDWSGNAI--KNSTIFVHERLAIVGLESGAQPITSP----DEDYMLCVNGEIYNH 80
           I  RGP++S   +  K  T +    L++       QP T      +E Y+L  NGE+YNH
Sbjct: 48  ISARGPNYSSLRVSKKYKTAWYSSVLSL------RQPFTCQSIEIEERYVLQFNGELYNH 101

Query: 81  IQLREECPEYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMFAWTLYDAKQDRIVAARDPIG 140
            ++     +Y    L +  P IP  +K        L+G FA+++YD +       RD +G
Sbjct: 102 -EIVHNDTQYIVGLLKESAPSIPAIIKK-------LNGEFAYSIYDIQNGTFYFGRDTVG 153

Query: 141 ITTL 144
             +L
Sbjct: 154 KRSL 157

>KLLA0D10285g Chr4 (869754..871301) [1548 bp, 515 aa] {ON} similar
           to uniprot|Q04489 Saccharomyces cerevisiae YML096W
           Hypothetical ORF
          Length = 515

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 54/106 (50%), Gaps = 2/106 (1%)

Query: 353 SRKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKST 412
           S+     G+ M  SG G+DE++GGY  F+   S  E   E  +++  +H  +  R +K  
Sbjct: 381 SKPYNRSGIVM-FSGLGADELYGGYHKFSN-KSNEELVIELQKQIAQIHDRNLNRDDKVI 438

Query: 413 MAWGLEARVPFLDKEFLQLCMNIDPNEKMIKPKEGRIEKYILRKAF 458
              G+E R PFLD+  +Q  +++  N K+ K     + K ILR  F
Sbjct: 439 SNHGIEVRYPFLDERVVQFSVDLPLNYKVNKHILRVMAKDILRLDF 484

 Score = 34.7 bits (78), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 38/77 (49%), Gaps = 8/77 (10%)

Query: 69  YMLCVNGEIYNHIQLREECPEYQFKTLSDCEPIIPMYLKHDID-APKYLDGMFAWTLYDA 127
           Y+L  NGE+YN   + E C        SD E I  +  KH ++   +   G FA+ + D 
Sbjct: 90  YLLQYNGELYNDDTV-ENCEH------SDTEYISSLLEKHSVEEVVRKCYGEFAYAITDL 142

Query: 128 KQDRIVAARDPIGITTL 144
           ++ ++   RD IG  +L
Sbjct: 143 QERKVYFGRDSIGKRSL 159

>Skud_13.46 Chr13 (79277..80836) [1560 bp, 519 aa] {ON} YML096W
           (REAL)
          Length = 519

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/101 (32%), Positives = 53/101 (52%), Gaps = 9/101 (8%)

Query: 357 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWG 416
           + QGV ++LSG G+DE++GGY  FA   +  E   E  +++ N++  +  R +K     G
Sbjct: 388 QRQGV-VLLSGLGADELYGGYHKFANK-AHHELVKELTRQINNIYERNLNRDDKVIAHNG 445

Query: 417 LEARVPFLDKEFLQLCMNIDPNEKMIKPKEGRIEKYILRKA 457
           +E R PFLD+  + L         +  P   ++ K ILRK 
Sbjct: 446 VEVRYPFLDEYVINLST-------LEIPINYKVNKLILRKV 479

 Score = 40.0 bits (92), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 56/123 (45%), Gaps = 14/123 (11%)

Query: 27  IRHRGPDWSGNAIKNSTIFVHERLAIVGLESGAQPIT----SPDEDYMLCVNGEIYN-HI 81
           I  RGP++S   +    I  H+      + S  +P T    + D+ Y L  NGE+YN  I
Sbjct: 47  IAARGPNYSSLRV----IKAHQTRWFSSVLSLRRPFTKQSINVDDRYHLQFNGELYNKEI 102

Query: 82  QLREECPEYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMFAWTLYDAKQDRIVAARDPIGI 141
              +    Y    L + E       ++ +D  + L+G +A+T+YD K       RDPIG 
Sbjct: 103 SDWDNDSLYIASLLRNLED-----GRNVVDVIRSLEGEYAYTVYDVKSSIFYFGRDPIGK 157

Query: 142 TTL 144
            +L
Sbjct: 158 RSL 160

>SAKL0D00352g Chr4 (31387..32934) [1548 bp, 515 aa] {ON} similar to
           uniprot|Q04489 Saccharomyces cerevisiae YML096W
           Hypothetical ORF
          Length = 515

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 51/89 (57%), Gaps = 6/89 (6%)

Query: 359 QGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLE 418
           +GV ++ SG G+DE++GGY   A   SA E       ++ N+H  +  R +K   + G+E
Sbjct: 387 KGV-VLFSGLGADELYGGYHKLANK-SAEELANALTLQINNIHDRNLNRDDKVIASNGVE 444

Query: 419 ARVPFLDKEFLQ----LCMNIDPNEKMIK 443
            R PFLD++ +Q    L +N   N+K+++
Sbjct: 445 VRYPFLDEKVVQFSTELPINYKVNKKILR 473

 Score = 39.7 bits (91), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 46/174 (26%), Positives = 85/174 (48%), Gaps = 35/174 (20%)

Query: 27  IRHRGPDWSGNAIKNSTIF-VHERLAIVGLESGAQPITSP----DEDYMLCVNGEIYNH- 80
           I +RGP+++  +I+NS+ + +    +I+ L     P+T      ++ ++L  NGE+YN  
Sbjct: 49  IINRGPNYA--SIRNSSKYGISWFSSILSLR---DPLTRQSVKINDRFVLQYNGELYNSS 103

Query: 81  IQLREECPEYQFKTLSDCEPIIPMYLKHDIDAPKY---LDGMFAWTLYDAKQDRIVAARD 137
           IQ             +D   I  +  ++  D PK    ++G FA+T++D + +++   RD
Sbjct: 104 IQH------------NDTLFIASLIERYQDDIPKAIREMEGEFAYTIFDKQCEKLYFGRD 151

Query: 138 PIGITTLYMGRSSASPKTVYFASELKCLT---DDCDTITAFPPGHVYDSKTDKI 188
            IG  +L     S + K   F S +   +   +DC+  T +    +YDSKT  +
Sbjct: 152 TIGKRSLSYKFDSETSK--LFISSVSGTSEGFEDCEGGTIY----IYDSKTGNL 199

>KAFR0L02110 Chr12 complement(400443..401987) [1545 bp, 514 aa] {ON}
           Anc_8.875 YML096W
          Length = 514

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 48/95 (50%), Gaps = 8/95 (8%)

Query: 363 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEARVP 422
           ++ SG G+DE++GGY  F    S  E   E   ++ N+H  +  R +K   + G+E R P
Sbjct: 388 VLFSGLGADELYGGYHKFVNR-SLEELSAELTGQINNIHDRNLNRDDKVIASNGVEVRYP 446

Query: 423 FLDKEFLQLCMNIDPNEKMIKPKEGRIEKYILRKA 457
           FLD   +Q        +++  P   ++ K ILRK 
Sbjct: 447 FLDHNVVQF-----STQEI--PINYKVNKLILRKV 474

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 61/122 (50%), Gaps = 15/122 (12%)

Query: 27  IRHRGPDWSGNAI--KNSTIFVHERLAIVGLESGAQPITSPDEDYMLCVNGEIYNHIQLR 84
           I +RGP++S   +  K  T +    LA+  L    Q +   D  Y+L  NGE+YN  +++
Sbjct: 46  IANRGPNYSSLRLSEKYHTAWFSSVLAL-RLPFTKQSLCVEDR-YVLQFNGELYNK-EIK 102

Query: 85  EECPEYQF--KTLSDCEPIIPMYLKHDIDAPKYLDGMFAWTLYDAKQDRIVAARDPIGIT 142
           ++  + QF    LS    +I    +        LDG FA+T+YD ++ +I   RD IG  
Sbjct: 103 QDQNDTQFIASLLSSSTDVIHTLTQ--------LDGEFAYTIYDLRETKIYFGRDSIGKR 154

Query: 143 TL 144
           +L
Sbjct: 155 SL 156

>TPHA0C04950 Chr3 complement(1067043..1068620) [1578 bp, 525 aa]
           {ON} Anc_8.875 YML096W
          Length = 525

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 52/99 (52%), Gaps = 9/99 (9%)

Query: 357 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWG 416
           K +G+ ++ SG G+DE++GGY  FA   S  E   E  +++ N+H  +  R +K +   G
Sbjct: 388 KRKGI-VLFSGLGADELYGGYHKFANK-SREELVEELTKQINNIHDRNLNRDDKVSADNG 445

Query: 417 LEARVPFLDKEFLQLCMNIDPNEKMIKPKEGRIEKYILR 455
           +E R PFLD    +  +N    E    P   +I K ILR
Sbjct: 446 IEVRYPFLD----EYVVNFSTKE---IPINYKINKKILR 477

 Score = 36.2 bits (82), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 60/128 (46%), Gaps = 25/128 (19%)

Query: 27  IRHRGPDWSGNAIKNSTIFVHERLA-IVGLESGAQPITSP----DEDYMLCVNGEIYNHI 81
           I  RGP++     +   +F  E+++    + S  +P T      ++ Y+L  NGE+YN+ 
Sbjct: 47  IARRGPNY-----QMFRVFKSEQISWYSSILSLRKPFTKQSIEVNDRYILQFNGELYNN- 100

Query: 82  QLREECPEYQFKTLSDCEPII-----PMYLKHDIDAPKYLDGMFAWTLYDAKQDRIVAAR 136
                    +   +SD    +      +  K  I+  + L+G FA+T++D+K+  +   R
Sbjct: 101 ---------EIHGISDTTYFVNCLKTALDEKDIINILRTLEGEFAYTIFDSKKKLVYFGR 151

Query: 137 DPIGITTL 144
           D IG  +L
Sbjct: 152 DTIGKRSL 159

>Suva_13.52 Chr13 (81009..82568) [1560 bp, 519 aa] {ON} YML096W
           (REAL)
          Length = 519

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 51/99 (51%), Gaps = 9/99 (9%)

Query: 359 QGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLE 418
           QGV ++ SG G+DE++GGY  FA  P   E   E  +++ N++  +  R +K     G+E
Sbjct: 390 QGV-VLFSGLGADELYGGYHKFANKP-PHELVEELTRQINNIYERNLNRDDKVIAHNGVE 447

Query: 419 ARVPFLDKEFLQLCMNIDPNEKMIKPKEGRIEKYILRKA 457
            R PFLD+  ++    +D       P   +I K ILR  
Sbjct: 448 VRYPFLDEHVIKFSA-VDI------PINFKINKLILRNV 479

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 57/126 (45%), Gaps = 20/126 (15%)

Query: 27  IRHRGPDWSGNAIKNSTIFVHERLAIVGLESGAQPIT----SPDEDYMLCVNGEIYN-HI 81
           I  RGP++S   +  +    ++      + S  QP T    S D+ Y L  NGE+YN  I
Sbjct: 47  IAARGPNYSSLRVSKA----YQTSWFSSVLSLRQPFTKQSISVDDRYYLQFNGELYNKEI 102

Query: 82  QLREECPEYQFKTLSDCEPIIPMYLKHD---IDAPKYLDGMFAWTLYDAKQDRIVAARDP 138
              +   +Y    L +        L  D   ID  + L+G +A+T+YD K  +    RDP
Sbjct: 103 SDDDNDSQYIASLLQN--------LTGDGDVIDVIRMLEGEYAYTVYDVKASKFYFGRDP 154

Query: 139 IGITTL 144
           IG  +L
Sbjct: 155 IGRRSL 160

>KNAG0J00200 Chr10 complement(24044..25591) [1548 bp, 515 aa] {ON}
           Anc_8.875 YML096W
          Length = 515

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 52/102 (50%), Gaps = 9/102 (8%)

Query: 355 KIKAQGVKMVL-SGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTM 413
           KI  Q   +VL SG G+DE++GGY  FA   S  +   E  +++ N+H  +  R +K   
Sbjct: 380 KIAYQRKGIVLFSGLGADELYGGYHKFANK-SFPDLQIELTRQINNIHDRNLNRDDKVIA 438

Query: 414 AWGLEARVPFLDKEFLQLCMNIDPNEKMIKPKEGRIEKYILR 455
           + G+E R PFLD   ++        E +  P   +I K ILR
Sbjct: 439 SNGVEIRYPFLDSSVVKFS-----TEDL--PINYKINKLILR 473

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 57/125 (45%), Gaps = 22/125 (17%)

Query: 27  IRHRGPD---WSGNAIKNSTIFVHERLAIVGLESGAQPITSP----DEDYMLCVNGEIYN 79
           I  RGP+   W G+A + ST +    L++       QP T      D  Y+L  NGE+YN
Sbjct: 47  IAARGPNFASWRGSA-EYSTAWFSSVLSL------RQPFTKQSLVVDGRYVLQFNGELYN 99

Query: 80  HIQLREECPEYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMFAWTLYDAKQDRIVAARDPI 139
             ++     +Y    L+  E  IP       D    LDG FA+T+YD +  +    RD I
Sbjct: 100 D-EIEFNDTQYIADMLARGEASIP-------DIIARLDGEFAYTIYDTEDQKYYFGRDAI 151

Query: 140 GITTL 144
           G  +L
Sbjct: 152 GKRSL 156

>NDAI0K00180 Chr11 (27899..29467) [1569 bp, 522 aa] {ON} Anc_8.875
           YML096W
          Length = 522

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 50/94 (53%), Gaps = 8/94 (8%)

Query: 363 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEARVP 422
           ++ SG G+DE++GGY  FA   S  E   E  +++ N++  +  R +K     G+E R P
Sbjct: 396 VLFSGLGADELYGGYHKFANK-STEELVKELTKQINNIYDRNLNRDDKVIAHNGVEVRYP 454

Query: 423 FLDKEFLQLCMNIDPNEKMIKPKEGRIEKYILRK 456
           FLD + ++        E++  P   +I K ILRK
Sbjct: 455 FLDIDVIKF-----STEEL--PINYKINKLILRK 481

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 51/220 (23%), Positives = 94/220 (42%), Gaps = 15/220 (6%)

Query: 15  NYKPKALQLSKRIRHRGPDWSGNAIKNSTIFVHERLAIVGLESGAQPITSPDEDYMLCVN 74
           N  P    +   I  RGP++S   +            +   E   +      + Y++  N
Sbjct: 37  NIDPIFNSMISDIAARGPNYSSFKVSKQYSITWFSSVLSLREPFTKQCVEIKDRYVVQFN 96

Query: 75  GEIYNHIQLREECPEYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMFAWTLYDAKQDRIVA 134
           GE+YN  +++    +Y  + L + + II        D  + LDG FA+T+YD +      
Sbjct: 97  GELYND-EIQYNDTQYTIQLLKEGKEII--------DVIRKLDGEFAYTIYDIQNRMFYF 147

Query: 135 ARDPIGITTLYMGRSSASPKTVYFASELKCLT--DDCDTITAFP-PGHVYDSKTD-KITR 190
            RDPIG   L     + + + +Y +S   C T   DC   T +     + +  TD KI++
Sbjct: 148 GRDPIGRRCLSFSIDNETGE-LYISSVTGCKTGFQDCIAGTIYKYDCQLKELNTDSKISK 206

Query: 191 -YFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVP 229
            ++  + LD++ +     +   +   L  +V KR+++  P
Sbjct: 207 PFYVSEELDDENLSHLDDNVEKLYTHLLDSVSKRVVSIHP 246

>YML096W Chr13 (79909..81486) [1578 bp, 525 aa] {ON} Putative
           protein of unknown function with similarity to
           asparagine synthetases; green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm; YML096W
           is not an essential gene and partially overlaps the
           verified gene RAD10
          Length = 525

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 48/95 (50%), Gaps = 8/95 (8%)

Query: 363 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEARVP 422
           ++ SG G+DE++GGY  FA  P   E   E  +++ N++  +  R +K     G+E R P
Sbjct: 393 VLFSGLGADELYGGYHKFANKP-PHELVEELTRQINNIYDRNLNRDDKVIAHNGVEVRYP 451

Query: 423 FLDKEFLQLCMNIDPNEKMIKPKEGRIEKYILRKA 457
           FLD+  ++L            P   ++ K ILRK 
Sbjct: 452 FLDEYVIKL-------STAEIPINFKVNKLILRKV 479

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 38/124 (30%), Positives = 57/124 (45%), Gaps = 16/124 (12%)

Query: 27  IRHRGPDWSG-NAIKNSTIFVHERLAIVGLESGAQPIT----SPDEDYMLCVNGEIYN-H 80
           I  RGP++S   A+K   I     +      S  QP T    + D+ Y L  NGE+YN  
Sbjct: 47  IAARGPNYSSLRAVKAYRISWFSSVL-----SLRQPFTKQSINVDDRYFLQFNGELYNKE 101

Query: 81  IQLREECPEYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMFAWTLYDAKQDRIVAARDPIG 140
           I   +    Y    L + +  + +     ID  K L+G +A+T+YD    ++   RDPIG
Sbjct: 102 ISQGDNDSLYIASMLQNLKEGMGV-----IDVIKSLEGEYAYTIYDVNSSKLYFGRDPIG 156

Query: 141 ITTL 144
             +L
Sbjct: 157 RRSL 160

>TDEL0B00440 Chr2 complement(78116..79666) [1551 bp, 516 aa] {ON}
           Anc_8.875 YML096W
          Length = 516

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 50/94 (53%), Gaps = 8/94 (8%)

Query: 363 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEARVP 422
           ++ SG G+DE++GGY   A   S +E   E  +++ N+H  +  R +K     G+E R P
Sbjct: 390 VLFSGLGADELYGGYHKLANK-SPSELKEELTRQINNIHDRNLNRDDKVIADNGVEVRYP 448

Query: 423 FLDKEFLQLCMNIDPNEKMIKPKEGRIEKYILRK 456
           FLD + ++        E++  P   ++ K ILR+
Sbjct: 449 FLDHDVIKF-----STEEI--PINYKVNKMILRR 475

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 58/219 (26%), Positives = 99/219 (45%), Gaps = 35/219 (15%)

Query: 27  IRHRGPDWSGNAI--KNSTIFVHERLAIVGLESGAQPITSPD----EDYMLCVNGEIYNH 80
           I+ RGPD+S   +  ++ST +    L++       +P TS        ++L  NGE+YN 
Sbjct: 47  IKSRGPDYSSLRVSSEHSTAWYSSVLSL------REPFTSQSVKVGNRFILQFNGELYN- 99

Query: 81  IQLREECPEYQFKTLSDCEPIIPMYLKHDI-DAPKYLDGMFAWTLYDAKQDRIVAARDPI 139
               +E   +   T      +   Y  HD+    + L G FA+TLYD +Q +    RD +
Sbjct: 100 ----QEITAHDNDTQFIVSKLQEGY--HDVCQIIRQLSGEFAYTLYDLQQRKFYYGRDNV 153

Query: 140 GITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHVYDSKTDKI-------TRYF 192
           G  +L    S+ + + +Y +S    +    D I      +VYD+++  +       ++YF
Sbjct: 154 GKRSLSYHLSAITGE-LYISSVSGAIPGFKDCIAGVV--YVYDTESKTLDDSIKLESQYF 210

Query: 193 TPDWLDEKRIPSTPIDYLA--IRHSLEKAVRKRLMAEVP 229
               LDE+    T +D     +   L  AVRKR+++  P
Sbjct: 211 ITKKLDEEL---TCLDSTVEQLYGMLSLAVRKRVLSIHP 246

>TBLA0C06300 Chr3 (1523556..1525112) [1557 bp, 518 aa] {ON}
           Anc_8.875 YML096W
          Length = 518

 Score = 47.4 bits (111), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 59/124 (47%), Gaps = 7/124 (5%)

Query: 22  QLSKRIRHRGPDW-SGNAIKNSTIFVHERLAIVGLESGAQPITSPDEDYMLCVNGEIYNH 80
            L K I  RGP++ S   +K+  I +   +  +      Q +   D  Y+L  NGE+YN 
Sbjct: 43  NLMKLISARGPNFASLRTLKDHRISLFSSVLSLREPFCKQSVLVEDR-YVLQFNGELYND 101

Query: 81  IQLREECPEYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMFAWTLYDAKQDRIVAARDPIG 140
            ++     ++  K L + E       K  I   K LDG FA+++YD K  R+   RDPIG
Sbjct: 102 -EIIHNDTQFIVKLLLNTE----QNSKGIISVIKNLDGEFAFSIYDLKNKRLYFGRDPIG 156

Query: 141 ITTL 144
             +L
Sbjct: 157 KRSL 160

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 47/94 (50%), Gaps = 8/94 (8%)

Query: 363 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEARVP 422
           ++ SG G+DE++GGY  F    +  E   E  +++ N+H  +  R +K     G+E R P
Sbjct: 392 VLFSGLGADELYGGYHKFVNK-TPRELVEELTRQINNIHDRNLNRDDKVIANNGVEVRYP 450

Query: 423 FLDKEFLQLCMNIDPNEKMIKPKEGRIEKYILRK 456
           FLD+  ++   +         P   +I K ILRK
Sbjct: 451 FLDEHVIKYSTH-------DIPINYKINKLILRK 477

>Smik_13.39 Chr13 (77004..78569) [1566 bp, 521 aa] {ON} YML096W
           (REAL)
          Length = 521

 Score = 47.4 bits (111), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 51/96 (53%), Gaps = 10/96 (10%)

Query: 363 MVLSGEGSDEIFGGYLYFA-QAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEARV 421
           ++LSG G+DE++GGY  FA +AP   E   E  +++ N++  +  R +K     G+E R 
Sbjct: 393 VLLSGLGADELYGGYHKFANKAPH--ELVEELTKQINNIYERNLNRDDKVIAHNGVEVRY 450

Query: 422 PFLDKEFLQLCMNIDPNEKMIKPKEGRIEKYILRKA 457
           PFLD+  ++          +  P   ++ K ILRK 
Sbjct: 451 PFLDEYVIKFST-------VEIPINYKVNKLILRKV 479

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 73/170 (42%), Gaps = 24/170 (14%)

Query: 27  IRHRGPDWSGNAIKNSTIFVHERLAIVGLESGAQPIT----SPDEDYMLCVNGEIYN-HI 81
           I  RGP++S       T+  +       + S  +P T    + D+ Y L  NGE+YN  +
Sbjct: 47  IAARGPNYSSL----RTVRAYRTSWFSSVLSLREPFTKQSINVDDRYYLQFNGELYNKEV 102

Query: 82  QLREECPEYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMFAWTLYDAKQDRIVAARDPIGI 141
                   Y    L D E    +     ID  K L+G +A+T+YD K  +    RDPIG 
Sbjct: 103 SHWGNDSLYIASLLKDLEDDGSV-----IDVIKSLEGEYAYTVYDVKSAKFYFGRDPIGR 157

Query: 142 TTLYMGRSSASPKTVYFAS---ELKCLTDDCDTITAFPPGHVYDSKTDKI 188
            +L    S  +   +Y AS    ++C   DC   T +     YD++T  +
Sbjct: 158 RSL--SYSVTANNELYVASVTGAVECF-HDCIGGTVYE----YDTQTKSL 200

>Skud_7.311 Chr7
           complement(535445..535513,535517..535621,535625..535693)
           [243 bp, 81 aa] {ON} YGR124W (REAL)
          Length = 81

 Score = 42.4 bits (98), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 29/89 (32%), Positives = 45/89 (50%), Gaps = 14/89 (15%)

Query: 102 IPMYLKHDIDAPKYLDGMFAWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASE 161
           +P YL+ DIDAPK+L+ MFA++    ++              ++ G S    +T +  S+
Sbjct: 1   VPFYLERDIDAPKHLNDMFAFSWKKKEKSCCC--------CKIFYGCSFLMHRTFFQVSK 52

Query: 162 --LKC----LTDDCDTITAFPPGHVYDSK 184
             L C    LT  CD   +F PG V+DS+
Sbjct: 53  DCLLCFTQILTGFCDNNDSFSPGRVFDSE 81

>Kwal_27.9705 s27 (28837..30384) [1548 bp, 515 aa] {ON} YML096W -
           Hypothetical ORF [contig 336] FULL
          Length = 515

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 47/87 (54%), Gaps = 2/87 (2%)

Query: 357 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWG 416
           K +G+ ++ SG G+DE++GGY  F+   +  E   E   ++ N+H  +  R +K   + G
Sbjct: 384 KRRGI-VLFSGLGADELYGGYHKFSN-KTPEELVGELETQINNIHDRNLNRDDKVIASNG 441

Query: 417 LEARVPFLDKEFLQLCMNIDPNEKMIK 443
           +E R PFLD   ++    +  N K+ K
Sbjct: 442 VEVRYPFLDDRVIEFSTQLPINYKVNK 468

 Score = 32.7 bits (73), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 40/172 (23%), Positives = 74/172 (43%), Gaps = 30/172 (17%)

Query: 27  IRHRGPDWSGNAIKNSTIFVHERLAIVGLESGAQPITSP----DEDYMLCVNGEIYNHIQ 82
           I  RGP+++  ++K+S       +    + S  +P+T      ++ ++L  NGEIYN   
Sbjct: 49  IVDRGPNYA--SLKSSA--TDAAVWFTSILSLREPLTKQCIDINDRFVLQYNGEIYNS-S 103

Query: 83  LREECPEYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMFAWTLYDAKQDRIVAARDPIGIT 142
           +     +Y    LS  + + P  ++        L G FA+T+YD     I   RD +G  
Sbjct: 104 IAHNDTQYIATELSIVQNV-PTVIRK-------LSGEFAYTVYDRATGEIFFGRDGVGKR 155

Query: 143 TLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPG-----HVYDSKTDKIT 189
           +L   R+ A  + +       C+T     +  F        ++Y SK+  ++
Sbjct: 156 SLAF-RTCAEQRNL-------CVTSVSGKVDGFQNCEAGVIYIYQSKSGHLS 199

>Ecym_8155 Chr8 complement(324050..325591) [1542 bp, 513 aa] {ON}
           similar to Ashbya gossypii ADL350C
          Length = 513

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 47/91 (51%), Gaps = 2/91 (2%)

Query: 354 RKIKAQGVKMVL-SGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKST 412
           + I  Q   +VL SG G+DE++GGY  F    S      E  +++ N++  +  R +K  
Sbjct: 376 KTISYQRRSLVLFSGLGADELYGGYHKFNN-KSPELLIKELTKQINNIYDRNLDRDDKCM 434

Query: 413 MAWGLEARVPFLDKEFLQLCMNIDPNEKMIK 443
              G+E R PFLD+E + L  ++  N K  K
Sbjct: 435 ACNGIEIRYPFLDEEVINLSTSLPINYKTNK 465

>KLTH0E16412g Chr5 complement(1455298..1456845) [1548 bp, 515 aa]
           {ON} similar to uniprot|Q04489 Saccharomyces cerevisiae
           YML096W Hypothetical ORF
          Length = 515

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 48/95 (50%), Gaps = 9/95 (9%)

Query: 363 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEARVP 422
           ++ SG G+DE++GGY  F++  +  E   E   ++ N++  +  R +K   + G+E R P
Sbjct: 389 VLFSGLGADELYGGYHKFSKRAN-EELVPELEVQINNIYDRNLNRDDKVISSNGVEIRYP 447

Query: 423 FLDKEFLQLCMNIDPNEKMIKPKEGRIEKYILRKA 457
           FLD + +     +  N K        + K ILRK 
Sbjct: 448 FLDDQVVAFSTQLPINYK--------VNKMILRKV 474

 Score = 34.7 bits (78), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 38/82 (46%), Gaps = 15/82 (18%)

Query: 66  DEDYMLCVNGEIYNHIQLREECPEYQFKTLSDCEPIIPMYLKHDIDAP---KYLDGMFAW 122
           ++ ++L  NGEIYN              + +D + I  M L    D P   + L G FA+
Sbjct: 88  EDRFVLQYNGEIYN-----------SSISHNDTQYIAEMLLNAK-DIPSVIRTLSGEFAY 135

Query: 123 TLYDAKQDRIVAARDPIGITTL 144
           T+YD     +   RDPIG  +L
Sbjct: 136 TIYDKLTGEVFFGRDPIGRRSL 157

>CAGL0H06963g Chr8 (689948..691501) [1554 bp, 517 aa] {ON} similar
           to uniprot|Q04489 Saccharomyces cerevisiae YML096w
          Length = 517

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 44/80 (55%), Gaps = 2/80 (2%)

Query: 352 LSRKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKS 411
           + ++ K +G+ ++ SG G+DE++GGY Y        E   E   ++ N++  +  R +K 
Sbjct: 382 VRKEYKRKGL-VLFSGLGADELYGGY-YKLSNKHEDELANELTTQINNIYRRNLNRDDKV 439

Query: 412 TMAWGLEARVPFLDKEFLQL 431
             + G+E R PFL +E ++ 
Sbjct: 440 IASNGVEVRYPFLAEEVVEF 459

 Score = 38.9 bits (89), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 48/169 (28%), Positives = 74/169 (43%), Gaps = 38/169 (22%)

Query: 1   MCGIFA----AFKHEDVH------------NYKPKALQLSKRIRHRGPDW-SGNAIKN-S 42
           MCGI      +FK E+               Y      + K +R RGP++ S   IK+ +
Sbjct: 1   MCGILLCYGPSFKAENDRLLEFYEDEVPRLGYDDNIESIVKLVRCRGPNYCSMRQIKDVN 60

Query: 43  TIFVHERLAIVGLESGAQPITSPD----EDYMLCVNGEIYNHIQLREECPEYQFKT--LS 96
           +I++   L++       QP T         Y+L  NGE+YN  ++ E   + QF +  L 
Sbjct: 61  SIWISSVLSL------RQPFTKQSIVIGNKYVLQFNGELYND-EIIESGNDTQFLSGLLK 113

Query: 97  DCEPIIPMYLKHDI-DAPKYLDGMFAWTLYDAKQDRIVAARDPIGITTL 144
            C        + DI +    LDG FA+T+ D + + I   RD IG  +L
Sbjct: 114 KCIS------EDDIFNILHGLDGEFAFTIQDLENNLIYFGRDTIGKRSL 156

>TDEL0C03200 Chr3 complement(566646..567236) [591 bp, 196 aa] {ON}
           Anc_7.456 YPR037C
          Length = 196

 Score = 32.0 bits (71), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 28/62 (45%), Gaps = 8/62 (12%)

Query: 249 RETANATNDVDPSTYDSKARHLAGVDDDGKLHTAGWTSLHSFAIGLPNAPDLQAARKVAK 308
           + T+N    + PS  D +A+         KL  A WT  H+     P+ P  + + K+ +
Sbjct: 51  KATSNEKGTIMPSMPDKEAKE--------KLGRASWTYFHTLLARFPDEPTAEQSEKLKQ 102

Query: 309 FI 310
           FI
Sbjct: 103 FI 104

>Smik_4.239 Chr4 (434533..435918) [1386 bp, 461 aa] {ON} YDR004W
           (REAL)
          Length = 461

 Score = 31.6 bits (70), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 29/62 (46%), Gaps = 6/62 (9%)

Query: 40  KNSTIFVHERLAIVGLESGAQPITSPDEDYMLC------VNGEIYNHIQLREECPEYQFK 93
           KNSTI   +  ++ G  +    I S DEDYML       VN   Y +   ++  P  + K
Sbjct: 304 KNSTILYRQMNSLFGANANNDEILSDDEDYMLIERVVNGVNDRSYEYSLRKKNSPISKNK 363

Query: 94  TL 95
           TL
Sbjct: 364 TL 365

>YDR004W Chr4 (455201..456583) [1383 bp, 460 aa] {ON}  RAD57Protein
           that stimulates strand exchange by stabilizing the
           binding of Rad51p to single-stranded DNA; involved in
           the recombinational repair of double-strand breaks in
           DNA during vegetative growth and meiosis; forms
           heterodimer with Rad55p
          Length = 460

 Score = 31.2 bits (69), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 19/32 (59%)

Query: 40  KNSTIFVHERLAIVGLESGAQPITSPDEDYML 71
           KNSTI   +  +++G  S    I S DEDYML
Sbjct: 304 KNSTILYRQMNSLLGASSNNDEILSDDEDYML 335

>ADR413C Chr4 complement(1448030..1449832) [1803 bp, 600 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR370C
           (MRS6)
          Length = 600

 Score = 31.2 bits (69), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 19/27 (70%), Gaps = 2/27 (7%)

Query: 258 VDPSTYD--SKARHLAGVDDDGKLHTA 282
           VDPS +D  SKA+H  G  D+G L+TA
Sbjct: 500 VDPSLFDLESKAKHTVGASDNGVLYTA 526

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.135    0.417 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 61,555,858
Number of extensions: 2632612
Number of successful extensions: 5571
Number of sequences better than 10.0: 52
Number of HSP's gapped: 5638
Number of HSP's successfully gapped: 70
Length of query: 572
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 457
Effective length of database: 40,294,809
Effective search space: 18414727713
Effective search space used: 18414727713
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)