Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_15.963.165ON49149124790.0
YOL062C (APM4)3.165ON49149123500.0
Skud_15.913.165ON49149122930.0
Suva_15.1033.165ON49149122620.0
ZYRO0B04840g3.165ON47649116500.0
TDEL0D045803.165ON48249216480.0
NCAS0C035803.165ON49150316210.0
CAGL0C05203g3.165ON47549216180.0
NDAI0G029203.165ON48650416010.0
Kpol_1045.443.165ON46949115470.0
SAKL0C07414g3.165ON48249114800.0
KNAG0K011503.165ON47449514140.0
KLTH0F06534g3.165ON46650514090.0
Kwal_33.141823.165ON46749614060.0
TPHA0P006603.165ON47349413380.0
TBLA0F008403.165ON48149113211e-179
Ecym_52393.165ON46449612611e-170
KLLA0C03894g3.165ON47549411691e-156
KAFR0C010203.165ON42849811131e-148
ADR315W3.165ON49245910841e-143
Kwal_55.208437.127ON4415084911e-55
SAKL0F05346g7.127ON4475064902e-55
KLTH0F12584g7.127ON4415034865e-55
Ecym_83507.127ON4454974795e-54
ADL017C7.127ON4435024788e-54
YPL259C (APM1)7.127ON4755154721e-52
KLLA0D14311g7.127ON4435044664e-52
Suva_16.457.127ON4785194661e-51
TBLA0A009507.127ON4695134651e-51
Smik_6.4667.127ON4765174624e-51
KNAG0L009507.127ON4615044501e-49
NDAI0E036807.127ON4445004491e-49
TDEL0H028907.127ON4425024454e-49
Skud_16.197.127ON4765174371e-47
ZYRO0C05236g7.127ON4475044351e-47
NCAS0E021407.127ON4815014372e-47
CAGL0K00539g7.127ON4563014167e-45
TPHA0C043207.127ON4543003913e-41
KAFR0L004707.127ON4653113896e-41
Kpol_1062.567.127ON4502993808e-40
KLTH0D07502g2.555ON5043322292e-19
Kwal_26.81462.555ON5054762016e-16
SAKL0D13090g2.555ON4993291901e-14
KLLA0F25432g2.555ON5073501873e-14
Ecym_45912.555ON5013371873e-14
TPHA0I023902.555ON5592341848e-14
KAFR0A020602.555ON5403461849e-14
CAGL0K03223g2.555ON5982421793e-13
TBLA0B067602.555ON6572451785e-13
ZYRO0E05874g2.555ON5493351732e-12
Kpol_1056.132.555ON5413481705e-12
Skud_8.262.555ON5963481696e-12
NCAS0A126502.555ON5883391642e-11
KNAG0C055502.555ON5823581616e-11
Suva_8.332.555ON5963551608e-11
ABR047W2.555ON4981441581e-10
TDEL0B064302.555ON5253311571e-10
NDAI0B016102.555ON6722341511e-09
YHL019C (APM2)2.555ON6053511501e-09
Smik_8.232.555ON6033521492e-09
KLTH0D06556g2.522ON4563191374e-08
KLLA0E18789g2.522ON4971481303e-07
KAFR0D035602.522ON4553391285e-07
Kwal_26.79572.522ON4563131285e-07
TDEL0A029702.522ON4963391109e-05
SAKL0A09218g2.522ON4733351053e-04
AGL061W2.522ON4113301026e-04
Kpol_1018.422.522ON575154970.003
TBLA0I006202.522ON609158970.004
CAGL0L02145g2.522ON543171850.089
TPHA0C041302.522ON533152840.12
ZYRO0B01738g2.522ON492152830.15
KNAG0A069702.522ON50536790.38
Smik_2.4302.522ON484146790.45
NCAS0A048702.522ON489165732.3
KNAG0F010602.44ON42859722.7
Ecym_72662.522ON517145705.2
NDAI0K019302.522ON612174706.1
Kpol_1025.384.119ON420127688.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_15.96
         (491 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_15.96 Chr15 complement(174750..176225) [1476 bp, 491 aa] {O...   959   0.0  
YOL062C Chr15 complement(210520..211995) [1476 bp, 491 aa] {ON} ...   909   0.0  
Skud_15.91 Chr15 complement(169608..171083) [1476 bp, 491 aa] {O...   887   0.0  
Suva_15.103 Chr15 complement(183026..184501) [1476 bp, 491 aa] {...   875   0.0  
ZYRO0B04840g Chr2 (389669..391099) [1431 bp, 476 aa] {ON} highly...   640   0.0  
TDEL0D04580 Chr4 (840369..841817) [1449 bp, 482 aa] {ON} Anc_3.1...   639   0.0  
NCAS0C03580 Chr3 complement(715761..717236) [1476 bp, 491 aa] {O...   629   0.0  
CAGL0C05203g Chr3 (496561..497988) [1428 bp, 475 aa] {ON} highly...   627   0.0  
NDAI0G02920 Chr7 complement(676413..677873) [1461 bp, 486 aa] {O...   621   0.0  
Kpol_1045.44 s1045 complement(103089..104498) [1410 bp, 469 aa] ...   600   0.0  
SAKL0C07414g Chr3 complement(683859..685307) [1449 bp, 482 aa] {...   574   0.0  
KNAG0K01150 Chr11 complement(225095..226519) [1425 bp, 474 aa] {...   549   0.0  
KLTH0F06534g Chr6 complement(565211..566611) [1401 bp, 466 aa] {...   547   0.0  
Kwal_33.14182 s33 complement(560456..561859) [1404 bp, 467 aa] {...   546   0.0  
TPHA0P00660 Chr16 (136114..137535) [1422 bp, 473 aa] {ON} Anc_3....   520   0.0  
TBLA0F00840 Chr6 (213915..215360) [1446 bp, 481 aa] {ON} Anc_3.1...   513   e-179
Ecym_5239 Chr5 complement(492091..493485) [1395 bp, 464 aa] {ON}...   490   e-170
KLLA0C03894g Chr3 complement(354889..356316) [1428 bp, 475 aa] {...   454   e-156
KAFR0C01020 Chr3 (208272..209558) [1287 bp, 428 aa] {ON} Anc_3.1...   433   e-148
ADR315W Chr4 (1259839..1261317) [1479 bp, 492 aa] {ON} Syntenic ...   422   e-143
Kwal_55.20843 s55 complement(580157..581482) [1326 bp, 441 aa] {...   193   1e-55
SAKL0F05346g Chr6 (413830..415173) [1344 bp, 447 aa] {ON} highly...   193   2e-55
KLTH0F12584g Chr6 complement(1053944..1055269) [1326 bp, 441 aa]...   191   5e-55
Ecym_8350 Chr8 (700421..701758) [1338 bp, 445 aa] {ON} similar t...   189   5e-54
ADL017C Chr4 complement(679085..680416) [1332 bp, 443 aa] {ON} S...   188   8e-54
YPL259C Chr16 complement(51244..52671) [1428 bp, 475 aa] {ON}  A...   186   1e-52
KLLA0D14311g Chr4 (1216574..1217905) [1332 bp, 443 aa] {ON} simi...   184   4e-52
Suva_16.45 Chr16 complement(66786..68222) [1437 bp, 478 aa] {ON}...   184   1e-51
TBLA0A00950 Chr1 complement(210799..212208) [1410 bp, 469 aa] {O...   183   1e-51
Smik_6.466 Chr6 (768507..769937) [1431 bp, 476 aa] {ON} YPL259C ...   182   4e-51
KNAG0L00950 Chr12 complement(174410..175795) [1386 bp, 461 aa] {...   177   1e-49
NDAI0E03680 Chr5 complement(794613..795947) [1335 bp, 444 aa] {O...   177   1e-49
TDEL0H02890 Chr8 complement(481125..482453) [1329 bp, 442 aa] {O...   176   4e-49
Skud_16.19 Chr16 complement(30298..31728) [1431 bp, 476 aa] {ON}...   172   1e-47
ZYRO0C05236g Chr3 complement(408616..409959) [1344 bp, 447 aa] {...   172   1e-47
NCAS0E02140 Chr5 complement(410049..411494) [1446 bp, 481 aa] {O...   172   2e-47
CAGL0K00539g Chr11 complement(64028..65398) [1371 bp, 456 aa] {O...   164   7e-45
TPHA0C04320 Chr3 (932871..934235) [1365 bp, 454 aa] {ON} Anc_7.1...   155   3e-41
KAFR0L00470 Chr12 complement(85772..87169) [1398 bp, 465 aa] {ON...   154   6e-41
Kpol_1062.56 s1062 (126558..127910) [1353 bp, 450 aa] {ON} (1265...   150   8e-40
KLTH0D07502g Chr4 (650799..652313) [1515 bp, 504 aa] {ON} simila...    93   2e-19
Kwal_26.8146 s26 (665689..667206) [1518 bp, 505 aa] {ON} YHL019C...    82   6e-16
SAKL0D13090g Chr4 (1093315..1094814) [1500 bp, 499 aa] {ON} weak...    78   1e-14
KLLA0F25432g Chr6 complement(2365434..2366957) [1524 bp, 507 aa]...    77   3e-14
Ecym_4591 Chr4 complement(1154444..1155949) [1506 bp, 501 aa] {O...    77   3e-14
TPHA0I02390 Chr9 (528997..530676) [1680 bp, 559 aa] {ON} Anc_2.5...    75   8e-14
KAFR0A02060 Chr1 (428640..430262) [1623 bp, 540 aa] {ON} Anc_2.5...    75   9e-14
CAGL0K03223g Chr11 (296371..298167) [1797 bp, 598 aa] {ON} simil...    74   3e-13
TBLA0B06760 Chr2 (1594957..1596930) [1974 bp, 657 aa] {ON} Anc_2...    73   5e-13
ZYRO0E05874g Chr5 (452910..454559) [1650 bp, 549 aa] {ON} simila...    71   2e-12
Kpol_1056.13 s1056 complement(30531..32156) [1626 bp, 541 aa] {O...    70   5e-12
Skud_8.26 Chr8 complement(55759..57549) [1791 bp, 596 aa] {ON} Y...    70   6e-12
NCAS0A12650 Chr1 (2492345..2494111) [1767 bp, 588 aa] {ON} Anc_2...    68   2e-11
KNAG0C05550 Chr3 complement(1076437..1078185) [1749 bp, 582 aa] ...    67   6e-11
Suva_8.33 Chr8 complement(69735..71525) [1791 bp, 596 aa] {ON} Y...    66   8e-11
ABR047W Chr2 (479283..480779) [1497 bp, 498 aa] {ON} Syntenic ho...    65   1e-10
TDEL0B06430 Chr2 (1137277..1138854) [1578 bp, 525 aa] {ON} Anc_2...    65   1e-10
NDAI0B01610 Chr2 complement(384287..386305) [2019 bp, 672 aa] {O...    63   1e-09
YHL019C Chr8 complement(67731..69548) [1818 bp, 605 aa] {ON}  AP...    62   1e-09
Smik_8.23 Chr8 complement(51372..53183) [1812 bp, 603 aa] {ON} Y...    62   2e-09
KLTH0D06556g Chr4 complement(570972..572342) [1371 bp, 456 aa] {...    57   4e-08
KLLA0E18789g Chr5 (1669103..1670596) [1494 bp, 497 aa] {ON} simi...    55   3e-07
KAFR0D03560 Chr4 complement(695693..697060) [1368 bp, 455 aa] {O...    54   5e-07
Kwal_26.7957 s26 complement(586544..587914) [1371 bp, 456 aa] {O...    54   5e-07
TDEL0A02970 Chr1 complement(532395..533885) [1491 bp, 496 aa] {O...    47   9e-05
SAKL0A09218g Chr1 complement(802348..803734,803809..803843) [142...    45   3e-04
AGL061W Chr7 (593647..594882) [1236 bp, 411 aa] {ON} Syntenic ho...    44   6e-04
Kpol_1018.42 s1018 (137162..138889) [1728 bp, 575 aa] {ON} (1371...    42   0.003
TBLA0I00620 Chr9 complement(110231..112060) [1830 bp, 609 aa] {O...    42   0.004
CAGL0L02145g Chr12 (252110..253741) [1632 bp, 543 aa] {ON} simil...    37   0.089
TPHA0C04130 Chr3 complement(886804..888405) [1602 bp, 533 aa] {O...    37   0.12 
ZYRO0B01738g Chr2 complement(139975..141453) [1479 bp, 492 aa] {...    37   0.15 
KNAG0A06970 Chr1 complement(1086674..1088191) [1518 bp, 505 aa] ...    35   0.38 
Smik_2.430 Chr2 complement(763687..765141) [1455 bp, 484 aa] {ON...    35   0.45 
NCAS0A04870 Chr1 (973552..975021) [1470 bp, 489 aa] {ON} Anc_2.5...    33   2.3  
KNAG0F01060 Chr6 (188811..190097) [1287 bp, 428 aa] {ON} Anc_2.4...    32   2.7  
Ecym_7266 Chr7 (559988..560022,560112..561630) [1554 bp, 517 aa]...    32   5.2  
NDAI0K01930 Chr11 (437535..439373) [1839 bp, 612 aa] {ON} Anc_2....    32   6.1  
Kpol_1025.38 s1025 (90229..90465,90467..91492) [1263 bp, 420 aa]...    31   8.4  

>Smik_15.96 Chr15 complement(174750..176225) [1476 bp, 491 aa] {ON}
           YOL062C (REAL)
          Length = 491

 Score =  959 bits (2479), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 466/491 (94%), Positives = 466/491 (94%)

Query: 1   MISGVLIYSSRGELVLNKFFKNSLKRSISDIFRVQVINNLDVRSPVLTLGSTTFHHIRSR 60
           MISGVLIYSSRGELVLNKFFKNSLKRSISDIFRVQVINNLDVRSPVLTLGSTTFHHIRSR
Sbjct: 1   MISGVLIYSSRGELVLNKFFKNSLKRSISDIFRVQVINNLDVRSPVLTLGSTTFHHIRSR 60

Query: 61  HGDNLWLVTITRSNANSAAIWEFLYKLDFVMNAYRLDREEALKEEFMIVHEMLDIMLGGN 120
           HGDNLWLVTITRSNANSAAIWEFLYKLDFVMNAYRLDREEALKEEFMIVHEMLDIMLGGN
Sbjct: 61  HGDNLWLVTITRSNANSAAIWEFLYKLDFVMNAYRLDREEALKEEFMIVHEMLDIMLGGN 120

Query: 121 GIPIDTELNSVIAQMSVKPVRNTGGLLDSPDGNDMLXXXXXXXXXXGEXXXXXXXXXXXX 180
           GIPIDTELNSVIAQMSVKPVRNTGGLLDSPDGNDML          GE            
Sbjct: 121 GIPIDTELNSVIAQMSVKPVRNTGGLLDSPDGNDMLSSSSSPSSVSGELHFPKFLKKSSS 180

Query: 181 XXXGQGDSASDFYDGNKITWRPKGITHKKDEVFLYVNERMNILVSRDGSILKSYVDGTID 240
              GQGDSASDFYDGNKITWRPKGITHKKDEVFLYVNERMNILVSRDGSILKSYVDGTID
Sbjct: 181 SFLGQGDSASDFYDGNKITWRPKGITHKKDEVFLYVNERMNILVSRDGSILKSYVDGTID 240

Query: 241 ITTHLSGTPICRFGLNDSLGMQSEDEKKWLAQQQHHSRGNFESKNFIHKAAAGSVLLEDC 300
           ITTHLSGTPICRFGLNDSLGMQSEDEKKWLAQQQHHSRGNFESKNFIHKAAAGSVLLEDC
Sbjct: 241 ITTHLSGTPICRFGLNDSLGMQSEDEKKWLAQQQHHSRGNFESKNFIHKAAAGSVLLEDC 300

Query: 301 KFHECVSLDKFNKNHTIEFVPPDGSMELMKYHVRDNINLPFKITPIVTHSTRDNEIDYRI 360
           KFHECVSLDKFNKNHTIEFVPPDGSMELMKYHVRDNINLPFKITPIVTHSTRDNEIDYRI
Sbjct: 301 KFHECVSLDKFNKNHTIEFVPPDGSMELMKYHVRDNINLPFKITPIVTHSTRDNEIDYRI 360

Query: 361 TLKSLFPGKLSAKDVTLHIPVPPSTVDCKISVSNGHCKFVPEENAMMWRFNKYNGLTENT 420
           TLKSLFPGKLSAKDVTLHIPVPPSTVDCKISVSNGHCKFVPEENAMMWRFNKYNGLTENT
Sbjct: 361 TLKSLFPGKLSAKDVTLHIPVPPSTVDCKISVSNGHCKFVPEENAMMWRFNKYNGLTENT 420

Query: 421 LSAVTVSTSDTTQLNLQQWTRPPMSLDFEVMMFSNSGLVVRYFTIFGKDSKHRAVKWIKY 480
           LSAVTVSTSDTTQLNLQQWTRPPMSLDFEVMMFSNSGLVVRYFTIFGKDSKHRAVKWIKY
Sbjct: 421 LSAVTVSTSDTTQLNLQQWTRPPMSLDFEVMMFSNSGLVVRYFTIFGKDSKHRAVKWIKY 480

Query: 481 ISRSGSYEVRY 491
           ISRSGSYEVRY
Sbjct: 481 ISRSGSYEVRY 491

>YOL062C Chr15 complement(210520..211995) [1476 bp, 491 aa] {ON}
           APM4Mu2-like subunit of the clathrin associated protein
           complex (AP-2); involved in vesicle transport
          Length = 491

 Score =  909 bits (2350), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/491 (89%), Positives = 453/491 (92%)

Query: 1   MISGVLIYSSRGELVLNKFFKNSLKRSISDIFRVQVINNLDVRSPVLTLGSTTFHHIRSR 60
           MISGVL+YSSRGELVLNKFFKNSLKRSISDIFRVQVINNLDVRSPVLTLGSTTFHHIRSR
Sbjct: 1   MISGVLVYSSRGELVLNKFFKNSLKRSISDIFRVQVINNLDVRSPVLTLGSTTFHHIRSR 60

Query: 61  HGDNLWLVTITRSNANSAAIWEFLYKLDFVMNAYRLDREEALKEEFMIVHEMLDIMLGGN 120
           HGDNLWLVTITRSNANSAAIWEFLYKLD VMNAYRLDREEALKEEFMIVHEMLDIMLGGN
Sbjct: 61  HGDNLWLVTITRSNANSAAIWEFLYKLDAVMNAYRLDREEALKEEFMIVHEMLDIMLGGN 120

Query: 121 GIPIDTELNSVIAQMSVKPVRNTGGLLDSPDGNDMLXXXXXXXXXXGEXXXXXXXXXXXX 180
           GIPIDTELNSVIAQMSVKPVRN GGLLDSPDGND+L          GE            
Sbjct: 121 GIPIDTELNSVIAQMSVKPVRNMGGLLDSPDGNDVLSSSSSPTSSAGELHFPKFLTKRSS 180

Query: 181 XXXGQGDSASDFYDGNKITWRPKGITHKKDEVFLYVNERMNILVSRDGSILKSYVDGTID 240
              GQGDS SDFYD NKITWRPKGI HKKDEVFLYVNER+NILVSRDGSILKSYVDGTID
Sbjct: 181 SFLGQGDSTSDFYDNNKITWRPKGIIHKKDEVFLYVNERINILVSRDGSILKSYVDGTID 240

Query: 241 ITTHLSGTPICRFGLNDSLGMQSEDEKKWLAQQQHHSRGNFESKNFIHKAAAGSVLLEDC 300
           ITTHLSGTPICRFGLNDSLGMQSEDEKKWLAQQQ HS  +F +KNFI KAAAGSVLLEDC
Sbjct: 241 ITTHLSGTPICRFGLNDSLGMQSEDEKKWLAQQQRHSGSDFGNKNFIPKAAAGSVLLEDC 300

Query: 301 KFHECVSLDKFNKNHTIEFVPPDGSMELMKYHVRDNINLPFKITPIVTHSTRDNEIDYRI 360
           KFHECVSLDKFN+NH IEFVPPDGSMELMKYHVRDNINLPFK+TPIVTHSTRDNEIDYRI
Sbjct: 301 KFHECVSLDKFNRNHIIEFVPPDGSMELMKYHVRDNINLPFKVTPIVTHSTRDNEIDYRI 360

Query: 361 TLKSLFPGKLSAKDVTLHIPVPPSTVDCKISVSNGHCKFVPEENAMMWRFNKYNGLTENT 420
           TLKSLFPGKLSAKDV LHIPVPPSTVDCKISVSNGHCKFVPEENAM+WRFNKYNGLTENT
Sbjct: 361 TLKSLFPGKLSAKDVVLHIPVPPSTVDCKISVSNGHCKFVPEENAMIWRFNKYNGLTENT 420

Query: 421 LSAVTVSTSDTTQLNLQQWTRPPMSLDFEVMMFSNSGLVVRYFTIFGKDSKHRAVKWIKY 480
           LSAVTVSTSDTTQLNLQQWTRPP+SL+FEVMMFSNSGLVVRYFTI GKDSKHRAVKWIKY
Sbjct: 421 LSAVTVSTSDTTQLNLQQWTRPPISLEFEVMMFSNSGLVVRYFTISGKDSKHRAVKWIKY 480

Query: 481 ISRSGSYEVRY 491
           IS++GSYEVRY
Sbjct: 481 ISKAGSYEVRY 491

>Skud_15.91 Chr15 complement(169608..171083) [1476 bp, 491 aa] {ON}
           YOL062C (REAL)
          Length = 491

 Score =  887 bits (2293), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/491 (86%), Positives = 446/491 (90%)

Query: 1   MISGVLIYSSRGELVLNKFFKNSLKRSISDIFRVQVINNLDVRSPVLTLGSTTFHHIRSR 60
           MISGVL+YSSRGEL+LNKFFKNSLKRSISDIFRVQVINNLDVRSPVLTLGSTTFHHIRS+
Sbjct: 1   MISGVLVYSSRGELILNKFFKNSLKRSISDIFRVQVINNLDVRSPVLTLGSTTFHHIRSK 60

Query: 61  HGDNLWLVTITRSNANSAAIWEFLYKLDFVMNAYRLDREEALKEEFMIVHEMLDIMLGGN 120
           HGDNLWLVTITRSNANSAAIWEFLYKLD VMNAYRLDREEALKEEFMIVHEMLDIMLGGN
Sbjct: 61  HGDNLWLVTITRSNANSAAIWEFLYKLDAVMNAYRLDREEALKEEFMIVHEMLDIMLGGN 120

Query: 121 GIPIDTELNSVIAQMSVKPVRNTGGLLDSPDGNDMLXXXXXXXXXXGEXXXXXXXXXXXX 180
           GIPIDTELNSV+A+MSVKP+RNTGGLLD  DG+D+L          GE            
Sbjct: 121 GIPIDTELNSVVARMSVKPMRNTGGLLDGADGSDILSSSSSPSSAGGELHFPKFLKKSSS 180

Query: 181 XXXGQGDSASDFYDGNKITWRPKGITHKKDEVFLYVNERMNILVSRDGSILKSYVDGTID 240
              GQGDS SDFYD NKITWR  GI HKKDEVFLYVNERMNILVSRDGSILKSYVDGTID
Sbjct: 181 SFLGQGDSTSDFYDSNKITWRATGIIHKKDEVFLYVNERMNILVSRDGSILKSYVDGTID 240

Query: 241 ITTHLSGTPICRFGLNDSLGMQSEDEKKWLAQQQHHSRGNFESKNFIHKAAAGSVLLEDC 300
           I THL+GTP+CRFGLNDSLGMQSEDEK WLAQQ  HSR +F +KNF+ KAAAGSVLLEDC
Sbjct: 241 IVTHLNGTPVCRFGLNDSLGMQSEDEKNWLAQQHQHSRSDFGNKNFLPKAAAGSVLLEDC 300

Query: 301 KFHECVSLDKFNKNHTIEFVPPDGSMELMKYHVRDNINLPFKITPIVTHSTRDNEIDYRI 360
           KFHECVS++KFNKNH IEF+PPDGSMELMKYHVRDNINLPFKITPIV+HSTRDNEIDYRI
Sbjct: 301 KFHECVSIEKFNKNHIIEFIPPDGSMELMKYHVRDNINLPFKITPIVSHSTRDNEIDYRI 360

Query: 361 TLKSLFPGKLSAKDVTLHIPVPPSTVDCKISVSNGHCKFVPEENAMMWRFNKYNGLTENT 420
           TLKSLFPGKLSAKDV LHIPVPPSTVDCKISVSNGHCKFVPEENAM+WRFNKYNGLTENT
Sbjct: 361 TLKSLFPGKLSAKDVILHIPVPPSTVDCKISVSNGHCKFVPEENAMIWRFNKYNGLTENT 420

Query: 421 LSAVTVSTSDTTQLNLQQWTRPPMSLDFEVMMFSNSGLVVRYFTIFGKDSKHRAVKWIKY 480
           LSA TVSTSDTTQL+ QQWTRPPMSLDFEVMMFSNSGLVVRYFTI GKDSKHRAVKWIKY
Sbjct: 421 LSAATVSTSDTTQLSFQQWTRPPMSLDFEVMMFSNSGLVVRYFTISGKDSKHRAVKWIKY 480

Query: 481 ISRSGSYEVRY 491
           IS+SGSYEVRY
Sbjct: 481 ISKSGSYEVRY 491

>Suva_15.103 Chr15 complement(183026..184501) [1476 bp, 491 aa] {ON}
           YOL062C (REAL)
          Length = 491

 Score =  875 bits (2262), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/491 (86%), Positives = 441/491 (89%)

Query: 1   MISGVLIYSSRGELVLNKFFKNSLKRSISDIFRVQVINNLDVRSPVLTLGSTTFHHIRSR 60
           MISGVL+YSSRGEL+LNKFFKNSLKRSISDIFRVQVINNLDVRSPVLTLGSTTFHHIRS 
Sbjct: 1   MISGVLVYSSRGELILNKFFKNSLKRSISDIFRVQVINNLDVRSPVLTLGSTTFHHIRSM 60

Query: 61  HGDNLWLVTITRSNANSAAIWEFLYKLDFVMNAYRLDREEALKEEFMIVHEMLDIMLGGN 120
            GDNLWLVTITRSNANSAAIWEFLYKLD VMNAYRLDREEALKEEFMIVHEMLDIMLGGN
Sbjct: 61  RGDNLWLVTITRSNANSAAIWEFLYKLDSVMNAYRLDREEALKEEFMIVHEMLDIMLGGN 120

Query: 121 GIPIDTELNSVIAQMSVKPVRNTGGLLDSPDGNDMLXXXXXXXXXXGEXXXXXXXXXXXX 180
           GIPIDTELNSVIAQMSVKP+RN GGLL+SPD  DML          GE            
Sbjct: 121 GIPIDTELNSVIAQMSVKPIRNVGGLLESPDSIDMLSSTSSPSSVGGELHFPKFLKKRSS 180

Query: 181 XXXGQGDSASDFYDGNKITWRPKGITHKKDEVFLYVNERMNILVSRDGSILKSYVDGTID 240
              GQGDS SDF DGNKI WRPKGI HKKDEVFLYVNERMNILVSRDGSILKSYVDGTID
Sbjct: 181 SFLGQGDSHSDFSDGNKIAWRPKGIIHKKDEVFLYVNERMNILVSRDGSILKSYVDGTID 240

Query: 241 ITTHLSGTPICRFGLNDSLGMQSEDEKKWLAQQQHHSRGNFESKNFIHKAAAGSVLLEDC 300
           ITTHLSGTP+CRFGLNDSLGMQSED++ WL+QQ  HS   FE+KN   KAAAGSVLLEDC
Sbjct: 241 ITTHLSGTPVCRFGLNDSLGMQSEDQENWLSQQDQHSHNGFENKNCFPKAAAGSVLLEDC 300

Query: 301 KFHECVSLDKFNKNHTIEFVPPDGSMELMKYHVRDNINLPFKITPIVTHSTRDNEIDYRI 360
           KFHECVS+DKFNKNH IEFVPPDGSMELMKYHVRDNINLPFKITPIV HS RDNE+DYRI
Sbjct: 301 KFHECVSIDKFNKNHIIEFVPPDGSMELMKYHVRDNINLPFKITPIVAHSARDNEVDYRI 360

Query: 361 TLKSLFPGKLSAKDVTLHIPVPPSTVDCKISVSNGHCKFVPEENAMMWRFNKYNGLTENT 420
           TLKSLFPGKLSAKDV LHIPVPPSTVDCKISVSNG+CKFVPEENAM+WRFNK+NGLTENT
Sbjct: 361 TLKSLFPGKLSAKDVILHIPVPPSTVDCKISVSNGNCKFVPEENAMIWRFNKFNGLTENT 420

Query: 421 LSAVTVSTSDTTQLNLQQWTRPPMSLDFEVMMFSNSGLVVRYFTIFGKDSKHRAVKWIKY 480
           LSAVTVSTSDTTQL+LQQWTRPPMSLDFEVMMFSNSGLVVRYFTI  +DSKHRAVKWIKY
Sbjct: 421 LSAVTVSTSDTTQLSLQQWTRPPMSLDFEVMMFSNSGLVVRYFTISSRDSKHRAVKWIKY 480

Query: 481 ISRSGSYEVRY 491
           IS+SGSYEVRY
Sbjct: 481 ISKSGSYEVRY 491

>ZYRO0B04840g Chr2 (389669..391099) [1431 bp, 476 aa] {ON} highly
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit
          Length = 476

 Score =  640 bits (1650), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/491 (64%), Positives = 378/491 (76%), Gaps = 15/491 (3%)

Query: 1   MISGVLIYSSRGELVLNKFFKNSLKRSISDIFRVQVINNLDVRSPVLTLGSTTFHHIRSR 60
           MI+ + IYS+RGEL+++K F NSLKRSISDIFR+QVINNLDVRSP+LTLGSTTFHHIRS 
Sbjct: 1   MINAIFIYSTRGELIVSKLFNNSLKRSISDIFRIQVINNLDVRSPILTLGSTTFHHIRSN 60

Query: 61  HGDNLWLVTITRSNANSAAIWEFLYKLDFVMNAYRLDREEALKEEFMIVHEMLDIMLGGN 120
             D+LW+VT++R+NANS AIWEFLYK + +++AY L +EE LKE+FMI +E+LD+++G  
Sbjct: 61  GSDSLWIVTVSRTNANSGAIWEFLYKFNAILDAYDLTKEEKLKEDFMICYEILDVVIGAG 120

Query: 121 GIPIDTELNSVIAQMSVKPVRNTGGLLDSPDGNDMLXXXXXXXXXXGEXXXXXXXXXXXX 180
           GIP+DTEL S+ +++SVKP + +GG    P  + +                         
Sbjct: 121 GIPMDTELGSIASKISVKPPK-SGGTSSEPKSSTVANFPGSNLSTSNLSMPKFLTRNNRS 179

Query: 181 XXXGQGDSASDFYDGNKITWRPKGITHKKDEVFLYVNERMNILVSRDGSILKSYVDGTID 240
                G +    Y  N   WRP GI +KK+EVFLYVNE++NILVSRDGSILK+YVDGTID
Sbjct: 180 MSQDLGTN----YPSN-FPWRPNGIKYKKNEVFLYVNEKINILVSRDGSILKAYVDGTID 234

Query: 241 ITTHLSGTPICRFGLNDSLGMQSEDEKKWLAQQQHHSRGNFESKNFIHKAAAGSVLLEDC 300
           +TTHLSGTPIC+FGLNDS  ++  D   WL  Q+ H+      K  + KAAAGSV+LEDC
Sbjct: 235 MTTHLSGTPICQFGLNDSPSVEFGDSL-WLDTQEFHN------KKAVPKAAAGSVMLEDC 287

Query: 301 KFHECVSLDKFNKNHTIEFVPPDGSMELMKYHVRDNINLPFKITPIVTHSTRDNEIDYRI 360
           KFH+CVSLDKFNK   I+FVPPDG+MELMKY VRDN+NLPFKITP+VT     + ++YRI
Sbjct: 288 KFHQCVSLDKFNKERIIKFVPPDGNMELMKYCVRDNLNLPFKITPVVTPC--GSTVEYRI 345

Query: 361 TLKSLFPGKLSAKDVTLHIPVPPSTVDCKISVSNGHCKFVPEENAMMWRFNKYNGLTENT 420
           TLKSLFP KLSAKDV LHIPVPP TVDCKI++SNG CKF  EENAM+WRFNKY+GLTENT
Sbjct: 346 TLKSLFPNKLSAKDVALHIPVPPGTVDCKINISNGKCKFESEENAMVWRFNKYHGLTENT 405

Query: 421 LSAVTVSTSDTTQLNLQQWTRPPMSLDFEVMMFSNSGLVVRYFTIFGKDSKHRAVKWIKY 480
           LSAVTV TSDTTQL LQQW RPPMSL FE+MMFSNSGLVVRYF +  KD K+R VKWIKY
Sbjct: 406 LSAVTVPTSDTTQLTLQQWPRPPMSLGFEIMMFSNSGLVVRYFRVSDKDEKYRVVKWIKY 465

Query: 481 ISRSGSYEVRY 491
           IS+SGSYEVRY
Sbjct: 466 ISKSGSYEVRY 476

>TDEL0D04580 Chr4 (840369..841817) [1449 bp, 482 aa] {ON} Anc_3.165
           YOL062C
          Length = 482

 Score =  639 bits (1648), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/492 (64%), Positives = 382/492 (77%), Gaps = 11/492 (2%)

Query: 1   MISGVLIYSSRGELVLNKFFKNSLKRSISDIFRVQVINNLDVRSPVLTLGSTTFHHIRSR 60
           MIS +LI+SSRGEL++ K  K+SLK+SISDIFR+QVINNLDVRSP+LTLGSTTFHHIRS 
Sbjct: 1   MISAILIFSSRGELIVAKTMKSSLKKSISDIFRIQVINNLDVRSPILTLGSTTFHHIRSD 60

Query: 61  HGDNLWLVTITRSNANSAAIWEFLYKLDFVMNAYRLDREEALKEEFMIVHEMLDIMLGGN 120
             D+LWLV ++RSNANS AIWEFLYKL+ +M+ Y L +E  LKE FM  +E+LD +L   
Sbjct: 61  GSDSLWLVAVSRSNANSGAIWEFLYKLNVIMDVYGLTKEGTLKENFMNCYEILDTVLEEG 120

Query: 121 GIPIDTELNSVIAQMSVKPVRN-TGGLLDSPDGNDMLXXXXXXXXXXGEXXXXXXXXXXX 179
           GIP+DTELNSVI++M+VKP +  +G LLD PD   M                        
Sbjct: 121 GIPVDTELNSVISKMTVKPPKQISGNLLDRPDLLTMSSLNLSTPGDSSSTLSMPKFLTRN 180

Query: 180 XXXXGQGDSASDFYDGNKITWRPKGITHKKDEVFLYVNERMNILVSRDGSILKSYVDGTI 239
                Q D  S++   + ++WRP GI +KK+EV L VNE+++ILVSRDGSILKSYVDGTI
Sbjct: 181 NRSMSQ-DLGSNY--PSNLSWRPHGIKYKKNEVLLNVNEKISILVSRDGSILKSYVDGTI 237

Query: 240 DITTHLSGTPICRFGLNDSLGMQSEDEKKWLAQQQHHSRGNFESKNFIHKAAAGSVLLED 299
           D+TTHLSG PIC+FGLNDSL ++  D+   +++ +     +F +K  I KAAAG V+LED
Sbjct: 238 DLTTHLSGMPICQFGLNDSLSVEFGDDS--ISEVE-----DFANKKAIPKAAAGRVMLED 290

Query: 300 CKFHECVSLDKFNKNHTIEFVPPDGSMELMKYHVRDNINLPFKITPIVTHSTRDNEIDYR 359
           CKFH+CVSLDKFNK+  I+FVPPDGSMELMKY VRDN+NLPFK+TPIVT   R N IDYR
Sbjct: 291 CKFHQCVSLDKFNKDRVIKFVPPDGSMELMKYCVRDNLNLPFKVTPIVTSIGRGNTIDYR 350

Query: 360 ITLKSLFPGKLSAKDVTLHIPVPPSTVDCKISVSNGHCKFVPEENAMMWRFNKYNGLTEN 419
           +TLKSLFPGKLSAKDV+L IPVPP TVDC+I+VSNG CKFVPEE+AM+W+F KY GLTEN
Sbjct: 351 VTLKSLFPGKLSAKDVSLRIPVPPGTVDCEINVSNGKCKFVPEESAMIWKFTKYTGLTEN 410

Query: 420 TLSAVTVSTSDTTQLNLQQWTRPPMSLDFEVMMFSNSGLVVRYFTIFGKDSKHRAVKWIK 479
           TLSAVTV +SDTTQL +QQW RPPMSL+FE+MMFSNSGLVVRYF +  KD ++R  KWIK
Sbjct: 411 TLSAVTVPSSDTTQLTVQQWPRPPMSLNFEIMMFSNSGLVVRYFKVSDKDERYRTAKWIK 470

Query: 480 YISRSGSYEVRY 491
           YIS+SGSYE+RY
Sbjct: 471 YISKSGSYEIRY 482

>NCAS0C03580 Chr3 complement(715761..717236) [1476 bp, 491 aa] {ON}
           Anc_3.165
          Length = 491

 Score =  629 bits (1621), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/503 (61%), Positives = 392/503 (77%), Gaps = 24/503 (4%)

Query: 1   MISGVLIYSSRGELVLNKFFKNSLKRSISDIFRVQVINNLDVRSPVLTLGSTTFHHIRSR 60
           MI+ +LI+++RGELV++K FK S+KRSI+DIFR+QVINNLDVRSP+LTLGSTTFHHI+S 
Sbjct: 1   MINALLIFTARGELVVSKLFKGSMKRSIADIFRIQVINNLDVRSPILTLGSTTFHHIKST 60

Query: 61  HGDNLWLVTITRSNANSAAIWEFLYKLDFVMNAYRLDREEALKEEFMIVHEMLDIML-GG 119
            GDNLW+V ++R+N +SAAIWEFLYKLD ++++Y L+ EE LKEEFMIVHE+LD+M+ G 
Sbjct: 61  RGDNLWIVAVSRNNVDSAAIWEFLYKLDSLLDSYGLNHEEYLKEEFMIVHELLDVMMCGS 120

Query: 120 NGIPIDTELNSVIAQMSVKPVRNTGGLLDSPDGNDMLXXXXXXXXXXGEXXXXXXXXXXX 179
            GIP+ TE + VI++MSVKP ++            +L                       
Sbjct: 121 GGIPMLTENSLVISRMSVKPSKS------------ILEAQNSGNGSSNTNSNNNNNNVPD 168

Query: 180 XXXXG----QGDSASDFYDGNKIT---WRPKGITHKKDEVFLYVNERMNILVSRDGSILK 232
               G    + +SAS   D + +T   WRPKGI HKK+EV L+VNER+NILVS+DGS+LK
Sbjct: 169 LLMSGPKLLRRNSASLSQDLSILTDFKWRPKGIVHKKNEVILHVNERINILVSKDGSVLK 228

Query: 233 SYVDGTIDITTHLSGTPICRFGLNDSLGMQSEDEKKWLAQQQHHSRG--NFES--KNFIH 288
           +YVDG+ID+ THLSGTPIC+FGLNDSL +   D   + +   +H  G  NF+   K  + 
Sbjct: 229 AYVDGSIDLETHLSGTPICQFGLNDSLSVSGVDSDMYGSHNHNHHFGDVNFDKTDKKQLS 288

Query: 289 KAAAGSVLLEDCKFHECVSLDKFNKNHTIEFVPPDGSMELMKYHVRDNINLPFKITPIVT 348
            A+ GSV+LEDCKFH+CVSLDKF+K+  I+FVPPDGSMELMKYHVRDN+NLPFK++PIVT
Sbjct: 289 MASVGSVILEDCKFHQCVSLDKFDKDRIIKFVPPDGSMELMKYHVRDNLNLPFKVSPIVT 348

Query: 349 HSTRDNEIDYRITLKSLFPGKLSAKDVTLHIPVPPSTVDCKISVSNGHCKFVPEENAMMW 408
           ++     ++YRIT+KSLFPG+LSAK+V LHIPVPP+T+DCKI+V+NG CKF+PEE+AM+W
Sbjct: 349 NTRNGTALEYRITMKSLFPGRLSAKNVALHIPVPPNTMDCKINVTNGSCKFIPEESAMIW 408

Query: 409 RFNKYNGLTENTLSAVTVSTSDTTQLNLQQWTRPPMSLDFEVMMFSNSGLVVRYFTIFGK 468
           RFNK+NGLTENTLSAVT+ T D TQL+LQQW++PPMSLDFE++MFSNSGLVVRYFTI  +
Sbjct: 409 RFNKFNGLTENTLSAVTIPTKDNTQLSLQQWSKPPMSLDFEILMFSNSGLVVRYFTITER 468

Query: 469 DSKHRAVKWIKYISRSGSYEVRY 491
           D K++AVKWIKYISRSGSYE+RY
Sbjct: 469 DQKYKAVKWIKYISRSGSYEIRY 491

>CAGL0C05203g Chr3 (496561..497988) [1428 bp, 475 aa] {ON} highly
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062c APM4
          Length = 475

 Score =  627 bits (1618), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/492 (60%), Positives = 378/492 (76%), Gaps = 18/492 (3%)

Query: 1   MISGVLIYSSRGELVLNKFFKNSLKRSISDIFRVQVINNLDVRSPVLTLGSTTFHHIRSR 60
           MIS VL++SSRGEL+++KFFKN+LKRSISDIFR+QVINNLDVRSP+LTLGSTTF HIRS 
Sbjct: 1   MISAVLVFSSRGELIVSKFFKNNLKRSISDIFRIQVINNLDVRSPILTLGSTTFQHIRSN 60

Query: 61  -HGDNLWLVTITRSNANSAAIWEFLYKLDFVMNAYRLDREEALKEEFMIVHEMLDIMLGG 119
            HGD+LWLV++TRSN N  A+WEFLYK D ++  Y L+ EE LKEEFM+ +E+LD+MLG 
Sbjct: 61  VHGDDLWLVSVTRSNINCGAVWEFLYKFDHMLELYGLNNEEFLKEEFMVCYELLDVMLGE 120

Query: 120 NGIPIDTELNSVIAQMSVKPVRNTGGLLDSPDGNDMLXXXXXXXXXXGEXXXXXXXXXXX 179
           NG P+DT+  +VI +MSVKP + T          +             +           
Sbjct: 121 NGTPMDTDPATVIKKMSVKPSKETI--------ENFAISVQNKNSTLPKIPKFLRRTSSF 172

Query: 180 XXXXGQGDSASDFYDGNKITWRPKGITHKKDEVFLYVNERMNILVSRDGSILKSYVDGTI 239
                  +S+  F    ++ WRPKGI+HKK+E+FLYVNE+++ILVS++GSILKSYVDGTI
Sbjct: 173 LNQESSNNSSGAFNMAGELPWRPKGISHKKNEIFLYVNEKISILVSKEGSILKSYVDGTI 232

Query: 240 DITTHLSGTPICRFGLNDSLGMQSEDEKKWLAQQQHHSRGNFESKNFIHKAAAGSVLLED 299
           D+ THLSGTP+C+FGLNDSL ++++D           S    ++K  I KAAAGSVLLED
Sbjct: 233 DLVTHLSGTPVCQFGLNDSLSVKNDD--------YGDSFDYIKNKKAIPKAAAGSVLLED 284

Query: 300 CKFHECVSLDKFNKNHTIEFVPPDGSMELMKYHVRDNINLPFKITPIVTHSTRDNEIDYR 359
           CKFH+CVSL+KF+K+  I+FVPPDGSMELMKYHVR NINLPFK++PIVT+S+    ++YR
Sbjct: 285 CKFHQCVSLEKFDKDRIIKFVPPDGSMELMKYHVRSNINLPFKVSPIVTYSSSGTAVEYR 344

Query: 360 ITLKSLFPGKLSAKDVTLHIPVPPSTVDCKISVSNGHCKFVPEENAMMWRFNKYNGLTEN 419
           ITLKSLFP KL+AK+VT+ IPVPP T+DCKI VSNG CKF PEE AM+W FNKYNGLTEN
Sbjct: 345 ITLKSLFPSKLTAKNVTMKIPVPPETLDCKIDVSNGSCKFAPEEKAMLWTFNKYNGLTEN 404

Query: 420 TLSAVTVSTSDTTQLNLQQWTRPPMSLDFEVMMFSNSGLVVRYFTIFGKDSKHRAVKWIK 479
           TLSAVT+++ D  +LN+QQW +PP+SLDFE+MMFSNSGLVVRYFTI  +  +++ VKWI+
Sbjct: 405 TLSAVTITSKDAPRLNIQQWQKPPISLDFEIMMFSNSGLVVRYFTI-KESERYKTVKWIR 463

Query: 480 YISRSGSYEVRY 491
           Y+S+SGSYE+RY
Sbjct: 464 YVSKSGSYEIRY 475

>NDAI0G02920 Chr7 complement(676413..677873) [1461 bp, 486 aa] {ON}
           Anc_3.165
          Length = 486

 Score =  621 bits (1601), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/504 (61%), Positives = 377/504 (74%), Gaps = 31/504 (6%)

Query: 1   MISGVLIYSSRGELVLNKFFKNSLKRSISDIFRVQVINNLDVRSPVLTLGSTTFHHIRS- 59
           MI+G+LIYS RGEL+++K FK +LKRSI+DIFR+QVINNLDVRSP+LTLGSTTFHHIRS 
Sbjct: 1   MINGILIYSPRGELIVSKLFKGTLKRSIADIFRIQVINNLDVRSPILTLGSTTFHHIRSS 60

Query: 60  RHGDNLWLVTITRSNANSAAIWEFLYKLDFVMNAYRLDREEALKEEFMIVHEMLDIMLGG 119
           +  DNLWLV  TR+NANSAAIWEFLYKLD ++  Y L++EE LKEEFMIVHE+LD+MLG 
Sbjct: 61  KDSDNLWLVAATRNNANSAAIWEFLYKLDSMLIEYGLNKEEYLKEEFMIVHELLDVMLGS 120

Query: 120 NGIPIDTELNSVIAQMSVKPVR----NTGGLLDSPDGNDMLXXXXXXXXXXGEXXXXXXX 175
            GIP++TE + VIA+MSVKP +    NT  LLD   G+             G        
Sbjct: 121 CGIPLETEPSKVIAKMSVKPAKLHHNNTSSLLDGHLGSK------------GNNEISMPK 168

Query: 176 XXXXXXXXGQGDSASDFYDGNKITWRPKGITHKKDEVFLYVNERMNILVSRDGSILKSYV 235
                      DS   F   N  +WRPK I HKK+EV L+VNE++NILV++DGSILK+YV
Sbjct: 169 FLKRNDSSQSHDSNFSF---NDFSWRPKDIKHKKNEVILHVNEKINILVAKDGSILKAYV 225

Query: 236 DGTIDITTHLSGTPICRFGLNDSLGMQSEDEKKWLAQQQHHSRGNFESK--------NFI 287
           DG+ID+ T LSGTP+C+FGLNDSL + S D +      ++   GN +S           +
Sbjct: 226 DGSIDLQTRLSGTPVCQFGLNDSLTLGSNDSE---YSSRNGRTGNNKSSMLDSNLSNKVL 282

Query: 288 HKAAAGSVLLEDCKFHECVSLDKFNKNHTIEFVPPDGSMELMKYHVRDNINLPFKITPIV 347
            KA+ G+V+LEDCKFH+CVSLDKF++   I+FVPPDGS+ELMKYH+R+N+NLPFKITPIV
Sbjct: 283 SKASVGNVILEDCKFHQCVSLDKFDRERIIKFVPPDGSVELMKYHIRNNLNLPFKITPIV 342

Query: 348 THSTRDNEIDYRITLKSLFPGKLSAKDVTLHIPVPPSTVDCKISVSNGHCKFVPEENAMM 407
           T+S   + +DYRI LKSLFPG+LSAK V LHIPVPP  +DC ISVSNG CKFVP ENAM+
Sbjct: 343 TNSVTGDALDYRIALKSLFPGRLSAKGVVLHIPVPPGVMDCNISVSNGTCKFVPAENAMV 402

Query: 408 WRFNKYNGLTENTLSAVTVSTSDTTQLNLQQWTRPPMSLDFEVMMFSNSGLVVRYFTIFG 467
           W+FNKYNGLTENTLSAVTV + +  Q  LQQW RPPMSLDFE++MFSNSGLVVRYFTI  
Sbjct: 403 WKFNKYNGLTENTLSAVTVPSKEVNQTTLQQWARPPMSLDFEILMFSNSGLVVRYFTISE 462

Query: 468 KDSKHRAVKWIKYISRSGSYEVRY 491
               ++AVKWIKY+S+SGSYEVR+
Sbjct: 463 GHQNYKAVKWIKYVSKSGSYEVRF 486

>Kpol_1045.44 s1045 complement(103089..104498) [1410 bp, 469 aa]
           {ON} complement(103091..104500) [1410 nt, 470 aa]
          Length = 469

 Score =  600 bits (1547), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/491 (60%), Positives = 364/491 (74%), Gaps = 22/491 (4%)

Query: 1   MISGVLIYSSRGELVLNKFFKNSLKRSISDIFRVQVINNLDVRSPVLTLGSTTFHHIRSR 60
           MI+GVL+Y+ +GEL+++KF K++ KRSISDIFRVQVINNLDVRSP+LTLGSTTFHHIRS 
Sbjct: 1   MINGVLVYTGKGELIVSKFSKSNAKRSISDIFRVQVINNLDVRSPILTLGSTTFHHIRSN 60

Query: 61  HGDNLWLVTITRSNANSAAIWEFLYKLDFVMNAYRLDREEALKEEFMIVHEMLDIMLGGN 120
             D+LWLV +TRSNANS AIWEFLYK D ++NA+ LD E  LKEEFM  +E+LD+ML  +
Sbjct: 61  SRDHLWLVAVTRSNANSGAIWEFLYKFDSLLNAFGLDNETTLKEEFMTCYELLDLMLNVD 120

Query: 121 GIPIDTELNSVIAQMSVKPVRNTGGLLDSPDGNDMLXXXXXXXXXXGEXXXXXXXXXXXX 180
           G+P+DTEL+SV A+MS KP+ +          N                           
Sbjct: 121 GVPLDTELSSVSAKMSTKPLHSI---------NSPSDSSLDNSSSPLSISKFLNRNNRSM 171

Query: 181 XXXGQGDSASDFYDGNKITWRPKGITHKKDEVFLYVNERMNILVSRDGSILKSYVDGTID 240
                    S++       WRP GI +KK+E+FL +NE+++ILVS+D +ILK+YVDGT+D
Sbjct: 172 SVDTMNTEPSNY------PWRPNGIKYKKNEIFLNINEKISILVSKDETILKAYVDGTVD 225

Query: 241 ITTHLSGTPICRFGLNDSLGMQSEDEKKWLAQQQHHSRGNFESKNFIHKAAAGSVLLEDC 300
           +T+HLSGTP C+FGLNDSL   S DE  +     +     F ++  I +A AG+V+LEDC
Sbjct: 226 LTSHLSGTPTCQFGLNDSL---SVDEPNYYNSDDN----GFRNQQNIPRATAGTVVLEDC 278

Query: 301 KFHECVSLDKFNKNHTIEFVPPDGSMELMKYHVRDNINLPFKITPIVTHSTRDNEIDYRI 360
           KFHECVSLDKFN++  I+FVPPDG +ELMKYHVRDNINLPFK+TP V +S     +DYRI
Sbjct: 279 KFHECVSLDKFNRDRIIKFVPPDGHIELMKYHVRDNINLPFKVTPNVINSRSRTGLDYRI 338

Query: 361 TLKSLFPGKLSAKDVTLHIPVPPSTVDCKISVSNGHCKFVPEENAMMWRFNKYNGLTENT 420
           TLKSLFP KLSA DV L IPVP STVDCK++VSNG C+FVPEE+ ++W+F KYNGLTEN 
Sbjct: 339 TLKSLFPSKLSANDVVLKIPVPSSTVDCKLNVSNGKCRFVPEESCIIWKFAKYNGLTENK 398

Query: 421 LSAVTVSTSDTTQLNLQQWTRPPMSLDFEVMMFSNSGLVVRYFTIFGKDSKHRAVKWIKY 480
           LSAVTVS++DTTQL LQQW RPP+SLDFE+MMFSNSGLVVRY  I  KD K+R VKWIKY
Sbjct: 399 LSAVTVSSNDTTQLMLQQWARPPISLDFEIMMFSNSGLVVRYLKIMEKDQKYRTVKWIKY 458

Query: 481 ISRSGSYEVRY 491
           ISRSGSYEVRY
Sbjct: 459 ISRSGSYEVRY 469

>SAKL0C07414g Chr3 complement(683859..685307) [1449 bp, 482 aa] {ON}
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit
          Length = 482

 Score =  574 bits (1480), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/491 (56%), Positives = 363/491 (73%), Gaps = 9/491 (1%)

Query: 1   MISGVLIYSSRGELVLNKFFKNSLKRSISDIFRVQVINNLDVRSPVLTLGSTTFHHIRSR 60
           M++ + ++S +GELV++K  ++++KRS+++IFR+QVINNLDVRSPVLTLGSTTFHHIRS 
Sbjct: 1   MLNALFVFSQKGELVVSKLIRDTIKRSVAEIFRIQVINNLDVRSPVLTLGSTTFHHIRS- 59

Query: 61  HGDNLWLVTITRSNANSAAIWEFLYKLDFVMNAYRLDREEALKEEFMIVHEMLDIMLGGN 120
              NLW+V +TRSNA+SAAIWEFLYK + ++ AY L+ EE+LKEEFM  +E+LD++L  N
Sbjct: 60  -SSNLWIVAVTRSNADSAAIWEFLYKFNALLEAYGLNSEESLKEEFMTCYELLDVVLE-N 117

Query: 121 GIPIDTELNSVIAQMSVKPVRNTGGLLDSPDGNDMLXXXXXXXXXXGEXXXXXXXXXXXX 180
           G+P+DTEL+SV ++MS +PV +   L ++P  +++L                        
Sbjct: 118 GVPVDTELSSVASKMSRRPVVS---LENNPLTDELLMSAAANVDLGFRMPKFLNKGSRSS 174

Query: 181 XXXGQGDSASDFYDGNKITWRPKGITHKKDEVFLYVNERMNILVSRDGSILKSYVDGTID 240
                  +  +  D     WR  GI +KK+E+FL VNER+NILVS+DGSILKSYVDG++D
Sbjct: 175 SSVSSPANGDEHGDPCAYPWRSSGIKYKKNEIFLDVNERINILVSKDGSILKSYVDGSVD 234

Query: 241 ITTHLSGTPICRFGLNDSLGMQSEDEKKWLAQQQHHSRGNFESKNFIHKAAAGSVLLEDC 300
           +TTHLSGTP+C+FGLNDSL +      + L      S    ++K  I KAAAGSV LEDC
Sbjct: 235 LTTHLSGTPLCQFGLNDSLSLDGGTLSRDL---DFISEYEVKNKKAIPKAAAGSVQLEDC 291

Query: 301 KFHECVSLDKFNKNHTIEFVPPDGSMELMKYHVRDNINLPFKITPIVTHSTRDNEIDYRI 360
           KFH+CV L++FN +  I FVPPDGS ELM+YHVRDN+NLPFKITPI +  + +  ++YR+
Sbjct: 292 KFHQCVQLNRFNTDRIIRFVPPDGSFELMRYHVRDNLNLPFKITPIFSVRSNNGAVEYRV 351

Query: 361 TLKSLFPGKLSAKDVTLHIPVPPSTVDCKISVSNGHCKFVPEENAMMWRFNKYNGLTENT 420
            LKSLFP KL+AKDV L IPVPP TVDCKI+ SNG C+FVPEENA++W+F KY GLTENT
Sbjct: 352 ALKSLFPSKLTAKDVVLRIPVPPGTVDCKINTSNGRCRFVPEENAVLWKFAKYQGLTENT 411

Query: 421 LSAVTVSTSDTTQLNLQQWTRPPMSLDFEVMMFSNSGLVVRYFTIFGKDSKHRAVKWIKY 480
           LSA+TV   + + LNLQQW+RPPMSL FE++MFSNSGLVVR+F +  +D  +  VKW+KY
Sbjct: 412 LSALTVPMDNQSSLNLQQWSRPPMSLTFEILMFSNSGLVVRFFKVSERDHSYHTVKWVKY 471

Query: 481 ISRSGSYEVRY 491
           ISRSG+YEVRY
Sbjct: 472 ISRSGAYEVRY 482

>KNAG0K01150 Chr11 complement(225095..226519) [1425 bp, 474 aa] {ON}
           Anc_3.165 YOL062C
          Length = 474

 Score =  549 bits (1414), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/495 (55%), Positives = 356/495 (71%), Gaps = 25/495 (5%)

Query: 1   MISGVLIYSSRGELVLNKFFKNSLKRSISDIFRVQVINNLDVRSPVLTLGSTTFHHIRSR 60
           MI+ VL+YS+RGEL+++K FK +LKRS+ DIFRVQVIN+LDVRSP+LTLGSTTFH++R+ 
Sbjct: 1   MINAVLVYSARGELIVSKMFKPTLKRSVGDIFRVQVINSLDVRSPILTLGSTTFHYVRT- 59

Query: 61  HGDNLWLVTITRSNANSAAIWEFLYKLDFVMNAYRLDREEALKEEFMIVHEMLDIMLGGN 120
            G+ LW+V+++R+N NSAA WEFLYK   ++ AYRLD EE LKEEFM+  E+LD M+ G 
Sbjct: 60  PGEGLWVVSVSRNNENSAATWEFLYKFATMLAAYRLDSEEVLKEEFMLAWELLDTMVEGG 119

Query: 121 GIPIDTELNSVIAQMSVKPVRNTGGLLDSPDGNDMLXXXXXXXXXXGEXXXXXXXXXXXX 180
           GIP +T+ + +I+ MSVKP         SP                G             
Sbjct: 120 GIPSETDPHRIISAMSVKPAM-------SPVDVRADARQQQTTTSTGAFGHAFPQLLHRA 172

Query: 181 XXXGQGDSASDFYDGNKITWRPKGITHKKDEVFLYVNERMNILVSRDGSILKSYVDGTID 240
              G G S      G+       G   K++E+ + V E ++ILVS+DGSILK+YVDG ID
Sbjct: 173 SNPG-GISILPHATGD-------GAQLKRNEIVMVVQESISILVSKDGSILKAYVDGGID 224

Query: 241 ITTHLSGTPICRFGLNDSLGMQSEDEKKWLAQQQHHSRG-NFESKNFIHKAAAGSVLLED 299
           +TT L G  +C+FGLNDSL   +    KW   +   ++G N E KN    A  G+VLL D
Sbjct: 225 LTTKLEGAAVCQFGLNDSLSTDNSSNSKWDPLRSKETQGTNLEMKN----AHVGTVLLRD 280

Query: 300 CKFHECVSLDKFNKNHTIEFVPPDGSMELMKYHVRDNINLPFKITPIVTHSTRDNEIDYR 359
           CKFH+CVSL++F+++  I F PP+G++ELMKYHVRDN+NLPFK+T +V   T +NE DYR
Sbjct: 281 CKFHQCVSLERFDRDRIIRFTPPEGTIELMKYHVRDNLNLPFKVTSMVI-PTANNETDYR 339

Query: 360 ITLKSLFPGKLSAKDVTLHIPVPPSTVDCKISVSNGHCKFVPEENAMMWRFNKYNGLTEN 419
           +T+KSLFPGKLSAK+VT+ IPVPP T+DCKI+VSNG+CKF+PEENAM+W+F+KYNGLTEN
Sbjct: 340 VTIKSLFPGKLSAKNVTMRIPVPPGTLDCKINVSNGNCKFLPEENAMVWKFHKYNGLTEN 399

Query: 420 TLSAVTVSTSDTTQLNLQQWTRPPMSLDFEVMMFSNSGLVVRYFTIFGK---DSKHRAVK 476
            LSA+TV T DTTQL LQQW+RPP+SLDFE++M+SN+GLVVRYFT+  K   ++K + VK
Sbjct: 400 KLSAITVPTRDTTQLALQQWSRPPISLDFEILMYSNTGLVVRYFTVLDKHNNNTKFKTVK 459

Query: 477 WIKYISRSGSYEVRY 491
           WIKY+S SGSYEVRY
Sbjct: 460 WIKYVSHSGSYEVRY 474

>KLTH0F06534g Chr6 complement(565211..566611) [1401 bp, 466 aa] {ON}
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit
          Length = 466

 Score =  547 bits (1409), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/505 (55%), Positives = 360/505 (71%), Gaps = 53/505 (10%)

Query: 1   MISGVLIYSSRGELVLNKFFKNSLKRSISDIFRVQVINNLDVRSPVLTLGSTTFHHIRSR 60
           M+S + I+S RGEL+++K  ++S+ +S+S+IFR+QVINNLDVRSPVLTLGSTTFHH++S 
Sbjct: 1   MLSALFIFSLRGELLISKHVRSSVPKSMSEIFRIQVINNLDVRSPVLTLGSTTFHHVKS- 59

Query: 61  HGDNLWLVTITRSNANSAAIWEFLYKLDFVMNAYRLDREEALKEEFMIVHEMLDIMLGGN 120
              NLW+V ++RSNA+SAAIWEFLYKL  ++ A+ L  E  LKE+FM  +E+LDI+L  +
Sbjct: 60  -PGNLWIVAVSRSNADSAAIWEFLYKLSALLEAFGLHSENELKEDFMTCYELLDIVLE-D 117

Query: 121 GIPIDTELNSVIAQMSVKP---VRNTGGLLDSPDG--NDMLXXXXXXXXXXGEXXXXXXX 175
           G+P+DTEL+SV ++MSVKP          ++S +G  N +L                   
Sbjct: 118 GVPVDTELSSVASKMSVKPSASAERINTFIESGNGGTNRILPVAQFLRAR---------- 167

Query: 176 XXXXXXXXGQGDSASDFYDG-----NKITWRPKGITHKKDEVFLYVNERMNILVSRDGSI 230
                       S+S+ +D      + I WR  GI +KK+EVFL VNER++ILVS+DGSI
Sbjct: 168 -----------SSSSNLHDSHSKVPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSI 216

Query: 231 LKSYVDGTIDITTHLSGTPICRFGLNDSLGMQSEDEKKWLAQQQHHSRGNFES----KNF 286
           LKSYVDGT++ TTHLSG P+CRFGLNDSL + +               G+ ES    K  
Sbjct: 217 LKSYVDGTVEATTHLSGMPVCRFGLNDSLSVSTP-------------FGDNESPTTNKKA 263

Query: 287 IHKAAAGSVLLEDCKFHECVSLDKFNKNHTIEFVPPDGSMELMKYHVRDNINLPFKITPI 346
           I KAAAGSV+LEDCKFH+CV LDKF    TI F+PPDGS ELMKYHVR+N+NLPFKITP+
Sbjct: 264 IPKAAAGSVMLEDCKFHQCVQLDKFQSERTINFIPPDGSFELMKYHVRENLNLPFKITPV 323

Query: 347 VTHSTRDNEIDYRITLKSLFPGKLSAKDVTLHIPVPPSTVDCKISVSNGHCKFVPEENAM 406
           VT   + N IDYR+T+KSLFP KL+AKDV L IPVPP TVDC IS SNG CKFVPEE+A+
Sbjct: 324 VTL-FKANSIDYRVTIKSLFPSKLTAKDVQLRIPVPPETVDCHISTSNGRCKFVPEESAI 382

Query: 407 MWRFNKYNGLTENTLSAVTVSTSDTTQLNLQQWTRPPMSLDFEVMMFSNSGLVVRYFTIF 466
           +W+F+KY GLTEN+LSA  V   D+  LN+ QW++PPMSL FE++MFSNSGLVVR+F + 
Sbjct: 383 IWKFSKYQGLTENSLSATAVPMKDSA-LNIDQWSKPPMSLKFEIVMFSNSGLVVRFFDVS 441

Query: 467 GKDSKHRAVKWIKYISRSGSYEVRY 491
             D  ++ VKWIKY+S+SG+YEVRY
Sbjct: 442 EGDRNYKMVKWIKYLSKSGAYEVRY 466

>Kwal_33.14182 s33 complement(560456..561859) [1404 bp, 467 aa] {ON}
           YOL062C (APM4) - Clathrin associated protein, medium
           subunit [contig 105] FULL
          Length = 467

 Score =  546 bits (1406), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/496 (56%), Positives = 359/496 (72%), Gaps = 34/496 (6%)

Query: 1   MISGVLIYSSRGELVLNKFFKNSLKRSISDIFRVQVINNLDVRSPVLTLGSTTFHHIRSR 60
           M++ + IYS RGEL+++K  K S+++S+S+IFR+QVINNLDVRSPVLTLGSTTFHHI+S 
Sbjct: 1   MLNALFIYSLRGELLISKHVKGSVQKSMSEIFRIQVINNLDVRSPVLTLGSTTFHHIKS- 59

Query: 61  HGDNLWLVTITRSNANSAAIWEFLYKLDFVMNAYRLDREEALKEEFMIVHEMLDIMLGGN 120
              NLW+V ++RSNA+SAAIWEFLY+L+ ++ A+ L  E  LKE FMI +E+LDI+L  +
Sbjct: 60  -AKNLWIVAVSRSNADSAAIWEFLYRLNELLEAFNLYSENELKERFMICYELLDIVLE-D 117

Query: 121 GIPIDTELNSVIAQMSVKPVRNTGGLLDSPDGNDMLXXXXXXXXXXGEXXXXXXXXXXXX 180
           G+P+DTEL+SV ++MSVKP  N G      D  +M           G             
Sbjct: 118 GLPVDTELSSVASKMSVKP--NAGV-----DNFNMFAENGH-----GGTNRILPVSQFLR 165

Query: 181 XXXGQG---DSASDFYDGNKITWRPKGITHKKDEVFLYVNERMNILVSRDGSILKSYVDG 237
                G   D AS+    + I WR  GI +KK+EVFL VNER++ILVS+DGSILKSYVDG
Sbjct: 166 GRPSAGNLQDIASE--APSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDG 223

Query: 238 TIDITTHLSGTPICRFGLNDSLGMQSE--DEKKWLAQQQHHSRGNFESKNFIHKAAAGSV 295
           T++ TTHLSG P+CRFGLND+L + +   D+ ++             +K  I KAAAGSV
Sbjct: 224 TVEATTHLSGMPVCRFGLNDALSVSTPFGDDDEY----------QVTNKKAIPKAAAGSV 273

Query: 296 LLEDCKFHECVSLDKFNKNHTIEFVPPDGSMELMKYHVRDNINLPFKITPIVTHSTRDNE 355
           +LEDCKFH+CV LDKF    TI F+ PDGS ELMKYHVR+N+NLPFK+TPIVT   R N 
Sbjct: 274 MLEDCKFHQCVQLDKFQSERTINFIAPDGSFELMKYHVRENLNLPFKVTPIVT-VVRSNS 332

Query: 356 IDYRITLKSLFPGKLSAKDVTLHIPVPPSTVDCKISVSNGHCKFVPEENAMMWRFNKYNG 415
           IDY+IT+KSLFP KL+AKDV L IPVPP TV C IS SNG CKFVPEE+A++W+F+KY G
Sbjct: 333 IDYQITIKSLFPSKLTAKDVQLRIPVPPETVSCHISTSNGKCKFVPEESAIVWKFSKYQG 392

Query: 416 LTENTLSAVTVSTSDTTQLNLQQWTRPPMSLDFEVMMFSNSGLVVRYFTIFGKDSKHRAV 475
           LTEN++SA  V   D+T LN++QW RPP+SL FE++MFSNSGLVVR+F +  +D  ++ V
Sbjct: 393 LTENSISATAVPMKDST-LNIEQWPRPPISLKFEIVMFSNSGLVVRFFNVSERDRNYKMV 451

Query: 476 KWIKYISRSGSYEVRY 491
           KWIKY+S+SG+YEVRY
Sbjct: 452 KWIKYLSKSGAYEVRY 467

>TPHA0P00660 Chr16 (136114..137535) [1422 bp, 473 aa] {ON} Anc_3.165
           YOL062C
          Length = 473

 Score =  520 bits (1338), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 258/494 (52%), Positives = 343/494 (69%), Gaps = 24/494 (4%)

Query: 1   MISGVLIYSSRGELVLNKFFKNSLKRSISDIFRVQVINNLDVRSPVLTLGSTTFHHIRSR 60
           MI+GVLIYSSRG+L++    K+SLKR+ISDIF++QVIN+L+++SP+LTLGSTTFHHIRS 
Sbjct: 1   MINGVLIYSSRGDLIVCDLLKSSLKRTISDIFKIQVINSLEMKSPILTLGSTTFHHIRSS 60

Query: 61  HGDNLWLVTITRSNANSAAIWEFLYKLDFVMNAYRLDREEALKEEFMIVHEMLDIMLGGN 120
               LW+V ITRSNANS  IWEFLYKLD ++ AY L+ EE L E+FM+ +EM+D+ML  N
Sbjct: 61  SESKLWIVAITRSNANSGVIWEFLYKLDSMLTAYDLNNEEKLMEKFMVYYEMIDVMLTSN 120

Query: 121 GIPIDTELNSVIAQMSVK-PVRNTGGLLDSPDGNDMLXXXXXXXXXXGEXXXXXXXXXXX 179
            +PI+TEL+S+ +++S + P   +    +  + N+ L                       
Sbjct: 121 AMPINTELSSIASKISYRLPKTISNSPTNEKNNNNGLSIPKFLTRNSRSMSQEFSNIT-- 178

Query: 180 XXXXGQGDSASDFYDGNKITWRPKGITHKKDEVFLYVNERMNILVSRDGSILKSYVDGTI 239
                Q D          I WRP GI +KK+EVFLYVNE++NILVS+D +ILK+YVDG+I
Sbjct: 179 -----QSD----------IPWRPTGIKYKKNEVFLYVNEKINILVSKDQTILKAYVDGSI 223

Query: 240 DITTHLSGTPICRFGLNDSLGMQSEDEKKWLAQQQHHSRGNFESKNFIH--KAAAGSVLL 297
           D+ +HLSGTPIC+FGLND L M   +    ++ +    R +F     +   ++++ SV +
Sbjct: 224 DLVSHLSGTPICQFGLNDYLSMTGNN----ISNRGDEFRHDFMDDEDLSTGRSSSSSVKI 279

Query: 298 EDCKFHECVSLDKFNKNHTIEFVPPDGSMELMKYHVRDNINLPFKITPIVTHSTRDNEID 357
           EDC FH+CVSLDKFN    I FVPPDGS ELM+YHVRD++N+PFK+TP V+ S+    + 
Sbjct: 280 EDCTFHQCVSLDKFNDERLINFVPPDGSFELMRYHVRDDLNIPFKVTPRVSISSSRCSMR 339

Query: 358 YRITLKSLFPGKLSAKDVTLHIPVPPSTVDCKISVSNGHCKFVPEENAMMWRFNKYNGLT 417
           Y+I LKSLFP  LSA D  L IP+PP TVDCKI+ S+G C F   +N  +W+FNKY GLT
Sbjct: 340 YKIILKSLFPTSLSAADAMLKIPLPPGTVDCKINASSGKCNFSTSDNCAIWKFNKYKGLT 399

Query: 418 ENTLSAVTVSTSDTTQLNLQQWTRPPMSLDFEVMMFSNSGLVVRYFTIFGKDSKHRAVKW 477
           EN L   TV +S T  L+LQQWTRPPMS++FE++MFSNSGLVV+Y  +  +  K+R VKW
Sbjct: 400 ENELILETVPSSSTDILSLQQWTRPPMSMNFEIIMFSNSGLVVKYLKVMERVQKYRPVKW 459

Query: 478 IKYISRSGSYEVRY 491
           IKY+S+SGSYE+RY
Sbjct: 460 IKYVSKSGSYEIRY 473

>TBLA0F00840 Chr6 (213915..215360) [1446 bp, 481 aa] {ON} Anc_3.165
           YOL062C
          Length = 481

 Score =  513 bits (1321), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 249/491 (50%), Positives = 341/491 (69%), Gaps = 10/491 (2%)

Query: 1   MISGVLIYSSRGELVLNKFFKNSLKRSISDIFRVQVINNLDVRSPVLTLGSTTFHHIRSR 60
           MI+ V+I++ RGEL++ K FK+S+KR+ISDIFRVQVINN ++RSP+LTLGSTTFH IR+ 
Sbjct: 1   MINAVMIFTPRGELLVFKVFKSSVKRTISDIFRVQVINNDNIRSPILTLGSTTFHFIRTT 60

Query: 61  HGDNLWLVTITRSNANSAAIWEFLYKLDFVMNAYRLDREEALKEEFMIVHEMLDIMLGGN 120
            G  LWLV +TRSNA+S AIWE+LYKL+ +M  Y L  E+ LK+EF++ HE+LDI LG N
Sbjct: 61  AGSKLWLVAVTRSNADSGAIWEYLYKLNSLMEVYGLTHEDILKDEFIVCHELLDITLGMN 120

Query: 121 GIPIDTELNSVIAQMSVKPVRNTGGLLDSPDGNDMLXXXXXXXXXXGEXXXXXXXXXXXX 180
           G+P+DTEL+SVI +M++KP +    L  S D +D+L                        
Sbjct: 121 GLPMDTELSSVIGKMTLKPAQ---VLTSSADRSDILASSVTTLGHNSTPISMPKFLSRNS 177

Query: 181 XXXGQGDSASDFYDGNKITWRPKGITHKKDEVFLYVNERMNILVSRDGSILKSYVDGTID 240
                 +  S F   N I WR + I +KK+E+ + V E++N+LV +D +IL++YVDGTID
Sbjct: 178 NRSVTQEFESQFSPSN-IPWRSRDIKYKKNEMIVNVIEKINVLVGKDDNILRAYVDGTID 236

Query: 241 ITTHLSGTPICRFGLNDSLGMQSEDEKKWLAQQQHHSRGNFESKNFIHKAAAGSVLLEDC 300
           IT HLSG P+C+ G+ND   +Q  +   W  + +  +R      + +   +   V+LE  
Sbjct: 237 ITAHLSGMPMCQIGMNDLSTIQGGENAHWTNEDRASNR------DAMPDVSGDRVILEGS 290

Query: 301 KFHECVSLDKFNKNHTIEFVPPDGSMELMKYHVRDNINLPFKITPIVTHSTRDNEIDYRI 360
           KFH+CV+LDK+NK++ I F+PPDG  ELMKYHV +N+NLPF+ITP VT ++    + Y I
Sbjct: 291 KFHQCVALDKYNKDNVIWFIPPDGQFELMKYHVSNNLNLPFRITPQVTLTSHGTALSYAI 350

Query: 361 TLKSLFPGKLSAKDVTLHIPVPPSTVDCKISVSNGHCKFVPEENAMMWRFNKYNGLTENT 420
            LKSLFP KLSA++V L IPVPP T+DCKI+ S+G CKF+PEEN M+W F+++NG TEN 
Sbjct: 351 KLKSLFPRKLSAENVVLRIPVPPGTLDCKINASDGKCKFIPEENCMVWSFHRFNGSTENH 410

Query: 421 LSAVTVSTSDTTQLNLQQWTRPPMSLDFEVMMFSNSGLVVRYFTIFGKDSKHRAVKWIKY 480
           L+A TV T      +++QWTRPPMSLDF+V+MFSN+GL+VRY  +  K+  +  +KWIKY
Sbjct: 411 LNAQTVPTQSIASQSIKQWTRPPMSLDFKVLMFSNTGLIVRYLKVQEKNMHYNTIKWIKY 470

Query: 481 ISRSGSYEVRY 491
           IS +GSYEVRY
Sbjct: 471 ISAAGSYEVRY 481

>Ecym_5239 Chr5 complement(492091..493485) [1395 bp, 464 aa] {ON}
           similar to Ashbya gossypii ADR315W
          Length = 464

 Score =  490 bits (1261), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 250/496 (50%), Positives = 338/496 (68%), Gaps = 37/496 (7%)

Query: 1   MISGVLIYSSRGELVLNKFFKNSLKRSISDIFRVQVINNLDVRSPVLTLGSTTFHHIRSR 60
           MIS + +YS RG+L+++K  K+++K  +S+IFR+QVINNLDVRSP+LTLGSTTFHHIRS 
Sbjct: 1   MISALFLYSPRGDLIISKLIKDNIKLGVSEIFRIQVINNLDVRSPILTLGSTTFHHIRSN 60

Query: 61  HGDNLWLVTITRSNANSAAIWEFLYKLDFVMNAYRLDREEALKEEFMIVHEMLDIMLGGN 120
            G  LWLVT++R N +SA IWEFLY  + ++  Y ++ E++L+ +FM+ +E+LDI+L  N
Sbjct: 61  GG--LWLVTVSRGNTDSAGIWEFLYNFNKLLEVYDINSEDSLQGDFMLCYEILDIVLD-N 117

Query: 121 GIPIDTELNSVIAQMSVKPVRNTGGLLDSPDGNDMLXXXXXXXXXXGEXXXXXXXXXXXX 180
           GIP DTEL  ++  +S KP+  +  LL    G+D +          G             
Sbjct: 118 GIPRDTELTHIMPYISKKPL--SENLL----GSDDILNTPSWLVKAG------------- 158

Query: 181 XXXGQGDSASDFYDGNKITWRPKGITHKKDEVFLYVNERMNILVSRDGSILKSYVDGTID 240
              G           +   WR +GI +KK+EV+L V E ++ILV++DG+ILKSYVDG++ 
Sbjct: 159 -ARGMSSENLGLTSKDMCLWRSEGIRYKKNEVYLDVFEHISILVNKDGAILKSYVDGSVQ 217

Query: 241 ITTHLSGTPICRFGLNDSLG----MQSEDEKKWLAQQQHHSRGNFESKNFIHKAAAGSVL 296
              HLSG P+C+FG ND L      QS     W A++++ ++        I  A  GSV+
Sbjct: 218 CVAHLSGMPVCQFGFNDYLSPSSNTQSSGNDGW-AEEENGTKA-------IKNAITGSVI 269

Query: 297 LEDCKFHECVSLDKFNKNHTIEFVPPDGSMELMKYHVRDNINLPFKITPIVTHSTRDNEI 356
           LEDCKFH+CV LDKF++   I FVPPDG  ELMKYHVRDN+NLPFK+TP+VT + +   +
Sbjct: 270 LEDCKFHQCVQLDKFDQERVIRFVPPDGLFELMKYHVRDNLNLPFKVTPMVT-TLKGKSV 328

Query: 357 DYRITLKSLFPGKLSAKDVTLHIPVPPSTVDCKISVSNGHCKFVPEENAMMWRFNKYNGL 416
           +YRITLKSLFP KL AKDV L+IP PP TV+ KI+VS+G  KF+PEENA++W+ +KY+GL
Sbjct: 329 EYRITLKSLFPSKLCAKDVELYIPAPPDTVNAKINVSSGKGKFIPEENAIVWKIHKYHGL 388

Query: 417 TENTLSAVTVSTSD-TTQLNLQQWTRPPMSLDFEVMMFSNSGLVVRYFTIFGKDSKHRAV 475
           TEN  SAV V   +    LNL+QW+RPP+S+ FE+ MFSNSGLVVRY  +  KD  +  V
Sbjct: 389 TENVFSAVIVPMGNGNDSLNLEQWSRPPISVRFEISMFSNSGLVVRYLKVMEKDLNYNTV 448

Query: 476 KWIKYISRSGSYEVRY 491
           KW+KYIS+SG+YEVRY
Sbjct: 449 KWVKYISKSGAYEVRY 464

>KLLA0C03894g Chr3 complement(354889..356316) [1428 bp, 475 aa] {ON}
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit,
          Length = 475

 Score =  454 bits (1169), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 224/494 (45%), Positives = 333/494 (67%), Gaps = 22/494 (4%)

Query: 1   MISGVLIYSSRGELVLNKFFKNSLKRSISDIFRVQVINNLDVRSPVLTLGSTTFHHIRSR 60
           M+S + IY+++G+L+++K  K+ +KRS++D+FR QVIN+  VRSP+LTLGSTTF H+   
Sbjct: 1   MLSAIFIYNAKGDLLISKLIKDHVKRSLADVFRTQVINDPHVRSPILTLGSTTFQHVIRE 60

Query: 61  HGDNL--WLVTITRSNANSAAIWEFLYKLDFVMNAYRLDREEALKEEFMIVHEMLDIMLG 118
             DNL  WLV ++RSN +S+ IWE+L+KL  +M A+ ++ E+ LK+EFM+++E+L++ L 
Sbjct: 61  SSDNLPMWLVAVSRSNVDSSMIWEYLHKLYQLMEAFGINDEDVLKDEFMLLYEILELTLE 120

Query: 119 GNGIPIDTELNSVIAQMSVKPVRNTGGLLDSPDGNDMLXXXXXXXXXXGEXXXXXXXXXX 178
            NGIP  T+L  +I ++S KP+ N   +  SPD +D L                      
Sbjct: 121 -NGIPQTTDLAQIIPRVSRKPIEN-NTISKSPDLDDFLSGSNILKAPK------------ 166

Query: 179 XXXXXGQGDSASDFYDGNKITWRPKGITHKKDEVFLYVNERMNILVSRDGSILKSYVDGT 238
                 +  S+      ++  WRP G+ +KK+EV+L +NE++ ILV +DGSI+KS+VDG+
Sbjct: 167 ---LSKRSSSSIALSSLSECPWRPSGLKYKKNEVYLDINEKITILVGKDGSIVKSFVDGS 223

Query: 239 IDITTHLSGTPICRFGLNDSLGMQSEDEKKWLAQQQHHSRGNFESKNFIHKAAAGSVLLE 298
           +D  +HLSG P+C+ GLND+  +   +EK  L+  +  S  + ++K  I  AAAGSV+LE
Sbjct: 224 VDCVSHLSGMPLCQLGLNDTYSIHG-NEKSELSIVEMMSEYDIKNKKAIPNAAAGSVILE 282

Query: 299 DCKFHECVSLDKFNKNHTIEFVPPDGSMELMKYHVRDNINLPFKITPIVTHSTRDNEIDY 358
           DCKFH+CV L+K+  NH I+FVPPDG  +LM+Y V DNIN+PF + P V    +++ ++Y
Sbjct: 283 DCKFHQCVQLNKYEANHVIQFVPPDGPFQLMQYRVIDNINIPFNVIPEV-EIVKNSTLNY 341

Query: 359 RITLKSLFPGKLSAKDVTLHIPVPPSTVDCKISVSNGHCKFVPEENAMMWRFNKYNGLTE 418
           ++TL+SLFP  +SAKDVT+ IPVPP+T+ C  +VS G CK+   E  M+W++NKY G TE
Sbjct: 342 KVTLRSLFPSNVSAKDVTVKIPVPPTTIKCDFNVSGGKCKYDAGEKCMVWKYNKYKGSTE 401

Query: 419 NTLSA-VTVSTSDTTQLNLQQWTRPPMSLDFEVMMFSNSGLVVRYFTIFGKDSKHRAVKW 477
           NTLS  V +  +     +L +W+RPP+S+ FE++MFSNSGLVVR+         ++ VKW
Sbjct: 402 NTLSGKVAIPATSHDLSDLLRWSRPPISMGFEIVMFSNSGLVVRHLKCQEPQLNYQPVKW 461

Query: 478 IKYISRSGSYEVRY 491
           IKYIS SG+YE+RY
Sbjct: 462 IKYISHSGAYEIRY 475

>KAFR0C01020 Chr3 (208272..209558) [1287 bp, 428 aa] {ON} Anc_3.165
           YOL062C
          Length = 428

 Score =  433 bits (1113), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 236/498 (47%), Positives = 317/498 (63%), Gaps = 77/498 (15%)

Query: 1   MISGVLIYSSRGELVLNKFFKNSLKRSISDIFRVQVINNLDVRSPVLTLGSTTFHHIRSR 60
           MIS +LIY+ RGEL+++K ++N++KRSIS+IFR+QVINN +VRSP+LTLGSTTFHHIRS 
Sbjct: 1   MISAILIYTPRGELIVSKLYRNNIKRSISEIFRIQVINNFNVRSPILTLGSTTFHHIRST 60

Query: 61  HGD----NLWLVTITRSNANSAAIWEFLYKLDFVMNAYRLDREEALKEEFMIVHEMLDIM 116
             D     LWLV + R+NANSAAIWEFL KL+ ++  Y +  E  LK+EFM VHE+LD M
Sbjct: 61  ANDPTDDELWLVCVNRNNANSAAIWEFLQKLNLILQQYGITSESKLKDEFMTVHEILDNM 120

Query: 117 LGGNGIPIDTELNSVIAQMSVKPVRNTGGLLDSPDGNDMLXXXXXXXXXXGEXXXXXXXX 176
           L G GI  +T+L S++ +MSVKP+  T     +  G   L          G         
Sbjct: 121 LLGTGIIQNTDLKSIVDKMSVKPISRTNETTSTQTG--FLKRRNTILTTPGANFSLI--- 175

Query: 177 XXXXXXXGQGDSASDFYDGNKITWRPKGITHKKDEVFLYVNERMNILVSRDGSILKSYVD 236
                        ++ +D            HKK+E+F +VNE MN+LVS+DGSILK+YVD
Sbjct: 176 ------------PTNRHDA-----------HKKNEIFFFVNESMNLLVSKDGSILKNYVD 212

Query: 237 GTIDITTHLSGTPICRFGLNDSLGMQSEDEKKWLAQQQHHSRGNFESKNFIHKAAAGSVL 296
           G I+I +HL+G P C+F L D       D+ K                            
Sbjct: 213 GKIEIKSHLNGNPTCQFELVD-------DQTK---------------------------- 237

Query: 297 LEDCKFHECVSLDKFNKNHTIEFVPPDGSMELMKYHVRDN-INLPFKITPIVTHSTRDNE 355
           + D KF +C+  +K  ++ T+     DG +E++ YHVRD+ IN+PFKITPIV  ST  + 
Sbjct: 238 ITDFKFDQCI--EKV-QSRTVRVAATDGELEIVNYHVRDDKINIPFKITPIV--STVKDT 292

Query: 356 IDYRITLKSLFPGKLSAKDVTLHIPVPPSTVDCKISVSNGHCKFVPEENAMMWRFNKYNG 415
           +DYRI+LKSLFP  LSA DV L IPVPP+T+DCKI+VSNGHCKF  E+NA++W FNK+NG
Sbjct: 293 VDYRISLKSLFPKNLSATDVVLTIPVPPNTIDCKINVSNGHCKFKAEQNAVIWTFNKFNG 352

Query: 416 LTENTLSAVTVSTSDTTQ-LNLQQWTRPPMSLDFEVMMFSNSGLVVRYFTIFGKDS-KHR 473
            TENTLSA+T+  +D  Q +NL+ WTRP + L FE+ M+S SGL++R   I  KD  +++
Sbjct: 353 STENTLSAITI--ADGRQIMNLESWTRPSIQLTFEITMYSISGLLLRNLMITDKDKRRYK 410

Query: 474 AVKWIKYISRSGSYEVRY 491
           A +WIKYISR+GSYE+R+
Sbjct: 411 ASRWIKYISRAGSYEMRF 428

>ADR315W Chr4 (1259839..1261317) [1479 bp, 492 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL062C (APM4)
          Length = 492

 Score =  422 bits (1084), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 211/459 (45%), Positives = 300/459 (65%), Gaps = 38/459 (8%)

Query: 1   MISGVLIYSSRGELVLNKFFKNSLKRSISDIFRVQVINNLDVRSPVLTLGSTTFHHIRSR 60
           MI    +++ RG L+++K      K S+S++FR+QVIN L++RSPVLTLGSTTF HIR+ 
Sbjct: 1   MIDAFFVFAPRGSLIVSKLISGEAKESLSEVFRLQVINGLEIRSPVLTLGSTTFQHIRTS 60

Query: 61  HGDNLWLVTITRSNANSAAIWEFLYKLDFVMNAYRLDREEALKEEFMIVHEMLDIMLGGN 120
            G  LW+V + R NA+SAAIWEFLY ++ +++AY ++ EEAL ++FM+ +E+LD++L  +
Sbjct: 61  GG--LWMVVVVRGNADSAAIWEFLYHMNKLLDAYAINTEEALLDDFMLCYELLDVVLD-S 117

Query: 121 GIPIDTELNSVIAQMSVKPVRNTGGLLDSPDGNDMLXXXXXXXXXXGEXXXXXXXXXXXX 180
           G+P DTEL+ ++  +S KP   TG   +S  G+D L                        
Sbjct: 118 GLPQDTELSHIVPLLSRKPA--TG---ESASGDDFLNSARLRRTGTKNVSVETL------ 166

Query: 181 XXXGQGDSASDFYDGNKITWRPKGITHKKDEVFLYVNERMNILVSRDGSILKSYVDGTID 240
                     D +  +   WR +GI +KK+EV+L V E++++LV+RDG+ILK+YVDGT+ 
Sbjct: 167 ----------DHFSRDVCPWRGEGIKYKKNEVYLDVIEKLSLLVNRDGTILKAYVDGTVQ 216

Query: 241 ITTHLSGTPICRFGLNDSLGMQSEDEKKWLAQQQHHSRGNFESKNFIHKAAAGSVLLEDC 300
            T HLSG P+C FG NDS  ++    ++  A +     G  E +         SV+LEDC
Sbjct: 217 CTAHLSGMPLCHFGFNDSQSLRQRSPRRQYAPRVF---GTDERE---------SVVLEDC 264

Query: 301 KFHECVSLDKFNKNHTIEFVPPDGSMELMKYHVRDNINLPFKITPIVTHSTRDNEIDYRI 360
           KFH+CV L+KF++   I FVPPDG  ELMKYH+RD++  PFK+TP+V+    +  I+YRI
Sbjct: 265 KFHQCVQLNKFDQERVIRFVPPDGEFELMKYHIRDDLRPPFKVTPVVS-KVNERSIEYRI 323

Query: 361 TLKSLFPGKLSAKDVTLHIPVPPSTVDCKISVSNGHCKFVPEENAMMWRFNKYNGLTENT 420
           TL+SLFP KLSAKDV L+IP PP T+  K++VS G CKFVPEENA++W+ +K++GLTENT
Sbjct: 324 TLQSLFPTKLSAKDVELYIPAPPYTISAKVNVSCGKCKFVPEENAIIWKIHKFHGLTENT 383

Query: 421 LSAVTVSTSDTTQLN-LQQWTRPPMSLDFEVMMFSNSGL 458
           LSAVT++         L QW RPP+S+  E+MMFS + L
Sbjct: 384 LSAVTIADEQGHYAQVLDQWPRPPISMKLEIMMFSTAAL 422

>Kwal_55.20843 s55 complement(580157..581482) [1326 bp, 441 aa] {ON}
           YPL259C (APM1) - medium subunit of the
           clathrin-associated protein complex [contig 138] FULL
          Length = 441

 Score =  193 bits (491), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 145/508 (28%), Positives = 244/508 (48%), Gaps = 87/508 (17%)

Query: 1   MISGVLIYSSRGELVLNKFFKNSLKRSISDIFRVQVI---NNLDVRSPVLTLGSTTFHHI 57
           M S +    + G+++L++ +++ +  S  + F   ++       V  P LT     +  I
Sbjct: 1   MASCIYFCDNTGKVILSRRYRDDVPPSAIERFPALLLEAEQESSVVPPCLTHNGLQYMFI 60

Query: 58  RSRHGDNLWLVTITRS-NANSAAIWEFLYKLDFVMNAY-RLDREEALKEEFMIVHEMLDI 115
           +  H D ++++T++RS + N A ++ FLYKL  V+  Y +   EE++++ F+I++E+LD 
Sbjct: 61  Q--HND-IYVLTMSRSLSINVAQVFSFLYKLVEVLAEYLKTVEEESIRDNFVIIYELLDE 117

Query: 116 MLGGNGIPIDTE---LNSVIAQMS---VKPVRNTGGLLDSPDGNDMLXXXXXXXXXXGEX 169
           ML   GIP  TE   L   I Q S   +K V+ +  ++  P                   
Sbjct: 118 MLD-YGIPQITETKMLKQYITQKSYKLIKSVKKSKNVVRPPAQLT--------------- 161

Query: 170 XXXXXXXXXXXXXXGQGDSASDFYDGNKITWRPKGITHKKDEVFLYVNERMNILVSRDGS 229
                                       ++WRP+GIT+KK+E FL V E +N+L++  G 
Sbjct: 162 --------------------------KSVSWRPEGITYKKNEAFLDVTESINMLITASGQ 195

Query: 230 ILKSYVDGTIDITTHLSGTPICRFGLNDSLGMQSEDEKKWLAQQQHHSRGNFESKNFIHK 289
           +L+S + G + + + LSG P  + GLND                    +G F S+   + 
Sbjct: 196 VLRSEILGKVKVRSRLSGMPDLKLGLND--------------------KGIFTSEEGGNN 235

Query: 290 AAAGS-----VLLEDCKFHECVSLDKFNKNHTIEFVPPDGSMELMKYHVRDNIN-LPFKI 343
           A  GS     + LED +FH+CV L KF     I F+PPDG  +LM Y +   I  L +  
Sbjct: 236 AEGGSGKKSNIELEDLQFHQCVRLSKFENEKIISFIPPDGDFDLMNYRLSTPIKPLIWCD 295

Query: 344 TPIVTHSTRDNEIDYRITLKSLFPGKLSAKDVTLHIPVPPSTVDCKISVSNGHCKFVPEE 403
             I  HS    EI  R   K+    K +A +V + IPVP      K   S+G  K+VPE+
Sbjct: 296 AKIQVHSQSRIEIHCR--AKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGSLKYVPEK 353

Query: 404 NAMMWRFNKYNGLTENTLSAVTVSTSDTTQLNLQQWTRPPMSLDFEVMMFSNSGLVVRYF 463
           +A++WR   +NG  E + +A  +     T + + +  R P+ + F++  F+ SG+ VRY 
Sbjct: 354 SAILWRIKTFNGGKEYSFAA-QLGLPSMTDVEVPKAKR-PIQVKFQIPYFTTSGIQVRYL 411

Query: 464 TIFGKDSKHRAVKWIKYISRSG-SYEVR 490
            +     ++++  W++YI++SG  Y +R
Sbjct: 412 KVHEPKLQYQSYPWVRYITQSGDDYTIR 439

>SAKL0F05346g Chr6 (413830..415173) [1344 bp, 447 aa] {ON} highly
           similar to uniprot|Q00776 Saccharomyces cerevisiae
           YPL259C APM1 medium subunit of the clathrin- associated
           protein complex
          Length = 447

 Score =  193 bits (490), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 143/506 (28%), Positives = 246/506 (48%), Gaps = 77/506 (15%)

Query: 1   MISGVLIYSSRGELVLNKFFKNSLKRSISDIFRVQVINNLDVRSPVL--TLGSTTFHHIR 58
           M S +    S+G+ +L++ +K+ +  +  D F + ++   +  S V+   L      ++ 
Sbjct: 1   MASCIYFCDSKGKKILSRRYKDDIPTNAIDKFPMLLVER-EQESSVIPPCLAHNGIQYLF 59

Query: 59  SRHGDNLWLVTITRS-NANSAAIWEFLYKLDFVMNAY-RLDREEALKEEFMIVHEMLDIM 116
            +H D L+++T+TRS + N A ++ FLYK+  V+  Y ++  EE++++ F+I++E+LD M
Sbjct: 60  VQHND-LYVLTMTRSLSTNVAQLFAFLYKVVEVLTEYVKVVEEESIRDNFVIIYELLDEM 118

Query: 117 LGGNGIPIDTE---LNSVIAQMS---VKPVRNTGGLLDSPDGNDMLXXXXXXXXXXGEXX 170
           +   GIP  TE   L   I Q S   +K  + +  ++  P                    
Sbjct: 119 MD-YGIPQITETKMLKQYITQKSFKLMKSAKKSKNVIRPPIAL----------------- 160

Query: 171 XXXXXXXXXXXXXGQGDSASDFYDGNKITWRPKGITHKKDEVFLYVNERMNILVSRDGSI 230
                                    N ++WRP+GI +KK+E FL V E +N+L+++ G +
Sbjct: 161 ------------------------TNSVSWRPEGIMYKKNEAFLDVVESINMLITQQGQV 196

Query: 231 LKSYVDGTIDITTHLSGTPICRFGLNDSLGMQSEDEKKWLAQQQHHSRGNFESKNFIHKA 290
           L+S + G + + +HLSG P  + GLND  G+ S           +H  G  E +     A
Sbjct: 197 LRSEILGKVKVKSHLSGMPDLKLGLNDK-GIFS-----------NHVSGGVEDEADDLSA 244

Query: 291 AA---GSVLLEDCKFHECVSLDKFNKNHTIEFVPPDGSMELMKYHVRDNINLPFKITPIV 347
                 ++ LED KFH+CV L KF     I F+PPDG  ELM Y +   I  P     I 
Sbjct: 245 TGKKKANIELEDLKFHQCVRLSKFENEKIITFIPPDGDFELMSYRLTTPIK-PLIWCDIK 303

Query: 348 THSTRDNEIDYRITLKSLFPGKLSAKDVTLHIPVPPSTVDCKISVSNGHCKFVPEENAMM 407
                 + I+     K+    K +A +V + IPVP      K   S+G  K+ PE+NA++
Sbjct: 304 IQVHSKSRIEVHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGSIKWAPEKNAIL 363

Query: 408 WRFNKYNGLTENTLSAV--TVSTSDTTQLNLQQWTRPPMSLDFEVMMFSNSGLVVRYFTI 465
           W+   + G  E +++A     S SD  +  +++    P+ + F++  F+ SG+ VRY  I
Sbjct: 364 WKIKSFPGGKEYSMAAQLGLPSVSDFEEPVMKR----PVQVKFQIPYFTTSGIQVRYLKI 419

Query: 466 FGKDSKHRAVKWIKYISRSG-SYEVR 490
                ++++  W++YI++SG  Y +R
Sbjct: 420 NEPKMQYQSYPWVRYITQSGDDYTIR 445

>KLTH0F12584g Chr6 complement(1053944..1055269) [1326 bp, 441 aa]
           {ON} highly similar to uniprot|Q00776 Saccharomyces
           cerevisiae YPL259C APM1 medium subunit of the clathrin-
           associated protein complex
          Length = 441

 Score =  191 bits (486), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 143/503 (28%), Positives = 243/503 (48%), Gaps = 77/503 (15%)

Query: 1   MISGVLIYSSRGELVLNKFFKNSLKRSISDIFR---VQVINNLDVRSPVLTLGSTTFHHI 57
           M S +    ++G+++L++ +++ +  S  + F    ++      +  P LT     +  I
Sbjct: 1   MASCIYFCDNKGKVILSRRYRDDVPPSAIEKFPSLLLEAEQESSIVPPCLTHNGVQYLFI 60

Query: 58  RSRHGDNLWLVTITRS-NANSAAIWEFLYKLDFVMNAY-RLDREEALKEEFMIVHEMLDI 115
           +  H D ++++T++RS + N A ++ FLYKL  V+  Y +   EE++++ F+I++E+LD 
Sbjct: 61  Q--HND-IYVLTMSRSLSINVAQVFSFLYKLVEVLAEYVKTVEEESIRDNFVIIYELLDE 117

Query: 116 MLGGNGIPIDTE---LNSVIAQMS---VKPVRNTGGLLDSPDGNDMLXXXXXXXXXXGEX 169
           ML   GIP  TE   L   I Q S   +K  + +  ++  P                   
Sbjct: 118 MLD-YGIPQITETKMLKQYITQKSYKLIKSAKKSKNVIRPPSQL---------------- 160

Query: 170 XXXXXXXXXXXXXXGQGDSASDFYDGNKITWRPKGITHKKDEVFLYVNERMNILVSRDGS 229
                                       ++WRP+GIT+KK+E FL V E +N+L++  G 
Sbjct: 161 -------------------------TKSVSWRPEGITYKKNEAFLDVTESINMLITASGQ 195

Query: 230 ILKSYVDGTIDITTHLSGTPICRFGLNDSLGMQSEDEKKWLAQQQHHSRGNFESKNFIHK 289
           +L+S + G +++ + LSG P  + GLND  G+ +  E    ++     + N E       
Sbjct: 196 VLRSEILGKVNVRSRLSGMPDLKLGLNDK-GIFTSVESASSSEATEGKKSNIE------- 247

Query: 290 AAAGSVLLEDCKFHECVSLDKFNKNHTIEFVPPDGSMELMKYHVRDNIN-LPFKITPIVT 348
                  LED KFH+CV L KF     I F+PPDG  ELM Y +   I  L +    I  
Sbjct: 248 -------LEDLKFHQCVRLSKFENEKIITFIPPDGDFELMNYRLSTPIKPLIWCDAKIQV 300

Query: 349 HSTRDNEIDYRITLKSLFPGKLSAKDVTLHIPVPPSTVDCKISVSNGHCKFVPEENAMMW 408
           HS    EI  R   K+    K +A +V + IPVP      K   S+G  K+VPE++A++W
Sbjct: 301 HSQSRIEIHCR--AKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGSLKYVPEKSAILW 358

Query: 409 RFNKYNGLTENTLSAVTVSTSDTTQLNLQQWTRPPMSLDFEVMMFSNSGLVVRYFTIFGK 468
           +   +NG  E + +A  +     T   + +  R P+ + F++  F+ SG+ VRY  I   
Sbjct: 359 KIKTFNGGKEYSFAA-QLGLPSMTDAEVPRAKR-PIQVKFQIPYFTTSGIQVRYLKINEP 416

Query: 469 DSKHRAVKWIKYISRSG-SYEVR 490
             ++++  W++YI++SG  Y +R
Sbjct: 417 KLQYQSYPWVRYITQSGDDYTIR 439

>Ecym_8350 Chr8 (700421..701758) [1338 bp, 445 aa] {ON} similar to
           Ashbya gossypii ADL017C
          Length = 445

 Score =  189 bits (479), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 142/497 (28%), Positives = 245/497 (49%), Gaps = 71/497 (14%)

Query: 1   MISGVLIYSSRGELVLNKFFKNSLKRSISDIFRVQVI---NNLDVRSPVLTLGSTTFHHI 57
           M SG+    ++G+L+L++ +K+ +  S  + F   +I      +V  P  +     +  I
Sbjct: 1   MSSGIYFCDAKGKLLLSRRYKDDIPISAIEQFPYLLIEKEQESNVIPPCFSHNGVQYLFI 60

Query: 58  RSRHGDNLWLVTITRS-NANSAAIWEFLYKLDFVMNAY-RLDREEALKEEFMIVHEMLDI 115
           +  H D L+++T+TRS  AN A ++ FL+ L  V+  Y ++  EE++K+ F+I++E+LD 
Sbjct: 61  Q--HND-LYILTLTRSMYANVAQVFSFLHTLVDVLQEYMKVVEEESIKDNFVIIYELLDE 117

Query: 116 MLGGNGIPIDTE---LNSVIAQMSVKPVRNTGGLLDSPDGNDMLXXXXXXXXXXGEXXXX 172
           ++  +GIP  T+   L   I Q S K +R+     +       L                
Sbjct: 118 VMD-SGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPSSLT--------------- 161

Query: 173 XXXXXXXXXXXGQGDSASDFYDGNKITWRPKGITHKKDEVFLYVNERMNILVSRDGSILK 232
                                    ++WRP+GI +KK+E FL V E +N+++++ G +L+
Sbjct: 162 -----------------------TAVSWRPEGIKYKKNEAFLDVIESINMMMTQQGQVLR 198

Query: 233 SYVDGTIDITTHLSGTPICRFGLNDS-LGMQSEDEKKWLAQQQHHSRGNFESKNFIHKAA 291
           S + G + + + LSG P  + GLND  +  QS +E+    + +  S+ +   K       
Sbjct: 199 SEILGKVKVRSRLSGMPDLKLGLNDKGIFTQSNEEE----EDEPSSQPSITRKK------ 248

Query: 292 AGSVLLEDCKFHECVSLDKFNKNHTIEFVPPDGSMELMKYHVRDNIN-LPFKITPIVTHS 350
             ++ LED KFH+CV L KF     I F+PPDG  ELM Y +   I  L +    I  HS
Sbjct: 249 -SNIELEDLKFHQCVRLSKFENEKIITFIPPDGDFELMSYRLSTPIKPLIWCDAKIQVHS 307

Query: 351 TRDNEIDYRITLKSLFPGKLSAKDVTLHIPVPPSTVDCKISVSNGHCKFVPEENAMMWRF 410
               E+  R   K+    K +A +V + IPVP      K   S+G  K+VPE+NA++W+ 
Sbjct: 308 RSRVEVHCR--AKAQIKAKSTANNVEILIPVPNDADSPKFRYSHGSIKWVPEKNAILWKI 365

Query: 411 NKYNGLTENTLSAVT--VSTSDTTQLNLQQWTRPPMSLDFEVMMFSNSGLVVRYFTIFGK 468
             + G  + +++A     S +D    N ++    P+ + F++  F+ SG+ VRY  I   
Sbjct: 366 KSFPGGKDYSMAAEMGLPSVNDIADYNFKR----PVQIKFQIPYFTTSGIQVRYLKINEP 421

Query: 469 DSKHRAVKWIKYISRSG 485
             ++ +  W++YI++SG
Sbjct: 422 KLQYNSYPWVRYITQSG 438

>ADL017C Chr4 complement(679085..680416) [1332 bp, 443 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL259C
           (APM1)
          Length = 443

 Score =  188 bits (478), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 145/502 (28%), Positives = 243/502 (48%), Gaps = 72/502 (14%)

Query: 1   MISGVLIYSSRGELVLNKFFKNSLKRSISDIFRVQVI---NNLDVRSPVLTLGSTTFHHI 57
           M SG+    S+G+L+L++ +K+ +  +  + F   +I       V  P  +     +  I
Sbjct: 1   MTSGIYFCDSKGKLLLSRRYKDDIPANAIEQFPHLLIEKEQESSVLPPCFSFNGVQYLFI 60

Query: 58  RSRHGDNLWLVTITRS-NANSAAIWEFLYKLDFVMNAY-RLDREEALKEEFMIVHEMLDI 115
           +  H D L+++T+T+S + N A ++ +L+KL  V+  Y ++  EE++K+ F+I++E+LD 
Sbjct: 61  Q--HND-LYVLTLTKSMSINVAQVFSYLHKLIEVLEEYMKVVEEESIKDNFVIIYELLDE 117

Query: 116 MLGGNGIPIDTE---LNSVIAQMSVKPVRNTGGLLDSPDGNDMLXXXXXXXXXXGEXXXX 172
           M+  +GIP  T+   L   I Q S K +R+     +       L                
Sbjct: 118 MMD-HGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPATLT--------------- 161

Query: 173 XXXXXXXXXXXGQGDSASDFYDGNKITWRPKGITHKKDEVFLYVNERMNILVSRDGSILK 232
                                  N ++WRP+GI +KK+E FL V E +N+L+++ G +L+
Sbjct: 162 -----------------------NSVSWRPEGIVYKKNEAFLDVVESINMLLTQQGQVLR 198

Query: 233 SYVDGTIDITTHLSGTPICRFGLNDSLGMQSEDEKKWLAQQQHHSRGNFESKNFIHKAAA 292
           S + G + + + LSG P  + GLND         K   AQ          S     K+  
Sbjct: 199 SEILGKVKVKSRLSGMPDLKLGLND---------KGIFAQGDDDDDEEGASGGTKKKS-- 247

Query: 293 GSVLLEDCKFHECVSLDKFNKNHTIEFVPPDGSMELMKYHVRDNIN-LPFKITPIVTHST 351
            ++ LED KFH+CV L KF     I F+PPDG  ELM Y +   I  L +    +  HS 
Sbjct: 248 -NIELEDLKFHQCVRLTKFENEKIITFIPPDGDFELMSYRLSTPIKPLIWCDVKLQVHSR 306

Query: 352 RDNEIDYRITLKSLFPGKLSAKDVTLHIPVPPSTVDCKISVSNGHCKFVPEENAMMWRFN 411
              EI  R   K+    K +A +V + IPVP      K   S+G  K+VP +NA++W+  
Sbjct: 307 SRIEIHCRA--KAQIKKKSTANNVEILIPVPEDADSPKFRYSHGTIKWVPSQNAILWKIK 364

Query: 412 KYNGLTENTLSAVT--VSTSDTTQLNLQQWTRPPMSLDFEVMMFSNSGLVVRYFTIFGKD 469
            + G  + +++A     S SD +   L++    P+ + F++  F+ SG+ VRY  I    
Sbjct: 365 SFPGGKDYSMAAEMGLPSVSDNSDHKLKR----PVQIKFQIPYFTTSGIQVRYLKINEPK 420

Query: 470 SKHRAVKWIKYISRSG-SYEVR 490
            ++ +  W++YI++SG  Y +R
Sbjct: 421 MQYNSYPWVRYITQSGDDYTIR 442

>YPL259C Chr16 complement(51244..52671) [1428 bp, 475 aa] {ON}
           APM1Mu1-like medium subunit of the clathrin-associated
           protein complex (AP-1); binds clathrin; involved in
           clathrin-dependent Golgi protein sorting
          Length = 475

 Score =  186 bits (472), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 141/515 (27%), Positives = 255/515 (49%), Gaps = 67/515 (13%)

Query: 1   MISGVLIYSSRGELVLNKFFKNSLKRSISDIFRVQVINNLDVRSPVL--TLGSTTFHHIR 58
           M S V      G+ +L++ +++ +  S  D F + ++++L+ +S ++   L      ++ 
Sbjct: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPI-LLSDLEEQSNLIPPCLNHNGLEYLF 59

Query: 59  SRHGDNLWLVTITRSNANSAAIWEFLYKLDFVMNAY-RLDREEALKEEFMIVHEMLDIML 117
            +H D   +  +T  +AN+AAI+ FL+KL  V++ Y +   EE++++ F+I++E+LD ++
Sbjct: 60  IQHNDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVM 119

Query: 118 GGNGIPIDTE---LNSVIAQMSVKPVRNTGGLLDSPDGNDMLXXXXXXXXXXGEXXXXXX 174
              GIP  TE   L   I Q S K V++     ++      L                  
Sbjct: 120 D-YGIPQITETKMLKQYITQKSFKLVKSAKKKRNATRPPVALT----------------- 161

Query: 175 XXXXXXXXXGQGDSASDFYDGNKITWRPKGITHKKDEVFLYVNERMNILVSRDGSILKSY 234
                                N ++WRP+GITHKK+E FL + E +N+L+++ G +L+S 
Sbjct: 162 ---------------------NSVSWRPEGITHKKNEAFLDIVESINMLMTQKGQVLRSE 200

Query: 235 VDGTIDITTHLSGTPICRFGLNDSLGMQS---EDEKKWLAQQQHHSRGNFES--KNFIHK 289
           + G + + + LSG P  + G+ND  G+ S   +D+    +     S  N E+  K  I  
Sbjct: 201 IIGDVKVNSKLSGMPDLKLGINDK-GIFSKYLDDDTNIPSASATTSDNNTETDKKPSITS 259

Query: 290 AAAG-----SVLLEDCKFHECVSLDKFNKNHTIEFVPPDGSMELMKYHVRDNINLPFKIT 344
           ++A      ++ LED KFH+CV L KF     I F+PPDG  +LM Y +   I  P    
Sbjct: 260 SSATNKKKVNIELEDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIK-PLIWC 318

Query: 345 PIVTHSTRDNEIDYRITLKSLFPGKLSAKDVTLHIPVPPSTVDCKISVSNGHCKFVPEEN 404
            +      ++ I+     K+    K +A +V + IPVP          S+G  K+VPE++
Sbjct: 319 DVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPDDADTPTFKYSHGSLKYVPEKS 378

Query: 405 AMMWRFNKYNGLTENTLSA----VTVSTSD----TTQLNLQQWTRPPMSLDFEVMMFSNS 456
           A++W+   + G  E ++SA     ++S ++    T   +  +  + P+ + F++  F+ S
Sbjct: 379 AILWKIRSFPGGKEYSMSAELGLPSISNNEDGNRTMPKSNAEILKGPVQIKFQIPYFTTS 438

Query: 457 GLVVRYFTIFGKDSKHRAVKWIKYISRSG-SYEVR 490
           G+ VRY  I     ++++  W++YI++SG  Y +R
Sbjct: 439 GIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIR 473

>KLLA0D14311g Chr4 (1216574..1217905) [1332 bp, 443 aa] {ON} similar
           to uniprot|Q00776 Saccharomyces cerevisiae YPL259C APM1
           medium subunit of the clathrin-associated protein
           complex
          Length = 443

 Score =  184 bits (466), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 140/504 (27%), Positives = 242/504 (48%), Gaps = 76/504 (15%)

Query: 1   MISGVLIYSSRGELVLNKFFKNSLKRSISDIFRVQVINNLDVRSPVLTLGSTTFHH---- 56
           M S V    S+G+ +L++ +++ + +S  + F+  ++     R    ++    FHH    
Sbjct: 1   MASYVAFCDSKGKPLLSRRYQDDVSQSAVESFQHLLLE----REQESSVMPPCFHHNGIH 56

Query: 57  -IRSRHGDNLWLVTITRS-NANSAAIWEFLYKLDFVMNAY-RLDREEALKEEFMIVHEML 113
            +  ++ D ++++ +TRS + N+  ++ F+YKL  V+  Y +   EE++++ ++I++E+L
Sbjct: 57  YMYVQYND-VYVLALTRSVSVNATTMFAFMYKLINVVEEYVKRVEEESIRDNYIIIYELL 115

Query: 114 DIMLGGNGIPIDTE---LNSVIAQMSVKPVRNTGGLLDSPDGNDMLXXXXXXXXXXGEXX 170
           D M+   G+P  TE   L   I Q S K  R+     +       L              
Sbjct: 116 DEMMD-KGVPQVTETKMLKQYITQKSFKLTRSAKKQKNVARPPTELT------------- 161

Query: 171 XXXXXXXXXXXXXGQGDSASDFYDGNKITWRPKGITHKKDEVFLYVNERMNILVSRDGSI 230
                                    N ++WRP+GI +KK+E FL V E +N+L+++ G +
Sbjct: 162 -------------------------NSVSWRPEGIKYKKNEAFLDVIESINMLMTQQGQV 196

Query: 231 LKSYVDGTIDITTHLSGTPICRFGLNDSLGMQSEDEKKWLAQQQHHSRGNFESKNFIHKA 290
           L+S + GT+ + + LSG P  + GLND     + D       Q+        SK      
Sbjct: 197 LRSEILGTVKVRSRLSGMPDLKLGLNDKGIFTTND-------QEDSPEPVVSSKK----- 244

Query: 291 AAGSVLLEDCKFHECVSLDKFNKNHTIEFVPPDGSMELMKYHVRDNIN-LPFKITPIVTH 349
              ++ LED KFH+CV L KF     I F+PPDG  +LM Y +   I  L +    +  H
Sbjct: 245 KNSNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMTYRLSTPIKPLIWCDVKVQVH 304

Query: 350 STRDNEIDYRITLKSLFPGKLSAKDVTLHIPVPPSTVDCKISVSNGHCKFVPEENAMMWR 409
           S    EI  R   K+    K  A +V + IP+P          S G+ K+VPE+NA++W+
Sbjct: 305 SGSRIEIHCR--AKAQIKKKSVANNVEILIPIPEDADSPTFKYSRGNIKWVPEKNAILWK 362

Query: 410 FNKYNGLTENTLSAV--TVSTSDTTQLNLQQWTRPPMSLDFEVMMFSNSGLVVRYFTIFG 467
           F+ + G  E +++A     S SD     L++    P+ + F++  F+ SG+ VRY  I  
Sbjct: 363 FSSFQGGKEYSMAAQLGLPSVSDAEPPKLKR----PVQIKFQIPYFTTSGIQVRYLKIEE 418

Query: 468 KDSKHRAVKWIKYISRSG-SYEVR 490
              ++ +  W++YI++SG  Y +R
Sbjct: 419 PKLQYNSYPWVRYITQSGDDYTIR 442

>Suva_16.45 Chr16 complement(66786..68222) [1437 bp, 478 aa] {ON}
           YPL259C (REAL)
          Length = 478

 Score =  184 bits (466), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 144/519 (27%), Positives = 254/519 (48%), Gaps = 72/519 (13%)

Query: 1   MISGVLIYSSRGELVLNKFFKNSLKRSISDIFRVQVINNLDVRSPVL--TLGSTTFHHIR 58
           M S V      G+ +L++ +++ +  S  D F   ++++L+ +S ++   L      ++ 
Sbjct: 1   MASAVYFCDHDGKPLLSRRYRDDIPLSAIDKFPT-LLSDLEEQSNLIPPCLNHNGLEYLF 59

Query: 59  SRHGDNLWLVTITRS-NANSAAIWEFLYKLDFVMNAY-RLDREEALKEEFMIVHEMLDIM 116
            +H D L+LV I  S +AN+AAI+ FL+KL  V++ Y +   EE++++ F+I++E+LD +
Sbjct: 60  IQHND-LYLVAIATSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEV 118

Query: 117 LGGNGIPIDTE---LNSVIAQMSVKPVRNTGGLLDSPDGNDMLXXXXXXXXXXGEXXXXX 173
           +   GIP  TE   L   I Q S K V++     ++      L                 
Sbjct: 119 MD-YGIPQITETKMLKQYITQKSFKLVKSAKKKRNATRPPVALT---------------- 161

Query: 174 XXXXXXXXXXGQGDSASDFYDGNKITWRPKGITHKKDEVFLYVNERMNILVSRDGSILKS 233
                                 N ++WRP+GI+HKK+E FL + E +N+L+++ G +L+S
Sbjct: 162 ----------------------NSVSWRPEGISHKKNEAFLDIVESINMLMTQKGQVLRS 199

Query: 234 YVDGTIDITTHLSGTPICRFGLNDSLGMQSE--DEKKWLAQQQHHSRG------NFESKN 285
            + G + + + LSG P  + G+ND  G+ S+  D+   L      +        + + K 
Sbjct: 200 EIIGDVKVNSKLSGMPDLKLGINDK-GIFSKYLDDSSNLPPAASTTTSDNKTDVDTDKKP 258

Query: 286 FIHKAAAGS-----VLLEDCKFHECVSLDKFNKNHTIEFVPPDGSMELMKYHVRDNINLP 340
            I  ++  S     + LED KFH+CV L KF     I F+PPDG  +LM Y +   I  P
Sbjct: 259 SITSSSTASKRKVNIELEDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIK-P 317

Query: 341 FKITPIVTHSTRDNEIDYRITLKSLFPGKLSAKDVTLHIPVPPSTVDCKISVSNGHCKFV 400
                +      ++ I+     K+    K +A +V + IPVP          S+G  K+V
Sbjct: 318 LIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPDDADTPTFKYSHGSLKYV 377

Query: 401 PEENAMMWRFNKYNGLTENTLSA----VTVST----SDTTQLNLQQWTRPPMSLDFEVMM 452
           PE++A++W+   + G  E ++SA     ++S     S T   N  +  + P+ + F++  
Sbjct: 378 PEKSAILWKLRSFPGGKEYSMSAELGLPSISNGNDGSKTIPKNNAEILKGPVQIKFQIPY 437

Query: 453 FSNSGLVVRYFTIFGKDSKHRAVKWIKYISRSG-SYEVR 490
           F+ SG+ VRY  I     ++++  W++YI++SG  Y +R
Sbjct: 438 FTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIR 476

>TBLA0A00950 Chr1 complement(210799..212208) [1410 bp, 469 aa] {ON}
           Anc_7.127 YPL259C
          Length = 469

 Score =  183 bits (465), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 141/513 (27%), Positives = 251/513 (48%), Gaps = 70/513 (13%)

Query: 1   MISGVLIYSSRGELVLNKFFKNSLKRSISDIFRVQVINNLDVRSPVL--TLGSTTFHHIR 58
           M+S +    S+G+ +L++ +++ +  +  D F   ++  L+  S V+   L     H++ 
Sbjct: 1   MVSSISFCDSKGKQLLSRKYRDDIPLTAIDNF-ATLLMKLEEESSVVPPCLTHNGIHYLF 59

Query: 59  SRHGDNLWLVTITRS-NANSAAIWEFLYKLDFVMNAYRLD-REEALKEEFMIVHEMLDIM 116
            +H D L++V +T S + N++ ++ FL+KL  VM+ Y  D  EE++++ F+I++E+LD M
Sbjct: 60  IQHND-LYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDEM 118

Query: 117 LGGNGIPIDTE---LNSVIAQMSVKPVRNTGGLLDSPDGNDMLXXXXXXXXXXGEXXXXX 173
           +   GIP  TE   L   I Q S K V+      ++      L                 
Sbjct: 119 MD-YGIPQITETKMLKQYITQKSFKLVKAAKKKRNAARPPQALT---------------- 161

Query: 174 XXXXXXXXXXGQGDSASDFYDGNKITWRPKGITHKKDEVFLYVNERMNILVSRDGSILKS 233
                                 N ++WRP+GI +KK+E FL + E +N+L+++ G +L+S
Sbjct: 162 ----------------------NSVSWRPEGIKYKKNEAFLDIVESINMLMTQQGQVLRS 199

Query: 234 YVDGTIDITTHLSGTPICRFGLNDSLGMQSEDEKKWLAQQQHHSRGNFE---SKNFIHKA 290
            + G + + + LSG P  + G+ND  G+ S+  +   +    +   + E   SK+   + 
Sbjct: 200 EIIGEVKVRSRLSGMPDLKLGINDK-GIFSKYLESTSSNSNSNDDNSNEVNSSKSSTPQP 258

Query: 291 AAG----------SVLLEDCKFHECVSLDKFNKNHTIEFVPPDGSMELMKYHVRDNINLP 340
           + G          +V LED KFH+CV L KF     I F+PPDG+ ELM Y +   I  P
Sbjct: 259 STGQDEGSSRKTSNVELEDLKFHQCVRLSKFENEKIITFIPPDGNFELMSYRLTTPIK-P 317

Query: 341 FKITPIVTHSTRDNEIDYRITLKSLFPGKLSAKDVTLHIPVPPSTVDCKISVSNGHCKFV 400
                +  H    + ++     K+    K  A +V + IPVP          S+G  K+V
Sbjct: 318 LIWCDVNIHVHSKSRVEIHCRAKAQIKKKSIANNVEILIPVPDDADTPSFRYSHGSIKWV 377

Query: 401 PEENAMMWRFNKYNGLTENTLSAV--TVSTSDTTQLNLQQWTRPPMSLDFEVMMFSNSGL 458
           PE+NA++W+   + G  E +++A     S  D  +  L++    P+ + F++  F+ SG+
Sbjct: 378 PEKNAILWKIRSFAGGKEYSMAAQLGLPSIDDNEKPKLKR----PVQIKFQIPYFTTSGI 433

Query: 459 VVRYFTIFGKDSKHRAVKWIKYISRSG-SYEVR 490
            VRY  +     ++++  W++YI++SG  Y +R
Sbjct: 434 QVRYLKVNEPKLQYKSYPWVRYITQSGDDYTIR 466

>Smik_6.466 Chr6 (768507..769937) [1431 bp, 476 aa] {ON} YPL259C
           (REAL)
          Length = 476

 Score =  182 bits (462), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 144/517 (27%), Positives = 250/517 (48%), Gaps = 70/517 (13%)

Query: 1   MISGVLIYSSRGELVLNKFFKNSLKRSISDIFRVQVINNLDVRSPVL--TLGSTTFHHIR 58
           M S V      G+ +L++ +++ +  S  D F   ++++L+ +S ++   L      ++ 
Sbjct: 1   MASAVYFCDHNGKPLLSRRYRDDVPLSAIDKFST-LLSDLEEQSNLIPPCLNHNGLEYLF 59

Query: 59  SRHGDNLWLVTITRS-NANSAAIWEFLYKLDFVMNAY-RLDREEALKEEFMIVHEMLDIM 116
            +H D L+LV I  S  AN+AAI+ FL+KL  V++ Y +   EE++++ F+I++E+LD +
Sbjct: 60  IQHND-LYLVAIVTSLTANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEV 118

Query: 117 LGGNGIPIDTE---LNSVIAQMSVKPVRNTGGLLDSPDGNDMLXXXXXXXXXXGEXXXXX 173
           +   GIP  TE   L   I Q S K V++     ++      L                 
Sbjct: 119 MD-YGIPQITETKMLKQYITQKSFKLVKSAKKKRNATRPPVALT---------------- 161

Query: 174 XXXXXXXXXXGQGDSASDFYDGNKITWRPKGITHKKDEVFLYVNERMNILVSRDGSILKS 233
                                 N ++WRP+GITHKK+E FL + E +N+L+++ G +L+S
Sbjct: 162 ----------------------NSVSWRPEGITHKKNEAFLDIVESINMLMTQKGQVLRS 199

Query: 234 YVDGTIDITTHLSGTPICRFGLNDSLGMQSE----DEKKWLAQQQHHSRGNFESKN---- 285
            + G + + + LSG P  + G+ND  G+ S+    D     A     S  N ++      
Sbjct: 200 EIIGDVKVNSKLSGMPDLKLGINDK-GIFSKYLDNDSNIPSAVSAATSDNNTDTDKKPSI 258

Query: 286 ---FIHKAAAGSVLLEDCKFHECVSLDKFNKNHTIEFVPPDGSMELMKYHVRDNINLPFK 342
                      ++ LED KFH+CV L KF     I F+PPDG  +LM Y +   I  P  
Sbjct: 259 TSSSTTSKRKVNIELEDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIK-PLI 317

Query: 343 ITPIVTHSTRDNEIDYRITLKSLFPGKLSAKDVTLHIPVPPSTVDCKISVSNGHCKFVPE 402
              +      ++ I+     K+    K +A +V + IPVP          S+G  K+VPE
Sbjct: 318 WCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPDDADTPTFKYSHGSLKYVPE 377

Query: 403 ENAMMWRFNKYNGLTENTLSA----VTVSTSD----TTQLNLQQWTRPPMSLDFEVMMFS 454
           ++A++W+   + G  E ++SA     ++STS     T   +  +  + P+ + F++  F+
Sbjct: 378 KSAILWKLRSFPGGKEYSMSAELGLPSISTSKDGSRTIPKSNAKLLKGPVQIKFQIPYFT 437

Query: 455 NSGLVVRYFTIFGKDSKHRAVKWIKYISRSG-SYEVR 490
            SG+ VRY  I     ++++  W++YI++SG  Y +R
Sbjct: 438 TSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIR 474

>KNAG0L00950 Chr12 complement(174410..175795) [1386 bp, 461 aa] {ON}
           Anc_7.127 YPL259C
          Length = 461

 Score =  177 bits (450), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 135/504 (26%), Positives = 237/504 (47%), Gaps = 59/504 (11%)

Query: 1   MISGVLIYSSRGELVLNKFFKNSLKRSISDIFRVQVINNLDVRSPVL--TLGSTTFHHIR 58
           M S V     +G+ +L++ +K+ +  S  D F   ++ +L+  S V+   +      ++ 
Sbjct: 1   MASAVYFCDDKGKPLLSRRYKDDVPLSAIDKFST-LLTDLEDESAVIPPCINHNGIEYLF 59

Query: 59  SRHGDNLWLVTITRS-NANSAAIWEFLYKLDFVMNAY-RLDREEALKEEFMIVHEMLDIM 116
            +H D L++V +  S   N A ++ FL+KL  V+  Y +   EE++++ F+I++E++D M
Sbjct: 60  IQHND-LYVVALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMDEM 118

Query: 117 LGGNGIPIDTE---LNSVIAQMSVKPVRNTGGLLDSPDGNDMLXXXXXXXXXXGEXXXXX 173
           +   GIP  TE   L   I Q S K                                   
Sbjct: 119 MD-YGIPQITEPRMLKKYITQKSFK----------------------------------- 142

Query: 174 XXXXXXXXXXGQGDSASDFYDGNKITWRPKGITHKKDEVFLYVNERMNILVSRDGSILKS 233
                           S+    N ++WR +GI +KK+E FL + E +N+L+++ G +L+S
Sbjct: 143 -LEKAHKKKRNAARPPSEL--NNSVSWRAEGIKYKKNEAFLDIVESINMLITQKGQVLRS 199

Query: 234 YVDGTIDITTHLSGTPICRFGLND----SLGMQSEDEKKWLAQQQHHSRGNFESK-NFIH 288
            + G + I + LSG P  + G+ND    +  ++  +    +   Q H  G  ES      
Sbjct: 200 EIIGAVKIKSRLSGMPDLKLGINDRGIFTKYLEGNNIGVNIPDPQEHGSGVAESSITNDG 259

Query: 289 KAAAGSVLLEDCKFHECVSLDKFNKNHTIEFVPPDGSMELMKYHVRDNINLPFKITPIVT 348
           K    ++ LED KFH+CV L KF     I F+PPDG  +LM Y +  +I  P     +  
Sbjct: 260 KKRKTNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMNYRLTTSIK-PLIWCDVSI 318

Query: 349 HSTRDNEIDYRITLKSLFPGKLSAKDVTLHIPVPPSTVDCKISVSNGHCKFVPEENAMMW 408
                + I+ R   K+    K  A +V + IPVP          S+G  K+VPE++A++W
Sbjct: 319 QVHSKSRIEIRCRAKAQIKKKSVAANVQILIPVPDDADTPSFKYSHGSIKYVPEQSAILW 378

Query: 409 RFNKYNGLTENTLSA-VTVSTSDTTQLNLQQWTRPPMSLDFEVMMFSNSGLVVRYFTIFG 467
           +   + G  E  + A + + + D+ +   +   + P+ + FE+  F+ SG+ VRY  I  
Sbjct: 379 KIKSFPGGKEYAMFAEMGLPSMDSYE---EPKVKRPVQVKFEIPYFTTSGIQVRYLKINE 435

Query: 468 KDSKHRAVKWIKYISRSG-SYEVR 490
              ++++  W++YI++SG  Y +R
Sbjct: 436 PKLQYKSYPWVRYITQSGDDYTIR 459

>NDAI0E03680 Chr5 complement(794613..795947) [1335 bp, 444 aa] {ON}
           Anc_7.127
          Length = 444

 Score =  177 bits (449), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 137/500 (27%), Positives = 241/500 (48%), Gaps = 68/500 (13%)

Query: 1   MISGVLIYSSRGELVLNKFFKNSLKRSISDIFRVQVINNLDVRS----PVLTLGSTTFHH 56
           M S +     +G  +L++ +++ +  +  D F   ++ +L+  S    P LT  +T +  
Sbjct: 1   MASAIYFCDIKGRPLLSRKYRDDIPLTAIDKF-ASLLADLEEESSVIPPCLTYNNTQYLF 59

Query: 57  IRSRHGDNLWLVTITRS-NANSAAIWEFLYKLDFVMNAY-RLDREEALKEEFMIVHEMLD 114
           I+  H D ++LV IT     N A ++ FLYK+  V+  Y +   EE++++ ++I++E+LD
Sbjct: 60  IQ--HSD-IYLVAITNLLRTNIAEVFAFLYKIIDVLGDYLKTVEEESIRDNYVIIYELLD 116

Query: 115 IMLGGNGIPIDTE---LNSVIAQMSVKPVRNTGGLLDSPDGNDMLXXXXXXXXXXGEXXX 171
            ++   GIP  TE   L   I Q S K V+      ++      L               
Sbjct: 117 ELMD-YGIPQITETKMLKQYITQKSFKLVKAAKKKQNAARPPSALT-------------- 161

Query: 172 XXXXXXXXXXXXGQGDSASDFYDGNKITWRPKGITHKKDEVFLYVNERMNILVSRDGSIL 231
                                   + ++WR +GI +KK+E FL + E +N+L+++ G IL
Sbjct: 162 ------------------------DSVSWRSEGIKYKKNEAFLDIVESINMLMTQKGQIL 197

Query: 232 KSYVDGTIDITTHLSGTPICRFGLNDSLGMQSEDEKKWLAQQQHHSRGNFESKNFIHKAA 291
           +S + G + I + LSG P  + G+ND  G+ S    K L +   ++    + +N I    
Sbjct: 198 RSEILGVVKIKSRLSGMPDLKLGINDK-GIFS----KQLTEDDTNNNATSKKQNKIE--- 249

Query: 292 AGSVLLEDCKFHECVSLDKFNKNHTIEFVPPDGSMELMKYHVRDNINLPFKITPIVTHST 351
                LED KFH+CV L KF     I F+PPDG  ELM Y +  +I  P     +     
Sbjct: 250 -----LEDLKFHQCVRLSKFETEKIITFIPPDGDFELMNYRLSTSIK-PLIWCDMNVQVH 303

Query: 352 RDNEIDYRITLKSLFPGKLSAKDVTLHIPVPPSTVDCKISVSNGHCKFVPEENAMMWRFN 411
            ++ I+     K+    K +A +V + IPVP          S+G  K+VPE++A++W+  
Sbjct: 304 SNSRIEIHCRAKAQIKKKSTATNVEILIPVPEDADTPNFKYSHGSIKWVPEKSAILWKIR 363

Query: 412 KYNGLTENTLSAVTVSTSDTTQLNLQQWTRPPMSLDFEVMMFSNSGLVVRYFTIFGKDSK 471
            + G  E +++A     S +++    Q  + P+ + F++  F+ SG+ VRY  I     +
Sbjct: 364 SFPGGKEYSMAAELCLPSTSSKSEEVQ-NKKPVQVKFQIPYFTTSGIQVRYLKINEPKLQ 422

Query: 472 HRAVKWIKYISRSG-SYEVR 490
           +++  W++YI++SG  Y +R
Sbjct: 423 YKSYPWVRYITQSGDDYTIR 442

>TDEL0H02890 Chr8 complement(481125..482453) [1329 bp, 442 aa] {ON}
           Anc_7.127 YPL259C
          Length = 442

 Score =  176 bits (445), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 137/502 (27%), Positives = 239/502 (47%), Gaps = 74/502 (14%)

Query: 1   MISGVLIYSSRGELVLNKFFKNSLKRSISDIFRVQVINNLDVRSPVL--TLGSTTFHHIR 58
           M+SG+     +G  +L++ +++ +  S  D F   ++ +L+  S V+   L      ++ 
Sbjct: 1   MVSGIYFCDIKGRPILSRRYRDDIPLSAIDRF-APLLADLEEESSVIPPCLNHRGIQYLF 59

Query: 59  SRHGDNLWLVTITRSNA-NSAAIWEFLYKLDFVMNAY-RLDREEALKEEFMIVHEMLDIM 116
             H D L++V ++ S A N+A ++ FL+KL   +  Y +   EE++++ F+I++E+LD M
Sbjct: 60  IEHED-LYVVALSTSLATNAAQVFTFLHKLVEALGDYLKTVEEESVRDNFVIIYELLDEM 118

Query: 117 LGGNGIPIDTE---LNSVIAQMS---VKPVRNTGGLLDSPDGNDMLXXXXXXXXXXGEXX 170
           +   GIP  TE   L   I Q S   +K V+        P G                  
Sbjct: 119 MD-YGIPQITETKMLKQYITQKSFKLIKAVKKVKATARPPTGLT---------------- 161

Query: 171 XXXXXXXXXXXXXGQGDSASDFYDGNKITWRPKGITHKKDEVFLYVNERMNILVSRDGSI 230
                                    N ++WR  GIT+KK+E FL + E +N+++++ G +
Sbjct: 162 -------------------------NSVSWRADGITYKKNEAFLDIVESINMVMNQQGQV 196

Query: 231 LKSYVDGTIDITTHLSGTPICRFGLNDSLGMQSEDEKKWLAQQQHHSRGNFESKNFIHKA 290
           L+S + G + + + LSG P  + G+ND  G+ + D +   +Q     + +          
Sbjct: 197 LRSEIIGQVIVRSRLSGMPDLKLGINDK-GIFTRDPETGESQVTAGKKKS---------- 245

Query: 291 AAGSVLLEDCKFHECVSLDKFNKNHTIEFVPPDGSMELMKYHVRDNIN-LPFKITPIVTH 349
              S  LED KFH+CV L KF     I F+PPDG  ELM Y +   +  L +    +  H
Sbjct: 246 ---SAELEDLKFHQCVRLSKFENEKIITFIPPDGEFELMSYRLTTPVKPLIWCDVNVQVH 302

Query: 350 STRDNEIDYRITLKSLFPGKLSAKDVTLHIPVPPSTVDCKISVSNGHCKFVPEENAMMWR 409
           S    EI  R   K+    K  A +V + IPVP          S+G  K+VPE+NA++W+
Sbjct: 303 SKSRIEIHCR--AKAQIKKKSVANNVEILIPVPDDADTPSFRYSHGSIKWVPEKNAILWK 360

Query: 410 FNKYNGLTENTLSAVTVSTSDTTQLNLQQWTRPPMSLDFEVMMFSNSGLVVRYFTIFGKD 469
              + G  E +++A  +       +   ++ R P+ + F++  F+ SG+ VRY  I    
Sbjct: 361 IRSFYGGKEYSMAA-QMGLPSINGVEKPKFKR-PVQVKFQIPYFTTSGIQVRYLKINEPK 418

Query: 470 SKHRAVKWIKYISRSG-SYEVR 490
            ++++  W++YI+++G  Y +R
Sbjct: 419 LQYKSYPWVRYITQNGDDYTIR 440

>Skud_16.19 Chr16 complement(30298..31728) [1431 bp, 476 aa] {ON}
           YPL259C (REAL)
          Length = 476

 Score =  172 bits (437), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 137/517 (26%), Positives = 243/517 (47%), Gaps = 70/517 (13%)

Query: 1   MISGVLIYSSRGELVLNKFFKNSLKRSISDIFRVQVINNLDVRSPVL--TLGSTTFHHIR 58
           M S V      G+ +L++ +++ +  S  D F   ++++L+ +S ++   L      ++ 
Sbjct: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPT-LLSDLEEQSNLIPPCLNHNGLEYLF 59

Query: 59  SRHGDNLWLVTITRS-NANSAAIWEFLYKLDFVMNAY-RLDREEALKEEFMIVHEMLDIM 116
            +H D L+LV I  S  AN+AAI+ FL+KL  V++ Y +   EE++++ F+I++E+LD +
Sbjct: 60  IQHND-LYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEV 118

Query: 117 LGGNGIPIDTE---LNSVIAQMSVKPVRNTGGLLDSPDGNDMLXXXXXXXXXXGEXXXXX 173
           +   GIP   E   L   I Q S K V++     ++      L                 
Sbjct: 119 MD-YGIPQICETKMLKQYITQKSFKLVKSAKKKRNATRPPVALT---------------- 161

Query: 174 XXXXXXXXXXGQGDSASDFYDGNKITWRPKGITHKKDEVFLYVNERMNILVSRDGSILKS 233
                                 N ++WRP+GI HKK+E FL + E +N+L+++ G +L+S
Sbjct: 162 ----------------------NSVSWRPEGIIHKKNEAFLDIVESINMLMTQKGQVLRS 199

Query: 234 YVDGTIDITTHLSGTPICRFGLNDSLGMQS---EDEKKWLAQQQHHSRGNFESKN----- 285
            + G + + + LSG P  + G+ND  G+ S   +D+          +  N    +     
Sbjct: 200 EIIGDVKVNSKLSGMPDLKLGINDK-GIFSKYLDDDSNTPPPTSAATSDNITDTDKKPSI 258

Query: 286 ---FIHKAAAGSVLLEDCKFHECVSLDKFNKNHTIEFVPPDGSMELMKYHVRDNINLPFK 342
                      ++ LED KFH+CV L KF     I F+PPDG  +LM Y +   I  P  
Sbjct: 259 TSSSTTSKRKVNIELEDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIK-PLI 317

Query: 343 ITPIVTHSTRDNEIDYRITLKSLFPGKLSAKDVTLHIPVPPSTVDCKISVSNGHCKFVPE 402
              +      ++ I+     K+    K +A +V + IPVP          S+G  K+VPE
Sbjct: 318 WCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEIIIPVPDDADTPTFKYSHGSLKYVPE 377

Query: 403 ENAMMWRFNKYNGLTENTLSAVTVSTSDTTQLNLQ--------QWTRPPMSLDFEVMMFS 454
           ++A++W+   + G  E ++SA     S +  +           +  + P+ + F++  F+
Sbjct: 378 KSAILWKLRSFPGGKEYSMSAELGLPSISNDIEGHRAIPKSNAEILKGPVQIKFQIPYFT 437

Query: 455 NSGLVVRYFTIFGKDSKHRAVKWIKYISRSG-SYEVR 490
            SG+ VRY  I     ++++  W++YI++SG  Y +R
Sbjct: 438 TSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIR 474

>ZYRO0C05236g Chr3 complement(408616..409959) [1344 bp, 447 aa] {ON}
           highly similar to uniprot|Q00776 Saccharomyces
           cerevisiae YPL259C APM1 medium subunit of the clathrin-
           associated protein complex
          Length = 447

 Score =  172 bits (435), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 137/504 (27%), Positives = 233/504 (46%), Gaps = 85/504 (16%)

Query: 1   MISGVLIYSSRGELVLNKFFKNSLKRSISDIFR---VQVINNLDVRSPVLTLGSTTFHHI 57
           M+S V     +G  +L++ +++ +  S  D F    +Q+     V  P L+     +  I
Sbjct: 1   MVSAVYFCDGKGRPILSRRYRDDIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQYLFI 60

Query: 58  RSRHGDNLWLVTITRSNA-NSAAIWEFLYKLDFVMNAY-RLDREEALKEEFMIVHEMLDI 115
           +  H D L++V +  S A N A ++ FL+KL  V+  Y +   EE++++ F+I++E+LD 
Sbjct: 61  Q--HND-LYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLDE 117

Query: 116 MLGGNGIPIDTE---LNSVIAQMSVKPVRNTGGLLDSPDGNDMLXXXXXXXXXXGEXXXX 172
           M+   GIP  TE   L   I Q S K ++       +P     +                
Sbjct: 118 MMD-YGIPQITETKMLKQYITQKSFKLMKAVKKSKAAPRPPTEVT--------------- 161

Query: 173 XXXXXXXXXXXGQGDSASDFYDGNKITWRPKGITHKKDEVFLYVNERMNILVSRDGSILK 232
                                  N ++WR   I HKK+E FL + E +N+L+++ G +L+
Sbjct: 162 -----------------------NSVSWRAPNIVHKKNEAFLDIVESINMLMNQQGQVLR 198

Query: 233 SYVDGTIDITTHLSGTPICRFGLND----SLGMQSEDEKKWLAQQQHHSRGNFESKNFIH 288
           S + G I + + LSG P  + G+ND    S  ++ + +    A  +   + N E      
Sbjct: 199 SEIIGQIKVKSKLSGMPDLKLGINDKGIFSKYVEGDSDPVTTAVTEGKKKTNIE------ 252

Query: 289 KAAAGSVLLEDCKFHECVSLDKFNKNHTIEFVPPDGSMELMKYHVRDNINLPFKITPIV- 347
                   LED KFH+CV L KF     I F+PPDG+ ELM Y     +++P K  P++ 
Sbjct: 253 --------LEDLKFHQCVRLSKFENEKIITFIPPDGAFELMNYR----LSMPVK--PLIW 298

Query: 348 ------THSTRDNEIDYRITLKSLFPGKLSAKDVTLHIPVPPSTVDCKISVSNGHCKFVP 401
                  HS    EI  R   ++    +  A  V + IPVP          ++G  K+VP
Sbjct: 299 CDVNVQVHSQSRIEIHCR--ARAQIKKRSIANSVEILIPVPDDADTPSFKYTHGSVKWVP 356

Query: 402 EENAMMWRFNKYNGLTENTLSAVTVSTSDTTQLNLQQWTRPPMSLDFEVMMFSNSGLVVR 461
           ++NA++W+   + G  E ++SA  +       L+  +  R P+ + F++  F+ SG+ VR
Sbjct: 357 QKNAILWKIRSFTGGKEYSMSA-QMGLPSINALDKPKVKR-PVQIKFQIPYFTTSGIQVR 414

Query: 462 YFTIFGKDSKHRAVKWIKYISRSG 485
           Y  I      +++  W++YI++SG
Sbjct: 415 YLKITEPKLLYKSYPWVRYITQSG 438

>NCAS0E02140 Chr5 complement(410049..411494) [1446 bp, 481 aa] {ON}
           Anc_7.127
          Length = 481

 Score =  172 bits (437), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 142/501 (28%), Positives = 242/501 (48%), Gaps = 64/501 (12%)

Query: 1   MISGVLIYSSRGELVLNKFFKNSLKRSISDIFRVQVINNLDVRS----PVLTLGSTTFHH 56
           M S V    S+G  +L + +++ +  S  + F   ++++L+  +    P L+     +  
Sbjct: 32  MASAVYFCDSKGYPLLARRYRDDIPISAIEKFPT-LLSDLEEETNLVPPCLSYNGMQYLF 90

Query: 57  IRSRHGDNLWLVTITRS-NANSAAIWEFLYKL-DFVMNAYRLDREEALKEEFMIVHEMLD 114
           I+  H D ++LV I  S +AN+A I+ FLYKL D + N  +   EE++++ F+I++E+LD
Sbjct: 91  IQ--HND-VYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKTVEEESIRDNFVIIYELLD 147

Query: 115 IMLGGNGIPIDTE---LNSVIAQMSVKPVRNTGGLLDSPDGNDMLXXXXXXXXXXGEXXX 171
             +   GIP  TE   L   I Q S K V+      ++    + L               
Sbjct: 148 ETMD-YGIPQITETKMLKQYITQKSFKLVKAAKKKRNAARPPEALT-------------- 192

Query: 172 XXXXXXXXXXXXGQGDSASDFYDGNKITWRPKGITHKKDEVFLYVNERMNILVSRDGSIL 231
                                   N ++WR   I +KK+E FL + E +N+L+++ G IL
Sbjct: 193 ------------------------NSVSWRSADIKYKKNEAFLDIIESINMLMTQKGQIL 228

Query: 232 KSYVDGTIDITTHLSGTPICRFGLNDSLGMQSEDEKKWLAQQQHHSRGNFESKNFIHKAA 291
           +S + G + + + LSG P  + G+ND  G+ S    K +     ++ G   + +   K  
Sbjct: 229 RSEIIGEVKVKSRLSGMPDLKLGINDK-GIFS----KHMDDDSLNNEGASVASSTTDK-K 282

Query: 292 AGSVLLEDCKFHECVSLDKFNKNHTIEFVPPDGSMELMKYHVRDNIN-LPFKITPIVTHS 350
             ++ LED KFH+CV L KF     I F+PPDG  ELM Y +  +I  L +    I  HS
Sbjct: 283 KNNIELEDLKFHQCVRLSKFETEKIITFIPPDGDFELMNYRLSTSIKPLIWCDMNIQVHS 342

Query: 351 TRDNEIDYRITLKSLFPGKLSAKDVTLHIPVPPSTVDCKISVSNGHCKFVPEENAMMWRF 410
               EI  R   K+    K +A +V + IPVP      +   S+G  K+VPE+N ++W+ 
Sbjct: 343 QSRIEIHCR--AKAQIKKKSTATNVQIIIPVPEDADTPEFKYSHGSIKYVPEKNVIIWKI 400

Query: 411 NKYNGLTENTLSAVTVSTSDTTQLNLQQWTRPPMSLDFEVMMFSNSGLVVRYFTIFGKDS 470
             + G  E ++SA  +       +   +  R P+ + F++  F+ SG+ V+Y  I     
Sbjct: 401 RSFPGGKEYSMSA-QMQLPSIGNIEEHKAKR-PVQIKFQIPYFTTSGIQVKYLKINEPKL 458

Query: 471 KHRAVKWIKYISRSG-SYEVR 490
           ++++  W++YI++SG  Y +R
Sbjct: 459 QYKSYPWVRYITQSGDDYTIR 479

>CAGL0K00539g Chr11 complement(64028..65398) [1371 bp, 456 aa] {ON}
           highly similar to uniprot|Q00776 Saccharomyces
           cerevisiae YPL259c Clathrin coat assembly protein
          Length = 456

 Score =  164 bits (416), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 102/301 (33%), Positives = 162/301 (53%), Gaps = 14/301 (4%)

Query: 196 NKITWRPKGITHKKDEVFLYVNERMNILVSRDGSILKSYVDGTIDITTHLSGTPICRFGL 255
           N ++WRP+GI HKK+E FL + E +N+L+++ G +L+S + G + + + LSG P  + G+
Sbjct: 162 NSVSWRPEGIKHKKNEAFLDIIESINMLMTQKGQVLRSEIIGEVKVKSKLSGMPDLKLGI 221

Query: 256 NDSLGMQSE----DEKKWLAQQQHHSRGNFESKNFIHKAAAGSVLLEDCKFHECVSLDKF 311
           ND  G+ S+    DE          S    + K    K  + ++ LED KFH+CV L KF
Sbjct: 222 NDK-GLFSKYLEGDENGVPIAPDDSSVDESKPK----KKRSNNMELEDLKFHQCVRLSKF 276

Query: 312 NKNHTIEFVPPDGSMELMKYHVRDNIN-LPFKITPIVTHSTRDNEIDYRITLKSLFPGKL 370
                I F+PPDG  ELM Y +   I  L +    I THS    EI  R   K+    K 
Sbjct: 277 ENEKQITFIPPDGDFELMSYRLSTAIKPLIWCDVNIKTHSKSRIEIFCR--AKAQIKKKS 334

Query: 371 SAKDVTLHIPVPPSTVDCKISVSNGHCKFVPEENAMMWRFNKYNGLTENTLSAVTVSTSD 430
           +A +V + IPVP          S+G  K+VPE+NA++W+   + G  E +++A     S 
Sbjct: 335 TATNVEILIPVPEDADTPVFKYSHGSIKYVPEKNAILWKIRTFPGDKEYSMAAEMGLPST 394

Query: 431 TTQLNLQQWTRPPMSLDFEVMMFSNSGLVVRYFTIFGKDSKHRAVKWIKYISRSG-SYEV 489
                 ++  R P+ + F++  F+ SG+ VRY  I  K+ ++++  W++YI++SG  Y +
Sbjct: 395 NAGEESEKLKR-PVQVKFQIPYFTTSGIQVRYLKIEEKNLQYKSYPWVRYITKSGDDYTI 453

Query: 490 R 490
           R
Sbjct: 454 R 454

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 39/132 (29%), Positives = 73/132 (55%), Gaps = 9/132 (6%)

Query: 1   MISGVLIYSSRGELVLNKFFKNSLKRSISDIFRVQVIN---NLDVRSPVLTLGSTTFHHI 57
           M S +    ++G  +L++ +++ +  S  D F + + N     ++  P +      F  I
Sbjct: 1   MASAIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEEETNLIPPCIEHNGIQFLFI 60

Query: 58  RSRHGDNLWLVTITRS-NANSAAIWEFLYKLDFVMNAY-RLDREEALKEEFMIVHEMLDI 115
           +  H D L+LV I  S + N+A I+ FL+K+  V++ Y +   EE++++ F+I++E+LD 
Sbjct: 61  Q--HND-LYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELLDE 117

Query: 116 MLGGNGIPIDTE 127
           M+   GIP  TE
Sbjct: 118 MM-DYGIPQITE 128

>TPHA0C04320 Chr3 (932871..934235) [1365 bp, 454 aa] {ON} Anc_7.127
           YPL259C
          Length = 454

 Score =  155 bits (391), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 97/300 (32%), Positives = 163/300 (54%), Gaps = 17/300 (5%)

Query: 196 NKITWRPKGITHKKDEVFLYVNERMNILVSRDGSILKSYVDGTIDITTHLSGTPICRFGL 255
           N ++WRP+GIT+KK+E FL + E +N+LV++ G +L+S + G + + + LSG P  + G+
Sbjct: 164 NSVSWRPEGITYKKNEAFLDIIESINMLVTQQGQVLRSEIVGAVRVRSRLSGMPDLKLGI 223

Query: 256 NDSLGMQSEDEKKWLAQQQHHSRGNFESKNFIH--KAAAGSVLLEDCKFHECVSLDKFNK 313
           ND  G+ S     +L  ++++  G+  S       +     + LED KFH+CV L KF  
Sbjct: 224 NDR-GIFS----NYL--EENNVDGSSSSTPIPEGVEDKKPQIELEDLKFHQCVRLSKFEN 276

Query: 314 NHTIEFVPPDGSMELMKYHVRDNIN-LPFKITPIVTHSTRDNEIDYRITLKSLFPGKLSA 372
              I F+PPDG  +LM Y +   I  L +    I  HS    EI  R   K+    K  A
Sbjct: 277 EKIITFIPPDGEFDLMNYRLTTPIKPLIWCDVNIQVHSKSRIEIHCR--AKAQIKKKSIA 334

Query: 373 KDVTLHIPVPPSTVDCKISVSNGHCKFVPEENAMMWRFNKYNGLTENTLSA-VTVSTSDT 431
            +V + IPVP      +   S+G  K++PE+NA++W+   + G  E ++SA + + + D 
Sbjct: 335 NNVEILIPVPDDADTPQFRYSHGSIKWLPEKNAILWKLRSFAGGKEYSMSAQLHLPSVDG 394

Query: 432 TQLNLQQWTRPPMSLDFEVMMFSNSGLVVRYFTIFGKDSKHRAVKWIKYISRSGS-YEVR 490
            +       R P+ + F++  F+ SG+ VRY  +     ++++  W++YI++SG  Y +R
Sbjct: 395 VE---PPKVRRPVQVKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQSGEDYTIR 451

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 42/145 (28%), Positives = 81/145 (55%), Gaps = 10/145 (6%)

Query: 1   MISGVLIYSSRGELVLNKFFKNSLKRSISDIFRVQVINNLDVRSPVL--TLGSTTFHHIR 58
           M+SG+    + G+ +L + +++ +  +  D F  Q++  L+  + V+   +     H++ 
Sbjct: 1   MVSGIYFCDNAGKPILARRYRDDISINAIDNFS-QLLLQLEEETGVIPPCIMHKGIHYLF 59

Query: 59  SRHGDNLWLVTITRS-NANSAAIWEFLYKLDFVMNAY-RLDREEALKEEFMIVHEMLDIM 116
            +H D +++V +T S   N A I+ FL++L  V+  Y ++  EE++++ F+I++E+LD M
Sbjct: 60  IKHSD-IYVVALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLDEM 118

Query: 117 LGGNGIPIDTE---LNSVIAQMSVK 138
           +   GIP  TE   L   I Q S K
Sbjct: 119 MDF-GIPQITETKMLKKYITQKSFK 142

>KAFR0L00470 Chr12 complement(85772..87169) [1398 bp, 465 aa] {ON}
           Anc_7.127 YPL259C
          Length = 465

 Score =  154 bits (389), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 88/311 (28%), Positives = 158/311 (50%), Gaps = 24/311 (7%)

Query: 196 NKITWRPKGITHKKDEVFLYVNERMNILVSRDGSILKSYVDGTIDITTHLSGTPICRFGL 255
           N ++WRP+GI +KK+E FL + E +N+L+++ G +L+S + G + + + LSG P  + G+
Sbjct: 162 NSVSWRPEGIKYKKNEAFLDIIESINMLITQKGQVLRSEIVGNVRVKSRLSGMPDLKLGI 221

Query: 256 ND-----------SLGMQSEDEKKWLAQQQHHSRGNFESKNFIHKAAAGSVLLEDCKFHE 304
           ND           ++G+    + +      + S    E  N        ++ LED KFH+
Sbjct: 222 NDRGIFTKYLEGNNIGIAKNGDDEDADDTNNESSIVSEGSN----KRKTNIELEDLKFHQ 277

Query: 305 CVSLDKFNKNHTIEFVPPDGSMELMKYHVRDNINLPFKITPIVTHSTRDNEIDYRITLKS 364
           CV L KF     I F+PPDG  +LM Y +  +I  P     +   + R   I+     K+
Sbjct: 278 CVRLSKFENEKIISFIPPDGEFDLMNYRLSTSIK-PLIWCDVSIQTYR---IEIHCKAKA 333

Query: 365 LFPGKLSAKDVTLHIPVPPSTVDCKISVSNGHCKFVPEENAMMWRFNKYNGLTENTLSAV 424
               K  A +V + IPVP          S+G  K++PE+N ++W+ + + G  E +++A 
Sbjct: 334 QIKKKSIATNVEILIPVPEDADSPIFKYSHGKIKYLPEKNLLLWKISSFPGGKEYSMAAQ 393

Query: 425 ----TVSTSDTTQLNLQQWTRPPMSLDFEVMMFSNSGLVVRYFTIFGKDSKHRAVKWIKY 480
               ++S  D     +   ++ P+ + F++  F+ SG+ VRY  +     +++   W++Y
Sbjct: 394 MGLPSISGEDDLNTRVSNQSKKPVQVKFKIPYFTTSGIQVRYLKVNEPKLQYKTYPWVRY 453

Query: 481 ISRSG-SYEVR 490
           I++SG  Y +R
Sbjct: 454 ITQSGDDYTIR 464

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 69/130 (53%), Gaps = 5/130 (3%)

Query: 1   MISGVLIYSSRGELVLNKFFKNSLKRSISDIFRVQVINNLDVRSPVL--TLGSTTFHHIR 58
           M S V     +G+ +L++ +++ +  S  D F   ++++ +  S +L   +      ++ 
Sbjct: 1   MASAVYFCDHKGKPLLSRKYRDDIPLSAIDKFS-SLLSDKEEESNLLPPCISHNGIQYMF 59

Query: 59  SRHGDNLWLVTITRSNANSAAIWEFLYKLDFVMNAY-RLDREEALKEEFMIVHEMLDIML 117
            +H D       T   AN + I+ FL+K+  V++ Y +   EE++++ F+I++E+LD M+
Sbjct: 60  IQHNDLYLAALATSVQANISLIFAFLHKIIDVLDGYLKTVEEESIRDNFIIIYELLDEMM 119

Query: 118 GGNGIPIDTE 127
              G+P  TE
Sbjct: 120 -DYGLPQITE 128

>Kpol_1062.56 s1062 (126558..127910) [1353 bp, 450 aa] {ON}
           (126558..127910) [1353 nt, 451 aa]
          Length = 450

 Score =  150 bits (380), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 93/299 (31%), Positives = 160/299 (53%), Gaps = 14/299 (4%)

Query: 196 NKITWRPKGITHKKDEVFLYVNERMNILVSRDGSILKSYVDGTIDITTHLSGTPICRFGL 255
           N ++WR +GI +KK+E +L + E +N+L+++ G +L+S + G + + + LSG P  + G+
Sbjct: 162 NSVSWRQEGIKYKKNEAYLDIIESINMLMNQQGQVLRSEIIGEVKVKSRLSGMPDLKLGI 221

Query: 256 NDSLGMQSEDEKKWLAQQQHHSRG-NFESKNFIHKAAAGSVLLEDCKFHECVSLDKFNKN 314
           ND  G+ S    K+L  ++  S+     + +        ++ LED KFH+CV L KF   
Sbjct: 222 NDK-GIFS----KYLENEEDFSKPVQIINDDSTTNGKKSNIELEDLKFHQCVRLSKFENE 276

Query: 315 HTIEFVPPDGSMELMKYHVRDNIN-LPFKITPIVTHSTRDNEIDYRITLKSLFPGKLSAK 373
             I F+PPDG  ELM Y +   I  L +    I  HS    EI  R   K+    K  A 
Sbjct: 277 KIITFIPPDGEFELMNYRLTTPIKPLIWCDINIQVHSKSRIEIHCR--AKAQIKKKSIAN 334

Query: 374 DVTLHIPVPPSTVDCKISVSNGHCKFVPEENAMMWRFNKYNGLTENTLSA-VTVSTSDTT 432
           +V + IPVP          S+G  K++PE+NA++W+   + G  E +++A + + + D  
Sbjct: 335 NVEILIPVPDDADTPTFKYSHGSIKWLPEKNAILWKLRSFAGGKEYSMTAQLGLPSVDGI 394

Query: 433 QLNLQQWTRPPMSLDFEVMMFSNSGLVVRYFTIFGKDSKHRAVKWIKYISRSG-SYEVR 490
           +       + P+ + F++  F+ SG+ VRY  I     ++++  W++YI++SG  Y +R
Sbjct: 395 E---PPKVKRPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSFPWVRYITQSGDDYTIR 450

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 45/145 (31%), Positives = 80/145 (55%), Gaps = 10/145 (6%)

Query: 1   MISGVLIYSSRGELVLNKFFKNSLKRSISDIFRVQVINNLDVRSPVL--TLGSTTFHHIR 58
           M+SGV    + G+ +L++ +++ +  S  D F  Q++   +  S V+   L     H++ 
Sbjct: 1   MVSGVYFCDASGKPILSRRYRDDIPLSAIDKFS-QILLEHEEESSVVPPCLLYQGIHYLF 59

Query: 59  SRHGDNLWLVTITRS-NANSAAIWEFLYKLDFVMNAY-RLDREEALKEEFMIVHEMLDIM 116
            +H D +++V +T S   N A I+ FL++L  V+  Y +   EE++++ F+I++E+LD M
Sbjct: 60  IQHSD-IYVVALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDNFVIIYELLDEM 118

Query: 117 LGGNGIPIDTE---LNSVIAQMSVK 138
           +   GIP  TE   L   I Q S K
Sbjct: 119 M-DYGIPQITETKMLKQYITQKSFK 142

>KLTH0D07502g Chr4 (650799..652313) [1515 bp, 504 aa] {ON} similar
           to uniprot|P38700 Saccharomyces cerevisiae YHL019C APM2
           homologous to the medium chain of mammalian
           clathrin-associated protein complex Similar to clathrin
           coat proteins
          Length = 504

 Score = 92.8 bits (229), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 76/332 (22%), Positives = 142/332 (42%), Gaps = 81/332 (24%)

Query: 198 ITWRPKGITHKKDEVFLYVNERMNILVS-RDGSILKSYVDGTIDITTHLSGTPICRFGLN 256
           I+WRPKGI + K+E+F+ + ER + L+  ++  + +++V G I+  ++LSG PI R  +N
Sbjct: 193 ISWRPKGIYYTKNELFVDIIERQSYLMDFKNSQVRQTFVYGKINCRSYLSGMPIVRVCIN 252

Query: 257 DSLGMQSEDEKKWLAQQQHHSRGNFESKNFIHKAAAGSVLLEDCKFHECVSLDKFNKNHT 316
             L                                   + L   KFH+CVSL+  +    
Sbjct: 253 KML-------------------------------KDKDLFLGSSKFHQCVSLESLSSQDY 281

Query: 317 IEFVPPDGSMELMKYHVRDNINLPFKITPIVTHSTRDNEIDYR----ITLKSLFPGKLSA 372
           IEF+PPDG  +L +Y ++ +IN    I  ++ +   + +  +R    +T++  F  + SA
Sbjct: 282 IEFIPPDGDFQLCEYKLKRHIN-DSPIIKLIDYKINERQKKHRLHLSVTIQPHFKAQNSA 340

Query: 373 KDVTLHIPVPPSTVDCKISVS--------NGHCKFVPEENAMMWRFNKYNGLTENTLSAV 424
             + +HIP      + KI ++        +G   F   +  ++W      G    T  ++
Sbjct: 341 TALKIHIPTRDLFQNYKIDLTKAPRFKCDHGSVFFNLSDELLLWDAQGIKGGHGETSYSM 400

Query: 425 TVSTS----DTTQLNLQQWTR----PPM----------------------------SLDF 448
            V  +    +     L+Q  +    PP+                            + +F
Sbjct: 401 HVEFALFDEEEHARKLEQIKKSMDPPPLREGAHLEELYAQVKSNKEGKGQFQSNAITAEF 460

Query: 449 EVMMFSNSGLVVRYFTIFGKDSKHRAVKWIKY 480
           EV  +++SGL V Y  I  ++ K+++  W++Y
Sbjct: 461 EVPYYTSSGLRVEYLKISEENLKYQSFSWVRY 492

>Kwal_26.8146 s26 (665689..667206) [1518 bp, 505 aa] {ON} YHL019C
           (APM2) - Similiar to clathrin coat proteins [contig 55]
           FULL
          Length = 505

 Score = 82.0 bits (201), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 99/476 (20%), Positives = 182/476 (38%), Gaps = 98/476 (20%)

Query: 63  DNLWLVTITRSNANSAAIWEFLYKLDFVMNAYRLDREEALK-----EEFMIVHEMLDIML 117
           D L+ V+++  +  S+ +   +Y  DF M   +  R  AL      + F +++E+LD  L
Sbjct: 58  DGLYFVSMSVGSLRSSIMSTLVYLNDFHMLLKKYLRVNALDRTRIVDNFNLIYELLDESL 117

Query: 118 GGNGIPIDTELNSVIAQMSVKPVRNTGGLLDSPDGNDMLXXXXXXXXXXGEXXXXXXXXX 177
              GIP  T+ N +   + ++P        + P    +            E         
Sbjct: 118 DF-GIPQLTDFNIIRDSIKIQP--------NIPPDPKIARSNSDDDESEQEESNVAETQE 168

Query: 178 XXXXXXGQGDSA--SDFY---DGNKITWRPKGITHKKDEVFLYVNE-RMNILVSRDGSIL 231
                  Q D    + F        I+WRPKGI + K+E+F+ V E +  ++  +   + 
Sbjct: 169 KSNKHGFQDDEEYINSFVLRTTTQAISWRPKGIYYAKNELFVDVIESQAYVMDFKHHQVR 228

Query: 232 KSYVDGTIDITTHLSGTPICRFGLNDSLGMQSEDEKKWLAQQQHHSRGNFESKNFIHKAA 291
           K+++ G I   ++LSG P+ +  +N  L                  R  F          
Sbjct: 229 KNFIFGRIICRSYLSGMPVVKICINKMLK----------------DRDQF---------- 262

Query: 292 AGSVLLEDCKFHECVSLDKFNKNHTIEFVPPDGSMELMKYHVRDNINLPFKITPI---VT 348
                L   KFH+CVSL+  +    IEF+PPDG  +L +Y ++ +I+    I  I   V 
Sbjct: 263 -----LSSAKFHQCVSLESLSSQDFIEFIPPDGDFQLCEYKIKRHISDSPVIKLIEYKVV 317

Query: 349 HSTRDNEIDYRITLKSLFPGKLSAKDVTLHIPVPPSTVDCKISVSN--------GHCKFV 400
              + +++   + ++  F  + SA  + + +P+       KI ++         G   F 
Sbjct: 318 EKPKKHKLQISMKIQPHFKAQNSATFLDIRVPIQDIFETYKIDLTKQPRFKCDFGSILFN 377

Query: 401 PEENAMMWRFNKYNGLTENTLSAVTV-------STSDTTQLNLQQWTRPP---------- 443
             +  ++W+ N   G    T  ++ V                L+    PP          
Sbjct: 378 LSDGYLLWKANGMKGGHGETYHSMQVEFFLFDAEAHRKEAEELKNSMDPPPLREGVRMEE 437

Query: 444 -------------------MSLDFEVMMFSNSGLVVRYFTIFGKDSKHRAVKWIKY 480
                              ++ +FEV  F++SGL V Y  I  +  ++++  W++Y
Sbjct: 438 LYALAHEEKGQINNPVRNMITAEFEVPYFTSSGLRVEYLKIEEEQLQYQSFPWVRY 493

>SAKL0D13090g Chr4 (1093315..1094814) [1500 bp, 499 aa] {ON} weakly
           similar to uniprot|P38700 Saccharomyces cerevisiae
           YHL019C APM2 homologous to the medium chain of mammalian
           clathrin-associated protein complex Similar to clathrin
           coat proteins
          Length = 499

 Score = 77.8 bits (190), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 72/329 (21%), Positives = 137/329 (41%), Gaps = 74/329 (22%)

Query: 198 ITWRPKGITHKKDEVFLYVNERMNILVSRDGS-ILKSYVDGTIDITTHLSGTPICRFGLN 256
           I+WRPKGI + K+E FL V E +   +  + S I K++V G I   ++LSG P  + GL+
Sbjct: 187 ISWRPKGIHYTKNEFFLDVIEEIEYCMDFNKSKIRKNFVHGRIRCRSYLSGMPKLKIGLS 246

Query: 257 DSLGMQSEDEKKWLAQQQHHSRGNFESKNFIHKAAAGSVLLEDCKFHECVSLDKFNKNHT 316
                  ++ +++                           + + KFH+CVSL+   KN  
Sbjct: 247 KITSSLPKEREQF---------------------------MNNAKFHQCVSLEDLQKN-I 278

Query: 317 IEFVPPDGSMELMKY----HVRDNINLPFKITPIVTHSTRDNEIDYRITLKSLFPGKLSA 372
           + F+PPDG  +L +Y    HVRD   +      +     +  +I   +T+ + F  + S 
Sbjct: 279 VSFIPPDGEFQLCEYKLKRHVRDPPVIKLVKFDVKKEEKKRPKILISLTITTDFKSQNST 338

Query: 373 KDVTLHIPVPPSTVDCKISVS--------NGHCKFVPEENAMMWRFNKYNG---LTENTL 421
             + + IP+     + +I ++         G+  F   ++ ++W      G    TE+++
Sbjct: 339 SVLNIRIPLTKIFSEYQIDLAKPPRFKCDQGNVLFNLTDDLLLWEVGSIKGGHAQTEHSM 398

Query: 422 -SAVTVSTSDTTQLNLQQWTR----PPM-------------------------SLDFEVM 451
                +   +  +  L++       PP+                         S++FE+ 
Sbjct: 399 YCEFRLYDEEEYKKQLEELKNSMDPPPLRQGPKLEELYKQVHENENTNRSRLVSMEFEIP 458

Query: 452 MFSNSGLVVRYFTIFGKDSKHRAVKWIKY 480
            ++ SGL V+Y  I     ++ +  W++Y
Sbjct: 459 YYTCSGLKVQYLKIEEDQLQYHSFPWVRY 487

>KLLA0F25432g Chr6 complement(2365434..2366957) [1524 bp, 507 aa]
           {ON} some similarities with uniprot|P38700 Saccharomyces
           cerevisiae YHL019C APM2 homologous to the medium chain
           of mammalian clathrin-associated protein complex Similar
           to clathrin coat proteins
          Length = 507

 Score = 76.6 bits (187), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 76/350 (21%), Positives = 132/350 (37%), Gaps = 102/350 (29%)

Query: 198 ITWRPKGITHKKDEVFLYVNERMNILVS-RDGSILKSYVDGTIDITTHLSGTPICRFGLN 256
           ++WRPKGI + K+E FL V E++  ++   +G +  + ++GTI   ++LSG P    GLN
Sbjct: 179 VSWRPKGIHYGKNEFFLDVIEKLEFIMDFEEGVVRNNVINGTIICRSYLSGMPQLSIGLN 238

Query: 257 DSLGMQSEDEKKWLAQQQHHSRGNFESKNFIHKAAAGSVLLEDCKFHECVSLDKFNKNHT 316
                        L Q+  H                    ++  KFHECV L    K  +
Sbjct: 239 K------------LMQKNVH-------------------FMKRLKFHECVDLHTLIKEES 267

Query: 317 --IEFVPPDGSMELMKYHVRDNINLPFKITPIVTHST--------RDNEIDYRITLKSL- 365
             I+F+PPDG  EL  Y     +N P    P++   +        ++ E   ++ LK+  
Sbjct: 268 PVIKFIPPDGEFELCNY----KLNRPLLDEPVIKLQSFGLSQKPRKNQETQDKLLLKAAI 323

Query: 366 ---FPGKLSAKDVTLHIPVPPSTVDCKISVSN--------GHCKFVPEENAMMWRFNKYN 414
              F  + SAK++ + IP+        I +          G   F     +++W+ N   
Sbjct: 324 TTHFKAQDSAKELLIKIPIKSVIRKWNIDLEKPPLFKSDIGDVVFDITAGSIIWKINNLK 383

Query: 415 GLTENTLSAVTV-------STSDTTQLNLQQWTRPP------------------------ 443
           G   N    +            +  ++ L+    PP                        
Sbjct: 384 GGHGNKNYGLKCMFEIWDRQIHEALEVQLRNSMDPPPLRTGPKLERIWDQYHGKTTEYDG 443

Query: 444 -------------MSLDFEVMMFSNSGLVVRYFTIFGKDSKHRAVKWIKY 480
                        +++ FE+  ++ SGL V YF I      +++  W++Y
Sbjct: 444 NENQKEDVDKFALIAMSFEIPYYAVSGLKVEYFKIEEPQLNYQSFPWVRY 493

>Ecym_4591 Chr4 complement(1154444..1155949) [1506 bp, 501 aa] {ON}
           similar to Ashbya gossypii ABR047W
          Length = 501

 Score = 76.6 bits (187), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 80/337 (23%), Positives = 128/337 (37%), Gaps = 88/337 (26%)

Query: 198 ITWRPKGITHKKDEVFLYVNERMNILVSRDGSILKS-YVDGTIDITTHLSGTPICRFGLN 256
           I+WRPKGI + K+E +L V E +  LV      +KS  V G I   ++LSG P+   GLN
Sbjct: 187 ISWRPKGIHYNKNEFYLDVIEHLEYLVDFQCMNIKSNTVYGYIQCRSYLSGMPMLTIGLN 246

Query: 257 DSLGMQSEDEKKWLAQQQHHSRGNFESKNFIHKAAAGSVLLEDCKFHECVSLDKFNKNHT 316
                                + N E++ F+ +A           FH+CV+LD+   +  
Sbjct: 247 ---------------------KLNSENEYFMRRA----------NFHQCVNLDQLTTDKL 275

Query: 317 IEFVPPDGSMELMKYHVRDNINLP---------FKITPIVTHSTRDNEIDYRITLKSLFP 367
           I F PPDG  +L  Y +  N++ P          K+ P  T    D  I   +T+ + F 
Sbjct: 276 ISFTPPDGEFQLCNYKLTRNMSDPPMIKLEDCKVKLKPRKTKDGLDRLI-LAVTISTYF- 333

Query: 368 GKLSAKDVTLHIPVPPSTV----------DCKISVSNGHCKFVPEENAMMWRFNKYNG-- 415
            KL      L+I VP S V            +     G   F   ++ ++W   K  G  
Sbjct: 334 -KLQDSTSLLNIKVPLSKVFRDWDVDLSYQPRFKCEQGKVMFNITDDYLLWEVGKVKGGH 392

Query: 416 ------------------------LTENTLSAVTVST--------SDTTQLNLQQWTRPP 443
                                      N++    +            T +LN        
Sbjct: 393 GDKTLKMQSEFHLHNREHEARIKQQLSNSMDPKPIRRGPHLEKLYQQTHELNSPTSEAAL 452

Query: 444 MSLDFEVMMFSNSGLVVRYFTIFGKDSKHRAVKWIKY 480
           + ++FE+  ++ SGL V +  I  K  + ++  W++Y
Sbjct: 453 LKVEFEIPYYTISGLKVEFLKIEEKQLQFQSFPWVRY 489

>TPHA0I02390 Chr9 (528997..530676) [1680 bp, 559 aa] {ON} Anc_2.555
           YHL019C
          Length = 559

 Score = 75.5 bits (184), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 61/234 (26%), Positives = 109/234 (46%), Gaps = 31/234 (13%)

Query: 198 ITWRPKGITHKKDEVFLYVNERMNILVS-RDGSILKSYVDGTIDITTHLSGTPICRFGLN 256
           ++WR KGI + K+E FL V E +  L++ +D  I ++ + G I   ++LSG P  R  LN
Sbjct: 225 VSWRTKGIYYAKNEFFLDVVESVQYLMNFKDKVIRRNLIHGQIKCKSYLSGMPTLRIALN 284

Query: 257 DSLGMQSEDEKKWLAQQQHHSRGNFESKNFIHKAAAGSVLLEDCKFHECVSLDKFNKNHT 316
             L    +D+K++L   + H   +  S N          L +D +    +S   F     
Sbjct: 285 KIL----QDDKQFLGHAKFHQCVSLNSINI-------KDLEKDLEGPNDISNKNFVNKKE 333

Query: 317 IEFVPPDGSMELMKYHVRDNINLPFKITPIVTHSTRDNEIDYR-------ITLKSLFPGK 369
           IEF+PPDG   L +Y +R ++  P    P++  ++ D + +++       + +++ F  +
Sbjct: 334 IEFIPPDGEFVLCQYELRRHVKDP----PVINMTSFDIKPNFKKFRVQISLKIETHFKRQ 389

Query: 370 LSAKDVTLHIPVPPSTVDCKISVSN--------GHCKFVPEENAMMWRFNKYNG 415
            S   +T+ IP+     D KI +S         G   F   E+ ++W  +   G
Sbjct: 390 NSTSLMTIKIPLLQLFNDYKIDLSKQPRFKSDVGKVLFNISEDFLIWEIDALKG 443

>KAFR0A02060 Chr1 (428640..430262) [1623 bp, 540 aa] {ON} Anc_2.555
           YHL019C
          Length = 540

 Score = 75.5 bits (184), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 76/346 (21%), Positives = 132/346 (38%), Gaps = 91/346 (26%)

Query: 198 ITWRPKGITHKKDEVFLYVNERMNILVSRDGSILK-SYVDGTIDITTHLSGTPICRFGLN 256
           ++WR KGI + K+E FL V E++   +    +I+K + + G I   + LSG P  +  LN
Sbjct: 223 VSWRAKGIQYAKNEFFLDVIEKVEYFMDFSNNIIKKNLIHGEIICKSFLSGMPTLKVSLN 282

Query: 257 DSLGMQSEDEKKWLAQQQHHSRGNFESKNFIHKAAAGSVLLEDCKFHECVSLDKFNKNHT 316
             +                     ++ K F          L  CKFH+CV  D  ++   
Sbjct: 283 KII---------------------YQDKQF----------LSSCKFHQCVMPDSVDEGKV 311

Query: 317 IEFVPPDGSMELMKYHVRDNIN-LPFKITPIVTHSTRDNEIDYR----ITLKSLFPGKLS 371
           +EFVPPDG   L KY ++ ++N LP  +  ++++  +     Y+    +T++S F    S
Sbjct: 312 LEFVPPDGDFVLCKYELKRHVNDLP--LLKLISYEVKPKLDKYKLKLFVTIESTFKKTNS 369

Query: 372 AKDVTLHIPVPPSTVDCKISVS--------NGHCKFVPEENAMMWRFNKYNGLTENTLSA 423
              + + IP+        I +S         G   F   ++ ++W      G        
Sbjct: 370 TTKLNIKIPLKVLLEKYDIDLSKNIKSRCDEGKILFNVSDDFLLWEIGAMKGGNSQLKMG 429

Query: 424 VTVSTSDTTQLNLQQ------WTRPPM--------------------------------- 444
              +  +  +   QQ         PP+                                 
Sbjct: 430 ADFALFNEEEYLRQQEELKTSMNPPPLRTGPKLEELYKQIHEEKCNNFTRKGESSDETKG 489

Query: 445 ---SLDFEVMMFSNSGLVVRYFTIFGKDSKHRAVKWIKY--ISRSG 485
               +DFE+   ++SGL V Y  I   + +++A  W++Y  IS  G
Sbjct: 490 NLIKMDFEIPYNTSSGLKVEYLKIEEPNLQYQAFPWVRYKTISDDG 535

>CAGL0K03223g Chr11 (296371..298167) [1797 bp, 598 aa] {ON} similar
           to uniprot|P38700 Saccharomyces cerevisiae YHL019c
           involved in clathrin-independent transport
          Length = 598

 Score = 73.6 bits (179), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 66/242 (27%), Positives = 108/242 (44%), Gaps = 45/242 (18%)

Query: 198 ITWRPKGITHKKDEVFLYVNERMNILVSRD-GSILKSYVDGTIDITTHLSGTPICRFGLN 256
           ++WR KGI + K+E FL V E++  LV  + G + +S + G I   ++LSG P  +  LN
Sbjct: 249 VSWRAKGIHYAKNEFFLDVIEKLQYLVDLESGMVRRSLIHGQIVCRSYLSGMPKLKMSLN 308

Query: 257 DSLGMQSEDEKKWLAQQQHHSRGNFES-KNFIHKAAAGSVLLEDCKFHECVSLDKFNKNH 315
             L    +++K++++Q Q H   + +S +  I  A   S  L+  K  E       N   
Sbjct: 309 KLL----QNDKQFISQVQFHQCVSLDSIEKVIKYAEEHSDELKTLKHTE------HNAES 358

Query: 316 TIEFVPPDGSMELMKYHVRDNINLP-------FKITP------------IVTHSTRDN-- 354
            IEF+PPDG   L  Y ++ +I  P       F+ITP            + TH    N  
Sbjct: 359 EIEFIPPDGDFTLCSYELKRHIRDPPMVKLCSFEITPKWKKYKLKISAAVETHFKPTNST 418

Query: 355 -EIDYRITLKSLFPGKLSAKDVTLHIPVPPSTVDCKISVSNGHCKFVPEENAMMWRFNKY 413
            ++D +I +  +F      KD  + +  P      K   SNG   +   ++ ++W     
Sbjct: 419 SKLDVKIPISKVF------KDYQIDLKKP-----IKFKTSNGRVVYNISDDFLLWEIGVI 467

Query: 414 NG 415
            G
Sbjct: 468 KG 469

>TBLA0B06760 Chr2 (1594957..1596930) [1974 bp, 657 aa] {ON}
           Anc_2.555 YHL019C
          Length = 657

 Score = 73.2 bits (178), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 67/245 (27%), Positives = 103/245 (42%), Gaps = 52/245 (21%)

Query: 198 ITWRPKGITHKKDEVFLYVNERMNILVS-RDGSILKSYVDGTIDITTHLSGTPICRFGLN 256
           I+WR KGI + K+E FL V E+   ++  ++  I K+ + G I     LSG P  +  LN
Sbjct: 287 ISWRTKGIYYAKNEFFLDVLEKQEYIMDFKNDLIRKNLIQGKIICRCFLSGMPKLKIALN 346

Query: 257 DSLGMQSEDEKKWLAQQQHHSRGNFESKNFIHKAAAGSVLLEDCKFHECVSLDKFNKNHT 316
                      K L + Q                      L   +FH+CVSL+   +N  
Sbjct: 347 -----------KLLQKDQQ--------------------FLSQLRFHQCVSLETI-QNKE 374

Query: 317 IEFVPPDGSMELMKY----HVRD--NINL-PFKITPIVTHSTRDNEIDYRITLKSLFPGK 369
           IEF+PPDG   L +Y    HV+D  NI L  F+I P      +  +I   +++ + F  +
Sbjct: 375 IEFIPPDGEFILCEYELKRHVKDPPNIKLISFEIKP----KLKKFKIQINLSITTFFKVQ 430

Query: 370 LSAKDVTLHIPVPPSTVDCKISVSN--------GHCKFVPEENAMMWRFNKYNGLTENTL 421
            S   + L IP+     D KI +          G  KF   ++ ++W      G     +
Sbjct: 431 NSTSILNLKIPLEKLFNDYKIDLKKSPRFKSNIGQVKFNLSDDFLLWEIGSMKGGHGENI 490

Query: 422 SAVTV 426
            A+T 
Sbjct: 491 KAMTA 495

 Score = 32.0 bits (71), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 37/70 (52%), Gaps = 3/70 (4%)

Query: 414 NGLTENTLSAVTVSTSDTTQLNLQQW--TRPP-MSLDFEVMMFSNSGLVVRYFTIFGKDS 470
           N  T  + S V   TS   ++ L++    +P  +++DFE+  ++ SGL V Y  I  +  
Sbjct: 576 NIATPASTSVVKNDTSSNKEIPLKKALSNKPQYLTVDFEIPYYACSGLKVEYLKIEEEQL 635

Query: 471 KHRAVKWIKY 480
            +++  W++Y
Sbjct: 636 LYQSFPWVRY 645

>ZYRO0E05874g Chr5 (452910..454559) [1650 bp, 549 aa] {ON} similar
           to uniprot|P38700 Saccharomyces cerevisiae YHL019C APM2
           homologous to the medium chain of mammalian
           clathrin-associated protein complex Similar to clathrin
           coat proteins
          Length = 549

 Score = 71.2 bits (173), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 78/335 (23%), Positives = 133/335 (39%), Gaps = 85/335 (25%)

Query: 198 ITWRPKGITHKKDEVFLYVNERMNILVS-RDGSILKSYVDGTIDITTHLSGTPICRFGLN 256
           ++WR KGI + K+E FL V E++  L   ++  + K+ + G I   ++LSG P  +  LN
Sbjct: 236 VSWRAKGIHYGKNEFFLDVVEKVQYLADFKEKVVRKNLIHGKIYCKSYLSGMPKLKIALN 295

Query: 257 DSLGMQSEDEKKWLAQQQHHSRGNFESKNFIHKAAAGSVLLEDCKFHECVSLDKFNKNHT 316
             L           AQ   HS                       KFH+CV+L+  N+   
Sbjct: 296 KLLQRD--------AQFMSHS-----------------------KFHQCVALETLNEKE- 323

Query: 317 IEFVPPDGSMELMKYHVRDNIN-LP-FKITPI-VTHSTRDNEIDYRITLKSLFPGKLSAK 373
           +EF+PPDG   L +Y ++ ++N  P  KIT   +    +  ++   +T+++ F  + S  
Sbjct: 324 LEFIPPDGEFILCEYELKRHVNDTPILKITSFEIKPQLKKFKLRILLTIETHFKTRNSTS 383

Query: 374 DVTLHIPVPPSTVDCKISVSN--------GHCKFVPEENAMMWR---------------- 409
            + + IP+     D  I +S         G   F   ++ ++W                 
Sbjct: 384 ILNVKIPLAKLFADYNIDLSKPTRFKSAAGQVLFNLSDDFLLWEIGQMRGGHGETQFSMV 443

Query: 410 -----FNKY-------------------NGLTENTLSAVTVSTSDTTQLNLQQWTRPPMS 445
                FNK                     G     L A T S  D   L ++      + 
Sbjct: 444 AEFSLFNKEEFEREQEERKHSMNPPPLREGPKLEELYAQTHSQKDPEVL-VKSIQSQLVG 502

Query: 446 LDFEVMMFSNSGLVVRYFTIFGKDSKHRAVKWIKY 480
           +DFE+   + SGL V Y  I  +  ++++  W++Y
Sbjct: 503 MDFEIPYTTCSGLKVEYLKIEEEQLQYQSFPWVRY 537

>Kpol_1056.13 s1056 complement(30531..32156) [1626 bp, 541 aa] {ON}
           complement(30531..32156) [1626 nt, 542 aa]
          Length = 541

 Score = 70.1 bits (170), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 79/348 (22%), Positives = 133/348 (38%), Gaps = 99/348 (28%)

Query: 198 ITWRPKGITHKKDEVFLYVNERMNILVS-RDGSILKSYVDGTIDITTHLSGTPICRFGLN 256
           ++WR KGI + K+E FL V E++  L+    G I K+ + G I    +LSG P  +  LN
Sbjct: 216 VSWRTKGIYYAKNEFFLDVIEKVQYLMDFSTGRIRKNLIHGEIKCKCYLSGMPTLKVALN 275

Query: 257 DSLGMQSEDEKKWLAQQQHHSRGNFESKNFIHKAAAGSVLLEDCKFHECVSLDKFNK--- 313
               +   DE+                             + + KFH+CVS++   +   
Sbjct: 276 ---KLIKNDEQ----------------------------FISNSKFHQCVSINSLKREIN 304

Query: 314 ---------NHTIEFVPPDGSMELMKY----HVRDNINLP-FKITPI-VTHSTRDNEIDY 358
                       IEF+PPDG   L KY    HVRD   +P  K++ I +    +  +I  
Sbjct: 305 NEEEENTYHGKEIEFIPPDGEFVLCKYELKRHVRD---VPVIKLSNIEIKPKLKKYKIQI 361

Query: 359 RITLKSLFPGKLSAKDVTLHIPVPPSTVDCKISVSN--------GHCKFVPEENAMMWRF 410
            +T+++ F  + S   +T+ IP+       KI ++         G   F   ++ ++W  
Sbjct: 362 HVTIETHFKKQNSTSVLTIKIPLRMVFSQYKIDLTKQPRFKSDFGEVLFNISDDFLIWEV 421

Query: 411 NKY---NGLTENTLSA----VTVSTSDTTQLNLQQWTRPP-------------------- 443
                 NG ++N + A          D  Q  ++    PP                    
Sbjct: 422 GSMKGGNGESKNNMVAEFFIFNQEEYDRLQEEMKTSMNPPPLREGPKLEEIYEQTHDNRD 481

Query: 444 -----------MSLDFEVMMFSNSGLVVRYFTIFGKDSKHRAVKWIKY 480
                      +++ FEV   + SGL V Y  I      +++  W++Y
Sbjct: 482 EHDKNGISQQLLTMKFEVPYSTCSGLKVEYLKIEENQVNYQSFPWVRY 529

>Skud_8.26 Chr8 complement(55759..57549) [1791 bp, 596 aa] {ON}
           YHL019C (REAL)
          Length = 596

 Score = 69.7 bits (169), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 83/348 (23%), Positives = 134/348 (38%), Gaps = 81/348 (23%)

Query: 198 ITWRPKGITHKKDEVFLYVNERMNILVS-RDGSILKSYVDGTIDITTHLSGTPICRFGLN 256
           I+WR KGI + K+E FL V ER+  L+    G I K+ + G I   ++LSG P  +  +N
Sbjct: 253 ISWRTKGIHYAKNEFFLDVIERVQYLMDFEKGIIRKNLIHGEIVCRSYLSGMPKLKISIN 312

Query: 257 DSLGMQSEDEKKWLAQQQHHSRGNFESKNFIHKAAAGSVLLEDCKFHECVSLDKFNKNHT 316
             L      + ++++    H   + +S N I K         D +     + D       
Sbjct: 313 KILNR----DPQFMSNSNFHQCVSLDSINTIEKGQEKEQNTGDSQ----AAADA----RE 360

Query: 317 IEFVPPDGSMELMKY----HVRDN--INLP-FKITPIVTHSTRDNEIDYRITLKSLFPGK 369
           IEFVPPDG   L +Y    HV+D   I L  F+I P +  S    +I     +++ F   
Sbjct: 361 IEFVPPDGEFVLCQYELKRHVKDAPMIKLKDFEIKPKLKKS----KIQILTKIQTNFKPT 416

Query: 370 LSAKDVTLHIPVPPSTVDCKISVS--------NGHCKFVPEENAMMWRFNKYNGLTENTL 421
            S   + + IP+     D KI +S        NG   F   ++ ++W      G  E   
Sbjct: 417 NSTSKLNVKIPLTRVFQDYKIDLSKQIRFKANNGKVVFNLSDDFLLWEIQTMKGHRERNA 476

Query: 422 SAVTVSTSDTTQ----------LNLQQWTR-----------PPM---------------- 444
           S       D +            N +++ R           PP+                
Sbjct: 477 SNAPQDDGDPSTCASMVAEFSLFNQEEYDRLQEEMKTSMNPPPLRTGPKLEELYNQVHDK 536

Query: 445 ------------SLDFEVMMFSNSGLVVRYFTIFGKDSKHRAVKWIKY 480
                       S+DFE+   + SGL V Y  +     ++++  W++Y
Sbjct: 537 HTPHVTPRDRLVSIDFEIPYCTCSGLKVEYLKVEEPQLQYQSFPWVRY 584

>NCAS0A12650 Chr1 (2492345..2494111) [1767 bp, 588 aa] {ON}
           Anc_2.555 YHL019C
          Length = 588

 Score = 67.8 bits (164), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 78/339 (23%), Positives = 137/339 (40%), Gaps = 68/339 (20%)

Query: 198 ITWRPKGITHKKDEVFLYVNERMNILVS-RDGSILKSYVDGTIDITTHLSGTPICRFGLN 256
           I+WR KGI + K+E FL V E++   +  + G I K+ + G I   ++LSG P  +  +N
Sbjct: 250 ISWRTKGIHYGKNEFFLDVIEKVEYFMDFKSGVIRKNLIHGEIICRSYLSGMPKLKISIN 309

Query: 257 DSLGMQSEDEKKWLAQQQHHSRGNFESKNFIHKAAAGSVLLEDCKFHECVSLDKFNKNHT 316
             L    + + ++L+  + H   + +S   I   +    + ED K  +    D       
Sbjct: 310 KIL----KQDVQFLSNVKFHQCVSLDS---IRARSNPPAVEEDGK-KKNEEADTLGNKGE 361

Query: 317 IEFVPPDGSMELMKY----HVRDNINLP---FKITPIVTHSTRDNEIDYRITLKSLFPGK 369
           IEF+PPDG   L KY    HV+D   +    F+I P + H  +   I   + +++ F   
Sbjct: 362 IEFIPPDGEFLLCKYELKRHVKDQPMIKLRNFEIIPKL-HKFK---IKIHVIIETHFKTT 417

Query: 370 LSAKDVTLHIPVPPSTVDCKISVS--------NGHCKFVPEENAMMWRFNKYN-GLTENT 420
            S   + L IP+       +I +S         G   F   +  ++W     N G  ENT
Sbjct: 418 NSTSKLNLRIPITNLFQSYRIDLSKQPKFKCEQGTVLFNLSDKFLLWEVGTMNGGHGENT 477

Query: 421 LSAVTV---------------------------------------STSDTTQLNLQQWTR 441
           LS +                                            D+ +++ ++   
Sbjct: 478 LSMMAEFALFNEEEYKKMEEERKTSMNPPPLREGPKLEELYKKIHEEGDSDEVSTRKKNE 537

Query: 442 PPMSLDFEVMMFSNSGLVVRYFTIFGKDSKHRAVKWIKY 480
             +++DFEV   + SGL + Y  I     ++++  W++Y
Sbjct: 538 SLLTMDFEVPYCTCSGLKIEYLKIEEDQLQYQSFPWVRY 576

>KNAG0C05550 Chr3 complement(1076437..1078185) [1749 bp, 582 aa]
           {ON} Anc_2.555 YHL019C
          Length = 582

 Score = 66.6 bits (161), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 75/358 (20%), Positives = 137/358 (38%), Gaps = 104/358 (29%)

Query: 198 ITWRPKGITHKKDEVFLYVNERMNILVSRDGSIL-KSYVDGTIDITTHLSGTPICRFGLN 256
           I+WR KGI + K+E FL V E++   +    +++ K+ + G I     LSG P  +  +N
Sbjct: 253 ISWRTKGIHYAKNEFFLNVIEKVEYFMDFTQNVIKKNLIHGEIRCKCFLSGMPNLKVSIN 312

Query: 257 DSLGMQSEDEKKWLAQQQHHSRGNFESKNFIHKAAAGSVLLEDCKFHECVSLDKF--NKN 314
             +     ++K++LA                           +CKFH+CVSL     + +
Sbjct: 313 KIVN----EDKQFLA---------------------------NCKFHQCVSLASLESSDH 341

Query: 315 HTIEFVPPDGSMELMKY----HVRDNINLP---FKITPIVTHSTRDNEIDYRITLKSLFP 367
             +EFVPPDG   L +Y    HVRD   +    F++ P +            +T+++ F 
Sbjct: 342 KDVEFVPPDGEFTLCRYELKRHVRDEPMVKLVNFEVKPKLKKFKLKL----LLTIETHFK 397

Query: 368 GKLSAKDVTLHIPVPPSTVDCKISVSN--------GHCKFVPEENAMMWRFNKYNGLTEN 419
              +   + L +P+     + ++ +S         G   F   ++ ++W     +G    
Sbjct: 398 TTNATSKLALRVPIKQLFREYRVDLSKNLKSKCDRGAILFNISDDFLLWEVGSMSGGHGE 457

Query: 420 TLSAVTVSTS-------DTTQLNLQQWTRPP----------------------------- 443
           T  ++ V  +       D  Q  L+    PP                             
Sbjct: 458 TQLSMGVEFALFNQEEYDREQEMLKTSMNPPPLREGPKLEELYKQIHEDDDDDDGNTEPV 517

Query: 444 ---------------MSLDFEVMMFSNSGLVVRYFTIFGKDSKHRAVKWIKYISRSGS 486
                          +++DFEV   ++SGL V Y  I     ++++  W++Y + S +
Sbjct: 518 AEHRLQPRTREIDKLLTMDFEVPYCTSSGLRVEYLKIEEPQLEYQSFPWVRYTTLSDA 575

>Suva_8.33 Chr8 complement(69735..71525) [1791 bp, 596 aa] {ON}
           YHL019C (REAL)
          Length = 596

 Score = 66.2 bits (160), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 83/355 (23%), Positives = 135/355 (38%), Gaps = 94/355 (26%)

Query: 198 ITWRPKGITHKKDEVFLYVNERMNILVS-RDGSILKSYVDGTIDITTHLSGTPICRFGLN 256
           I+WR KGI + K+E FL V ER+  L+    G I K+ + G I    +LSG P  +  +N
Sbjct: 252 ISWRTKGIHYSKNEFFLDVIERVQYLMDFEKGIIRKNLIHGEIVCRCYLSGMPKLKISIN 311

Query: 257 DSLGMQSEDEKKWLAQQQHHSRGNFESKNFIHKAA-----AGSVLLEDCKFHECVSLDKF 311
             L      + ++++  + H   + +S N I +       AGS    D K          
Sbjct: 312 KLLNR----DPQFMSNSKFHQCVSLDSINIIEEEGRDTDDAGSQTATDTK---------- 357

Query: 312 NKNHTIEFVPPDGSMELMKY----HVRDN--INLP-FKITPIVTHSTRDNEIDYRITLKS 364
                IEF+PPDG   L +Y    HV+D   I L  F+I P      +  +I     +++
Sbjct: 358 ----EIEFIPPDGEFVLCQYELKRHVKDAPMIKLQGFEIKP----KLKKFKIQIITKIQT 409

Query: 365 LFPGKLSAKDVTLHIPVPPSTVDCKISVSN--------GHCKFVPEENAMMWRFNKYNGL 416
            F    S   + + IP+     D KI +S         G   F   ++ ++W      G 
Sbjct: 410 NFKPTNSTSKLNVKIPLTKVFQDYKIDLSKQIRFKANLGKVVFNLSDDFLLWEIGTMKGH 469

Query: 417 TE------------NTLSAVTV-------STSDTTQLNLQQWTRPP-------------- 443
            E            +TL+++            D  Q  L+    PP              
Sbjct: 470 RERNTGTVPQEDDASTLASMVAEFPLFNQEEYDRLQEELKTSMNPPPLRTGPKLEELYKQ 529

Query: 444 ------------------MSLDFEVMMFSNSGLVVRYFTIFGKDSKHRAVKWIKY 480
                             +S+DFE+   + SGL V Y  +     ++++  W++Y
Sbjct: 530 VHEERVLHTHDVAPRDKLVSVDFEIPYCTCSGLKVEYLKVEEPQLQYQSFPWVRY 584

>ABR047W Chr2 (479283..480779) [1497 bp, 498 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHL019C (APM2)
          Length = 498

 Score = 65.5 bits (158), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 44/144 (30%), Positives = 70/144 (48%), Gaps = 32/144 (22%)

Query: 196 NKITWRPKGITHKKDEVFLYVNERMNILVSRDGSILK-SYVDGTIDITTHLSGTPICRFG 254
           + I+WRP+GI + K+E FL V E +  L+  + + ++ + V G I+  ++LSG P    G
Sbjct: 183 SAISWRPRGIYYSKNEFFLDVVEELEYLMDFERAQVRLNQVHGAINCRSYLSGMPQLTVG 242

Query: 255 LNDSLGMQSEDEKKWLAQQQHHSRGNFESKNFIHKAAAGSVLLEDCKFHECVSLDKFNKN 314
           LN           K +AQ +     +F S+  +H             FH+CV L++   +
Sbjct: 243 LN-----------KMVAQDR-----DFTSQ--VH-------------FHQCVDLERLATD 271

Query: 315 HTIEFVPPDGSMELMKYHVRDNIN 338
             I FVPPDG  +L  Y +    N
Sbjct: 272 RHITFVPPDGEFQLCHYKLARGAN 295

>TDEL0B06430 Chr2 (1137277..1138854) [1578 bp, 525 aa] {ON}
           Anc_2.555 YHL019C
          Length = 525

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 72/331 (21%), Positives = 129/331 (38%), Gaps = 81/331 (24%)

Query: 198 ITWRPKGITHKKDEVFLYVNERMNILVS-RDGSILKSYVDGTIDITTHLSGTPICRFGLN 256
           ++WR KGI + ++E FL V E++  L+    G I K+ + G I   ++LSG P  +   N
Sbjct: 216 VSWRAKGIHYARNEFFLDVVEQVQYLMDFNSGIIKKNLIHGKIICKSYLSGMPKLKIAFN 275

Query: 257 DSLGMQSEDEKKWLAQQQHHSRGNFESKNFIHKAAAGSVLLEDCKFHECVSLDKFNKNHT 316
               +  +DE+                             +   KFH+CV+    N+   
Sbjct: 276 ---KLSQKDEQ----------------------------FISHSKFHQCVTWPSSNEKE- 303

Query: 317 IEFVPPDGSMELMKY----HVRDNINLPFKITPIVTHSTRDNEIDYRITLKSLFPGKLSA 372
           IEF+PPDG   L +Y    HV+D   L   ++  V    +  +I    T+++ F  + S 
Sbjct: 304 IEFIPPDGDFVLCQYELKRHVKDQPMLKL-VSFGVKPKLKKYKIQMSCTIETHFKARNST 362

Query: 373 KDVTLHIPVPPSTVDCKISVS--------NGHCKFVPEENAMMWRFNKYNGLTENTLSAV 424
             + L IP+     + +I +         +G   F   ++ ++W      G   +T  ++
Sbjct: 363 STLNLKIPLARLFQEYQIDLKKPARFKSDSGKVLFNISDDFLLWDIEVMKGGHGDTQLSM 422

Query: 425 TVSTS-------DTTQLNLQQWTRPP----------------------------MSLDFE 449
               S       +  Q  L+    PP                            +S+ FE
Sbjct: 423 AAEFSLFNKKEFEEEQEELKNSMNPPPLRDGPKLEELYDQVHNEKGPSKMASRLLSMKFE 482

Query: 450 VMMFSNSGLVVRYFTIFGKDSKHRAVKWIKY 480
           +   + SGL V Y  I  +  ++++  W++Y
Sbjct: 483 IPYSTCSGLQVEYLKIDEEQLQYQSFPWVRY 513

>NDAI0B01610 Chr2 complement(384287..386305) [2019 bp, 672 aa] {ON}
           Anc_2.555 YHL019C
          Length = 672

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 55/234 (23%), Positives = 107/234 (45%), Gaps = 26/234 (11%)

Query: 198 ITWRPKGITHKKDEVFLYVNERMNILVS-RDGSILKSYVDGTIDITTHLSGTPICRFGLN 256
           I+WR KGI + K+E FL V E++   +    G I K+ + G I    +LSG P  +  +N
Sbjct: 295 ISWRTKGIHYAKNEFFLDVIEKVEYFMDFEKGLIRKNLIHGEIVCKCYLSGMPKLKISIN 354

Query: 257 DSLGMQSEDEKKWLAQQQHHSRGNFESKNFIHKAAAGSVLLEDCKFHECVSLDKFNKNHT 316
             L    +++ ++L+    H   + +S +   ++A      ++   +E  + D+ ++   
Sbjct: 355 KIL----QNDSQFLSNAHFHQCVSLDSLHL--QSAEDDDGDDNANVNENENHDERDRKKE 408

Query: 317 IEFVPPDGSMELMKYHVRDNI-NLP------FKITPIVTHSTRDNEIDYRITLKSLFPGK 369
           IEF+PPDG   L KY ++ ++ +LP      F I P ++      ++   + +++ F   
Sbjct: 409 IEFIPPDGDFLLCKYELKRHVKDLPVIKLKLFDIKPKLSKY----KLKIHVIIETHFKTT 464

Query: 370 LSAKDVTLHIPVPPSTVDCKISVS--------NGHCKFVPEENAMMWRFNKYNG 415
            +   + L IP+     + +I +S         G   F   +N ++W      G
Sbjct: 465 NNTSKLNLKIPIERLFQEYRIDLSKQIKFKCDQGKVLFNLSDNFLIWEIGSMKG 518

 Score = 35.0 bits (79), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 17/68 (25%), Positives = 35/68 (51%), Gaps = 2/68 (2%)

Query: 415 GLTENTLSAVTVSTSDTTQLNLQQWTRPP--MSLDFEVMMFSNSGLVVRYFTIFGKDSKH 472
           G  E T +    +  +    +L++ TR P  + +DFE+  ++ SGL + Y  I     ++
Sbjct: 593 GSQEATGTHARKTKEERKDKDLRKRTRSPNLLKIDFEIPYYTCSGLKIEYLKIEEPQLQY 652

Query: 473 RAVKWIKY 480
           ++  W++Y
Sbjct: 653 QSFPWVRY 660

>YHL019C Chr8 complement(67731..69548) [1818 bp, 605 aa] {ON}
           APM2Protein of unknown function, homologous to the
           medium chain of mammalian clathrin-associated protein
           complex; involved in vesicular transport
          Length = 605

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 77/351 (21%), Positives = 134/351 (38%), Gaps = 83/351 (23%)

Query: 198 ITWRPKGITHKKDEVFLYVNERMNILVS-RDGSILKSYVDGTIDITTHLSGTPICRFGLN 256
           I+WR KGI + K+E FL V ER+  L+    G I K+ + G I    +LSG P  +  +N
Sbjct: 258 ISWRTKGIHYAKNEFFLDVIERVQYLMDFEKGVIRKNLIHGEIVCRCYLSGMPKLKISIN 317

Query: 257 DSLGMQSEDEKKWLAQQQHHSRGNFESKNFIHKAAAGSVLLEDCKFHECVSLDKFNKNHT 316
             L      + ++++    H   + +S N I K        E+    +   L        
Sbjct: 318 KILNR----DPQFMSNSSFHQCVSLDSINTIEKD-------EEKNSDDDAGLQAATDARE 366

Query: 317 IEFVPPDGSMELMKY----HVRDN--INLP-FKITPIVTHSTRDNEIDYRITLKSLFPGK 369
           IEF+PPDG   L +Y    HV+D   + L  F+I P      +  +I     +++ F   
Sbjct: 367 IEFIPPDGEFVLCQYELKRHVKDAPMVRLKDFEIKP----KLKKFKIQIVTKIQTNFKPT 422

Query: 370 LSAKDVTLHIPVPPSTVDCKISVSN--------GHCKFVPEENAMMWRFNKYNGLTENTL 421
            S   + + IP+     + KI +S         G   F   ++ ++W      G  E++ 
Sbjct: 423 NSTSKLNVRIPLTKVFQEYKIDLSKQIRFKANIGKVVFNLSDDFLLWEIQTMKGHREHST 482

Query: 422 SAVTVSTSDTTQ-------------LNLQQWTR-----------PPM------------- 444
           +  +   SD                 N +++ R           PP+             
Sbjct: 483 NKSSQYNSDEDDPNTCASMVAEFPLFNQEEYDRLQEEMKTSMNPPPLRTGPRLEELYRQV 542

Query: 445 ---------------SLDFEVMMFSNSGLVVRYFTIFGKDSKHRAVKWIKY 480
                          ++DFE+   + SGL V Y  +     ++++  W++Y
Sbjct: 543 HDQQTSHVTPRDKLVNIDFEIPYCTCSGLKVEYLKVEEPQLQYQSFPWVRY 593

>Smik_8.23 Chr8 complement(51372..53183) [1812 bp, 603 aa] {ON}
           YHL019C (REAL)
          Length = 603

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 77/352 (21%), Positives = 132/352 (37%), Gaps = 81/352 (23%)

Query: 198 ITWRPKGITHKKDEVFLYVNERMNILVS-RDGSILKSYVDGTIDITTHLSGTPICRFGLN 256
           I+WR KGI + K+E FL V ER+  L+    G I K+ + G I    +LSG P  +  +N
Sbjct: 260 ISWRTKGIHYAKNEFFLDVIERVQYLMDFEKGIIRKNLIHGEIVCRCYLSGMPKLKISIN 319

Query: 257 DSLGMQSEDEKKWLAQQQHHSRGNFESKNFIHKAAAGSVLLEDCKFHECVSLDKFNKNHT 316
             L   ++    +L+    H   + +S   I K           K  +   L        
Sbjct: 320 KILNRDAQ----FLSNSSFHQCVSLDSIKTIEKREE--------KEDDDTGLQAAADAKE 367

Query: 317 IEFVPPDGSMELMKY----HVRDN--INLP-FKITPIVTHSTRDNEIDYRITLKSLFPGK 369
           +EFVPPDG   L +Y    HV+D   I L  F+I P      +  +I     +++ F   
Sbjct: 368 LEFVPPDGEFVLCQYELKRHVKDAPMIKLKDFQIKP----KLKKFKIQIETKIQTNFKPT 423

Query: 370 LSAKDVTLHIPVPPSTVDCKISVSN--------GHCKFVPEENAMMWRFNKYNGLTE--- 418
            S   + + IP+     + +I +S         G   F   ++ ++W      G  E   
Sbjct: 424 NSTSKLNVKIPLTKVFQEYRIDLSKQIRFKSNIGKVVFNLSDDFLLWEIQAMKGHREHNT 483

Query: 419 -------NTLSAVTVSTSDTTQLNLQQWTR-----------PPM---------------- 444
                  N   A     ++    N +++ R           PP+                
Sbjct: 484 NKTSQDDNDPDACASMVAEFPLFNQEEYDRLQEEKKTSMNPPPLRTGPRLEELYRQVHDQ 543

Query: 445 ------------SLDFEVMMFSNSGLVVRYFTIFGKDSKHRAVKWIKYISRS 484
                       ++DFE+   + SGL + Y  +     ++++  W++Y + S
Sbjct: 544 QIAHVTPRDKLVAIDFEIPYCTCSGLKIEYLKVEEPQLQYQSFPWVRYKTTS 595

>KLTH0D06556g Chr4 complement(570972..572342) [1371 bp, 456 aa] {ON}
           similar to uniprot|P38153 Saccharomyces cerevisiae
           YBR288C APM3 Mu3-like subunit of the yeast AP-3 complex
           which functions in transport of alkaline phosphatase to
           the vacuole via the alternate pathway clathrin
           associated protein medium chain
          Length = 456

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 71/319 (22%), Positives = 128/319 (40%), Gaps = 74/319 (23%)

Query: 198 ITWRPKGITHKKDEVFLYVNERMNILVSRD---GSI--LKSYVDGTIDITTHLSGTPICR 252
           + WR  G+ +  +E+++ V E +++++ ++   G +  ++  +DG +D  +HLSG P+  
Sbjct: 186 VPWRSAGVKYSNNELYVDVVETVHVILRKNEKTGELTSVRGVLDGVVDFRSHLSGNPVIA 245

Query: 253 FGL---NDSLGMQSEDEKKWLAQQQHHSRGNFESKNFIHKAAAGSVLLEDCKFHECVSLD 309
             L      LGM +                                       H+C  LD
Sbjct: 246 LNLRLRGHDLGMPA--------------------------------------LHQCC-LD 266

Query: 310 KFN-KNHTIEFVPPDGSMELMKYHVR-DNINLPFKITPIVTHSTRDNEIDYRITLKSL-- 365
            +  +   + FVPPDG  +LM Y +  D++    K+   +   +     DYR  L  L  
Sbjct: 267 SYQGRPDQLRFVPPDGKFQLMHYSIDLDSLQSKSKLFSNIGLVSP----DYRTELGDLGD 322

Query: 366 -------FPGKLSAK---DVTLHIPVPPSTVDCKISV---SNGHCKFVPEENAMMWRFNK 412
                    G   AK   D+ + +   P   +CKI V   ++GH +     N   W F+K
Sbjct: 323 EFEVNLNIAGSQHAKVVDDLVITLSFGPLPSECKIKVLRSTHGHFENCASNNIGKWVFDK 382

Query: 413 YNGLTENTLSAVTVSTSDTTQLNLQQWTRPPMSLDFEVMMFSNSGLVVRYFTIFGKDSKH 472
                  TL  +     + T+   +Q     +S+ +       SG+ V    I    SK+
Sbjct: 383 ET--PTGTLPVLRGCLENATR---EQVRALQLSVSYTNRGELPSGIKVDSVDILSGLSKN 437

Query: 473 -RAVKWIKYISRSGSYEVR 490
            +  K +KYI+++G + +R
Sbjct: 438 IKPFKGVKYIAKTGDFHLR 456

>KLLA0E18789g Chr5 (1669103..1670596) [1494 bp, 497 aa] {ON} similar
           to uniprot|P38153 Saccharomyces cerevisiae YBR288C APM3
           Mu3-like subunit of the yeast AP-3 complex which
           functions in transport of alkaline phosphatase to the
           vacuole via the alternate pathway clathrin associated
           protein medium chain
          Length = 497

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 40/148 (27%), Positives = 62/148 (41%), Gaps = 46/148 (31%)

Query: 194 DGNKITWRPKGITHKKDEVFLYVNERMNILVSRDGSILKSYVDGTIDITTHLSGTPIC-- 251
           D + + WR  GI +  +E+F+ ++E +N +V + G +L  ++ G ID+  HLSG P+   
Sbjct: 206 DESGVPWRMSGINYANNEIFIDMSEEINAIVEK-GKLLTGHIKGCIDLNNHLSGQPLVEM 264

Query: 252 RFGLNDSLGMQSEDEKKWLAQQQHHSRGNFESKNFIHKAAAGSVLLEDCKFHECVSLDKF 311
           + GL D                              HK +       +  FH C+  DK 
Sbjct: 265 KLGLLD------------------------------HKLSH-----LNTTFHRCILEDKA 289

Query: 312 N--------KNHTIEFVPPDGSMELMKY 331
           N        K   + FVPPDG   L +Y
Sbjct: 290 NSINDLIAGKFTKLTFVPPDGRTRLCQY 317

>KAFR0D03560 Chr4 complement(695693..697060) [1368 bp, 455 aa] {ON}
           Anc_2.522 YBR288C
          Length = 455

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 73/339 (21%), Positives = 136/339 (40%), Gaps = 77/339 (22%)

Query: 185 QGDSASDFYDGNKITWRPKGITHKKDEVFLYVNERMNILVSRDG------SILKSYVDGT 238
           +G + S   D   + WR K I   ++E+++ V E + + + +         +L  Y++G+
Sbjct: 160 KGQAPSKTVDNEVVPWRSKEIKTVRNEIYVDVKETLYVTLIKSNRASHRLKLLNGYINGS 219

Query: 239 IDITTHLSGTPICRFGLNDSLGMQSEDEKKWLAQQQHHSRGNFESKNFIHKAAAGSVLLE 298
           + + + + G P+                          S G  + K+ I           
Sbjct: 220 VSVDSSIGGVPMLEV-----------------------SFGGCDFKDIIP---------- 246

Query: 299 DCKFHECVSLDKF--NKNHTIEFVPPDGSMELMKYHV-----RDNINLPFKITPIVTHST 351
             KFH+CV +++F  N  + I+F+PPDG  +LM+Y +      DN+ +    T  + +S 
Sbjct: 247 --KFHDCVEVNEFLTNDGNIIKFIPPDGKFQLMEYSMALSSFNDNL-ISCNFTNGLGNSN 303

Query: 352 RDNEIDYRITLKSLFPGKLSAKDVTLHIPVPPSTVDCKISVSNGHCKFVPEENAMMWRFN 411
            + EI   I   +  P K++   V L+          KI + N H +F   +N   W F+
Sbjct: 304 DEFEITLNINKSNKVP-KINNLQVCLNFENREGQSKVKI-LRNTHGRFEYGKNT--WIFD 359

Query: 412 KYNGLTENTLSAVTVSTSDTTQ-----------LNLQQWTRPP-----MSLDFEVMMFSN 455
             + L   TL  +     + T+             +    RP      MS  +E  +   
Sbjct: 360 --SELLTGTLPVLRGCVEEETKNEEDGGIDGEGRRILSKLRPELRSVIMSFQYEGQL--P 415

Query: 456 SGLVVRYFTIFGKDS----KHRAVKWIKYISRSGSYEVR 490
           SG  V    I    +    + +  K +KY++++ +YE+R
Sbjct: 416 SGTRVSSINIRNDSTSNPQRQQLFKGVKYVTKTSNYEIR 454

>Kwal_26.7957 s26 complement(586544..587914) [1371 bp, 456 aa] {ON}
           YBR288C (APM3) - clathrin associated protein medium
           chain [contig 55] FULL
          Length = 456

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 64/313 (20%), Positives = 117/313 (37%), Gaps = 62/313 (19%)

Query: 198 ITWRPKGITHKKDEVFLYVNERMNILV---SRDGSIL--KSYVDGTIDITTHLSGTPICR 252
           + WR  G+ +  +E+++ V E +++++    + G ++  +  +DG +D  +HL+G P+  
Sbjct: 186 VPWRTAGLKYSNNELYVDVVETIHVILRKTEKSGQLVPVRGLIDGYVDFRSHLTGNPVVA 245

Query: 253 FGLNDSLGMQSEDEKKWLAQQQHHSRGNFESKNFIHKAAAGSVLLEDCKFHECVSLDKFN 312
             LN                              +H    G   L     H C       
Sbjct: 246 LKLN------------------------------LHGHDLGVPAL-----HPCCQAQYTG 270

Query: 313 KNHTIEFVPPDGSMELMKYHVR-----------DNINLPFKITPIVTHSTRDNEIDYRIT 361
               ++FVPPDG   LM+Y +             N+ L   +   V      +E + ++ 
Sbjct: 271 SPENLQFVPPDGKFRLMQYTIDLEALQTKSKLFSNMGL-VSLDYFVGLGDLRDEFEIKVN 329

Query: 362 LKSLFPGKLSAKDVTLHIPVPPSTVDCKISV---SNGHCKFVPEENAMMWRFNKYNGLTE 418
           +      KL   D+ + I     T DC+I     ++GH +   E N   W F+K     E
Sbjct: 330 IAGSQHVKL-IDDLVVTIKFGKLTSDCRIKALRSTHGHFENGFENNIGKWSFDK-----E 383

Query: 419 NTLSAVTVSTSDTTQLNLQQWTRPPMSLDFEVMMFSNSGLVVRYFTIF-GKDSKHRAVKW 477
                V V          +Q     +++ +       SG+ V    I  G     +  K 
Sbjct: 384 TPTGTVPVFRGCLENATPEQIKTLSLAISYSNKGSLPSGIKVGAVDIISGLPKNTKPFKG 443

Query: 478 IKYISRSGSYEVR 490
           +KY++R+G + +R
Sbjct: 444 VKYVARTGQFNLR 456

>TDEL0A02970 Chr1 complement(532395..533885) [1491 bp, 496 aa] {ON}
           Anc_2.522 YBR288C
          Length = 496

 Score = 47.0 bits (110), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 73/339 (21%), Positives = 128/339 (37%), Gaps = 100/339 (29%)

Query: 198 ITWRPKGITHKKDEVFLYVNERMNILVSRDG----------SILKSYVDGTIDITTHLSG 247
           + WR  G+ +  +E+++ + E ++++  + G           ++   ++G   +  +LSG
Sbjct: 211 VPWRTAGLKYSNNELYVDLTESIHVVYQKAGKRSRRTSSKLEMICGTINGQASVKCYLSG 270

Query: 248 TPICRFGLN---DSLGMQSEDEKKWLAQQQHHSRGNFESKNFIHKAAAGSVLLEDCKFHE 304
            P     L+   + LG+ +                                      FHE
Sbjct: 271 NPTVDLQLDLAGNDLGVPA--------------------------------------FHE 292

Query: 305 CVSLDKFN--KNHTIEFVPPDGSMELMKYHVRDNINLPFKITPIVTHSTRDNEIDYRITL 362
           CV LD      N  + F+PPDG   LM+Y    +I+L    TP +  + R N     +T+
Sbjct: 293 CVELDNHQNPSNCDLRFIPPDGRFNLMQY----SIDLD---TPRIQQTRRFNHTVGLVTI 345

Query: 363 KSLFPGKLSAKDVTLHIPV-------------------------PPSTVDCKISV-SNGH 396
              F  +L  K     I V                           S  D KI V  N H
Sbjct: 346 D--FADQLGNKTDEFEITVNISNSREVANIEDLRIDVQLQSNTDEDSETDFKIKVLRNTH 403

Query: 397 CKF----VPEENAMMWRFNKYNGLTENTLSAVTVSTSDTTQLNLQQWTRPPMSLDFEVMM 452
            +F    VP + +  W F+K        +    V +++   L +Q+ T    SL  ++  
Sbjct: 404 GRFDNSVVPGQGS--WIFDKDTPTGTLPVLRGCVESTEPRLLRVQRVT-ASYSLSGQLA- 459

Query: 453 FSNSGLVVRYFTIFGKDSK-HRAVKWIKYISRSGSYEVR 490
              SG+ V+   I    +K +R  K +KY +++G +E+R
Sbjct: 460 ---SGIRVKAINIGQLTTKSNRPFKGVKYATKTGDFEIR 495

>SAKL0A09218g Chr1 complement(802348..803734,803809..803843) [1422
           bp, 473 aa] {ON} similar to uniprot|P38153 Saccharomyces
           cerevisiae YBR288C APM3 Mu3-like subunit of the yeast
           AP-3 complex which functions in transport of alkaline
           phosphatase to the vacuole via the alternate pathway
           clathrin associated protein medium chain
          Length = 473

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 72/335 (21%), Positives = 128/335 (38%), Gaps = 83/335 (24%)

Query: 186 GDSASDFYDGNKITWRPKGITHKKDEVFLYVNERMNILVS--RDGSIL---KSYVDGTID 240
           G S S       + WR  G+ +  +E+++ + E +NI+++  R+ + L      +DG + 
Sbjct: 192 GSSVSYANRDRTVPWRSAGVKYTNNELYVDMAETVNIILAKTRNSTSLVPISGSIDGEVG 251

Query: 241 ITTHLSGTPICRFGLNDS---LGMQSEDEKKWLAQQQHHSRGNFESKNFIHKAAAGSVLL 297
              +LS  P+    LN +   LG+ +                                  
Sbjct: 252 FKCYLSENPLVELDLNTNGHDLGIPA---------------------------------- 277

Query: 298 EDCKFHECVSLDKFN-KNHTIEFVPPDGSMELMKYHV-------RDNINLPFKITPIVTH 349
               FH CV  +  +    T+ F+PPDG   LM+Y++       R+ I     +  +  H
Sbjct: 278 ----FHRCVRTEGSDFHPGTLRFIPPDGDFCLMEYNIDLDSLRNRNKILSNLGLVSVDYH 333

Query: 350 S---TRDNEIDYRITLKSLFPGKLSAKDVTLHIPVPPSTVDCKISV-SNGHCKFVPEENA 405
           +    + +E + ++T+ +L       +D+ + +   P   D KI +  N H  F   EN 
Sbjct: 334 TGLGPKKDEFEIKVTV-ALSRNVKHVEDLKIDVHFDPLREDGKIKILRNTHGGF---ENG 389

Query: 406 M----MWRFNKYNGLTENTLSAVTVSTSDTTQLNLQQWTRPPMSLDFEVMMFSN-----S 456
           +     W F+K     E  +    V            W +      +  M +SN     S
Sbjct: 390 INNKGTWTFDK-----ETPVGVFPVLRGCIEGCTEPTWPK------YLSMSYSNKGQLPS 438

Query: 457 GLVVRYFTIF-GKDSKHRAVKWIKYISRSGSYEVR 490
           G+ V    I  G  +  +  K +KYI++ G Y VR
Sbjct: 439 GIRVNSVNILSGFPAGVKPFKGVKYITKIGDYVVR 473

>AGL061W Chr7 (593647..594882) [1236 bp, 411 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR288C (APM3)
          Length = 411

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 71/330 (21%), Positives = 119/330 (36%), Gaps = 90/330 (27%)

Query: 195 GNKITWRPKGITHKKDEVFLYVNERMNILVSRDGS---ILKSYVDGTIDITTHLSGTPIC 251
           G  + WR     +  +E+++ + E +N  + + GS   ++   + G ID+  +LSG P  
Sbjct: 137 GQTVPWRTADCRYVNNEIYVDLVETVNATLRQKGSSLTLINGSLSGKIDVKCYLSGNPTV 196

Query: 252 RFGLNDSLGMQSEDEKKWLAQQQHHSRGNFESKNFIHKAAAGSVLLEDCKFHECVSLDKF 311
           +  L  S                 H                    L++   H CV L + 
Sbjct: 197 QLKLRTS----------------GHP-------------------LDNSALHRCVELGEA 221

Query: 312 NKNHTIEFVPPDGSMELMKYHV---------RDNINL----------------PFKITPI 346
               T+ FVPPDG   L +Y +         R   NL                 F+I  I
Sbjct: 222 GV-ATMNFVPPDGRFTLAEYAIDLSAISQAARRLTNLGLVTVSLASGLGQHRDEFEIKVI 280

Query: 347 VTHSTRDNEI-DYRITLKSLFPGKLSAKDVTLHIPVPPSTVDCKISVSNGHCKFVPEENA 405
           + +ST+   I D RIT+   FP    A  + +            +  ++G  +       
Sbjct: 281 IGNSTQVAAIEDLRITV--YFPDISDAAKIKI------------LRTTHGGWESDLSRVR 326

Query: 406 MMWRFNKYNGLTENTLSAVTVSTSDTTQLNLQQWTRPPMSLDFEVMMFSNSGLV---VRY 462
            +W F+K   +    +    V   ++T         PP+      + +S+ G +   +R 
Sbjct: 327 GVWAFDKQTAVGSVPVLRGCVENPESTP------HAPPVFPSHLAVSYSHVGQLPSGIRV 380

Query: 463 FTIFGKD--SKHRAVKWIKYISRSGSYEVR 490
            TI   D     +  K +KY SR+G Y VR
Sbjct: 381 DTIALSDLPPGSKPFKGVKYTSRAGDYIVR 410

>Kpol_1018.42 s1018 (137162..138889) [1728 bp, 575 aa] {ON}
           (137162..138889) [1728 nt, 576 aa]
          Length = 575

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 38/154 (24%), Positives = 60/154 (38%), Gaps = 55/154 (35%)

Query: 200 WRPKGITHKKDEVFLYVNE-----------RMNILVSRDGSILK---SYVDGTIDITTHL 245
           WR + + H  +E+++ + E           R N L     SI K    Y+ GT  + + L
Sbjct: 203 WRSQNVKHNNNEIYIDLVESVHVVYQTKIRRSNELTRSKQSIKKIVNGYLKGTAYVQSFL 262

Query: 246 SGTPICRFGLNDSLGMQSEDEKKWLAQQQHHSRGNFESKNFIHKAAAGSVLLEDCKFHEC 305
           +G P+    L  S                    GN    +  H +           FHEC
Sbjct: 263 NGNPLVELQLELS--------------------GN----DIGHPS-----------FHEC 287

Query: 306 VSLDKFNKN------HTIEFVPPDGSMELMKYHV 333
           V +D++ KN       +++F+PPDG   LM Y +
Sbjct: 288 VDIDEYLKNIDNSSISSLKFIPPDGKFTLMDYTI 321

>TBLA0I00620 Chr9 complement(110231..112060) [1830 bp, 609 aa] {ON}
           Anc_2.522 YBR288C
          Length = 609

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 34/158 (21%), Positives = 70/158 (44%), Gaps = 41/158 (25%)

Query: 198 ITWRPKGITHKKDEVFLYVNERMNILVSRDGS------------------ILKSYVDGTI 239
           + WR   + +  +E+++ V E ++++  R  S                  ++++ + G +
Sbjct: 256 VPWRSGNVKYTNNEIYIDVIEEIHVVYQRRNSKRYHKINQFNRNDNSPMKLIRADIIGEL 315

Query: 240 DITTHLSGTPICRFGLNDSLGMQSEDEKKWLAQQQHHSRGNFESKNFIHKAAAGSVLLED 299
           ++ ++LS  P+    L D     S+ +  W             S+N + K     + +  
Sbjct: 316 NVRSYLSDNPMVEVTLVDR--NYSDQKTGW-------------SENDLFKQLNLGLPM-- 358

Query: 300 CKFHECVSLD---KFNKN-HTIEFVPPDGSMELMKYHV 333
             FH+CV +D     N++   I+F+PPDG   LMKY++
Sbjct: 359 --FHDCVEIDYEKGINQDFRHIKFIPPDGKFSLMKYNI 394

>CAGL0L02145g Chr12 (252110..253741) [1632 bp, 543 aa] {ON} similar
           to uniprot|P38153 Saccharomyces cerevisiae YBR288c APM3
           AP-3 complex subunit mu3 subunit
          Length = 543

 Score = 37.4 bits (85), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 47/171 (27%), Positives = 71/171 (41%), Gaps = 32/171 (18%)

Query: 302 FHECV---SLDKFNKNHTIEFVPPDGSMELMKYHVRDNINLPFKITPIVTHSTRDNEIDY 358
           FH+CV   SL K  K   + F+PPDG   LM+Y    NINL       V     D E D+
Sbjct: 314 FHDCVDKTSLLKQEKISKLSFIPPDGRFTLMQY----NINLDQGKRHSVGLVHADIE-DH 368

Query: 359 RITLKSLFPGKLSAKDVTLHIPVPPSTVDCKISVSNGHCKFVPEENAMMWRFNKYNGLTE 418
             TL   F       +VTL+I    S             K + +   M+     Y GL+ 
Sbjct: 369 LGTLGDEF-------EVTLNISSSTS------------VKHIEDMEVML-----YFGLSH 404

Query: 419 NTLSAVTVSTSDTTQLNLQQWTRPPMSLDFEVMMFSNSGLVVRYFTIFGKD 469
                 T  +SD  + +++Q+   P+ +    +   +SG+  R   +F K+
Sbjct: 405 GNRKKDTHLSSDEEEFSVEQFRIKPLQITHGRLENMSSGVHKRSKWVFDKE 455

>TPHA0C04130 Chr3 complement(886804..888405) [1602 bp, 533 aa] {ON}
           Anc_2.522 YBR288C
          Length = 533

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 37/152 (24%), Positives = 66/152 (43%), Gaps = 34/152 (22%)

Query: 193 YDGN-KITWRPKGITHKKDEVFLYVNERMNILVSRDGSILKSYVDGTIDITT-HLSGTPI 250
           +D N  + WR + + H  +E++L + E +++++        SY + T+ I T ++ G  +
Sbjct: 196 FDSNVAVPWRMRNVDHVNNELYLDLVESIHVVLETKKR-KSSYANSTMKIVTGNIIGKAL 254

Query: 251 CRFGLNDSLGMQSEDEKKWLAQQQHHSRGNFESKNFIHKAAAGSVLLEDCKFHECVS--- 307
            +  LN +           + + +    GN                LE    HECV    
Sbjct: 255 VKSVLNGNP----------IVEMKIDMAGND---------------LESIFLHECVKSKD 289

Query: 308 LDK---FNKNHTIEFVPPDGSMELMKYHVRDN 336
           +DK   F     I+F+PPDGS +L  Y++  N
Sbjct: 290 VDKDQEFENTKLIKFLPPDGSFKLFDYNINLN 321

>ZYRO0B01738g Chr2 complement(139975..141453) [1479 bp, 492 aa] {ON}
           similar to uniprot|P38153 Saccharomyces cerevisiae
           YBR288C APM3 Mu3-like subunit of the yeast AP-3 complex
           which functions in transport of alkaline phosphatase to
           the vacuole via the alternate pathway clathrin
           associated protein medium chain
          Length = 492

 Score = 36.6 bits (83), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 27/152 (17%), Positives = 67/152 (44%), Gaps = 41/152 (26%)

Query: 198 ITWRPKGITHKKDEVFLYVNERMNILVS---RDGSI--LKSYVDGTIDITTHLSGTPICR 252
           + WR   + +  DE+++ + E ++++     R+ S+  +   ++G +++ ++LSG P   
Sbjct: 192 VPWRSGHLKYTSDEIYVDIIETVHVIYQTHHRNNSVQMVSGTINGQVNVKSYLSGNPTVE 251

Query: 253 FGLNDSLGMQSEDEKKWLAQQQHHSRGNFESKNFIHKAAAGSVLLEDCKFHECVSLDKFN 312
             ++             LA  + ++                         H+CV + + +
Sbjct: 252 MDMD-------------LAGNEMYAPS----------------------MHQCVEMPQGS 276

Query: 313 KNHTIEFVPPDGSMELMKYHVRDNINLPFKIT 344
            + ++ F+PPDG+  L+ Y +  ++N   K+T
Sbjct: 277 PS-SLCFIPPDGNCNLLNYTIDLDMNPKVKVT 307

>KNAG0A06970 Chr1 complement(1086674..1088191) [1518 bp, 505 aa]
           {ON} Anc_2.522 YBR288C
          Length = 505

 Score = 35.0 bits (79), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 22/36 (61%), Gaps = 4/36 (11%)

Query: 302 FHECVSLDKFNK----NHTIEFVPPDGSMELMKYHV 333
            H+CV LD   +    + T++F+PPDG   LM+Y V
Sbjct: 287 LHDCVELDGVPEGPADHTTLKFIPPDGKFRLMEYSV 322

>Smik_2.430 Chr2 complement(763687..765141) [1455 bp, 484 aa] {ON}
           YBR288C (REAL)
          Length = 484

 Score = 35.0 bits (79), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 31/146 (21%), Positives = 62/146 (42%), Gaps = 49/146 (33%)

Query: 198 ITWR-PKGITHKKDEVFLYVNERMNILVSRDGS---ILKSYVDGTIDITTHLSGTPICRF 253
           + WR  +   H+ +E++L + E  +++  +  S   ++   + GT+D+ ++L+ TP+   
Sbjct: 199 VPWRTSRASKHENNELYLDLLETFHVVFEKKKSHIRLVNGNIHGTLDVRSYLNDTPLVLV 258

Query: 254 GLN---DSLGMQSEDEKKWLAQQQHHSRGNFESKNFIHKAAAGSVLLEDCKFHECVSLDK 310
            LN   + +G+ S                                       HECV ++ 
Sbjct: 259 KLNTMGNDIGIPS--------------------------------------LHECVEIND 280

Query: 311 ---FNKNHTIEFVPPDGSMELMKYHV 333
              F+ ++ I F+PPDG   L++Y V
Sbjct: 281 GGVFSPSN-ITFIPPDGKFRLLEYCV 305

>NCAS0A04870 Chr1 (973552..975021) [1470 bp, 489 aa] {ON} Anc_2.522
           YBR288C
          Length = 489

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 32/165 (19%), Positives = 54/165 (32%), Gaps = 69/165 (41%)

Query: 198 ITWRPKGITHKKDEVFLYVNERMNILV-------SRDG--------SILKSYVDGTIDIT 242
           + WR  GI   K+E+++ + E + +          RDG         ++  ++ GTID+ 
Sbjct: 189 VPWRRNGIKDAKEELYVDLKEEVYVTYRKSDRHHGRDGIRTSNPSMELVSGHIKGTIDVR 248

Query: 243 THLSGTPICRF---GLNDSLGMQSEDEKKWLAQQQHHSRGNFESKNFIHKAAAGSVLLED 299
            +L+G P        + + LG+ S                                    
Sbjct: 249 CYLNGNPTVSLMFDTMGNDLGIPS------------------------------------ 272

Query: 300 CKFHECV-------------SLDKFNKNHTIEFVPPDGSMELMKY 331
             FH CV               + F     + F+PPDG   L +Y
Sbjct: 273 --FHACVEQEDQVQEQKQEQEPESFQGKRLLRFLPPDGKFRLAQY 315

>KNAG0F01060 Chr6 (188811..190097) [1287 bp, 428 aa] {ON} Anc_2.44
           YNL207W
          Length = 428

 Score = 32.3 bits (72), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 29/59 (49%), Gaps = 7/59 (11%)

Query: 29  SDIFRVQVINNLDVRSPVLTLGSTTFHHIRSRHGDNLWLVTITRSNANSAAIWEFLYKL 87
           SDI++V   N ++    +  LG T+FH +R+            R N+ + A W FL KL
Sbjct: 107 SDIYKVSDKNGVEKVMKIHRLGRTSFHTVRNNR-------DYLRKNSKNGANWMFLSKL 158

>Ecym_7266 Chr7 (559988..560022,560112..561630) [1554 bp, 517 aa]
           {ON} similar to Ashbya gossypii AGL061W
          Length = 517

 Score = 31.6 bits (70), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 28/145 (19%), Positives = 54/145 (37%), Gaps = 40/145 (27%)

Query: 194 DGNKITWRPKGITHKKDEVFLYVNERM--NILVSRDGS--ILKSYVDGTIDITTHLSGTP 249
           D   + WR   +++  +E+++ + E +  N+  SR  S  +    + G ID+  +L G P
Sbjct: 191 DAQVVPWRIPNLSNVNNEIYVDMVETLTLNLKQSRPNSFHVFHGVISGKIDLKCYLRGNP 250

Query: 250 ICRFGLNDSLGMQSEDEKKWLAQQQHHSRGNFESKNFIHKAAAGSVLLEDCKFHECV-SL 308
             +  L                    HS G+                 +    H C+   
Sbjct: 251 TMQINL--------------------HSAGH---------------AFKPSALHRCLDPS 275

Query: 309 DKFNKNHTIEFVPPDGSMELMKYHV 333
                + ++ F+PPDG   L++Y +
Sbjct: 276 SSSFDSSSLRFIPPDGKFTLLEYTI 300

>NDAI0K01930 Chr11 (437535..439373) [1839 bp, 612 aa] {ON} Anc_2.522
           YBR288C
          Length = 612

 Score = 31.6 bits (70), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 36/174 (20%), Positives = 60/174 (34%), Gaps = 71/174 (40%)

Query: 198 ITWRPKGITHKKDEVFLYVNERM-----NILVSRDG-------------------SILKS 233
           + WR   I + K+E+++ + E +     N + +R G                    ++  
Sbjct: 259 VPWRNGNIKNAKNELYIDMKEDIHVNFRNQIKNRKGRTYDNNNSNGIRVNNPSCMKLMNG 318

Query: 234 YVDGTIDITTHLSGTPICRFGLN---DSLGMQSEDEKKWLAQQQHHSRGNFESKNFIHKA 290
           Y+ G ID+ ++L+G PI    LN   + +G  S                           
Sbjct: 319 YITGVIDVRSYLNGNPIVEMKLNTCGNDMGTPS--------------------------- 351

Query: 291 AAGSVLLEDCKFHECVSL------DKFNKNHTIEFVPPDGSMELMKYHVRDNIN 338
                       H CV L      D      +++F+PPDG   L +Y V  N N
Sbjct: 352 -----------LHPCVELEGDMNGDDDKVMDSLKFIPPDGKFCLARYCVDLNKN 394

>Kpol_1025.38 s1025 (90229..90465,90467..91492) [1263 bp, 420 aa]
           {ON} (90229..90465,90467..91492) [1263 nt, 421 aa]
          Length = 420

 Score = 30.8 bits (68), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 56/127 (44%), Gaps = 27/127 (21%)

Query: 223 LVSRDGSILKSYVDGTIDITTHLSGTPICRFG--------LND-SLGMQSEDEKKWLAQQ 273
           ++ R  +IL S +DG++ +    SGT I +FG        +ND  LGM+S +    L++ 
Sbjct: 197 IIDRGRNILSSSLDGSVRLWELGSGTTIKQFGRKEKLDDPINDICLGMRSNENN--LSES 254

Query: 274 QHHSRGNFE----SKNFIHKAAAGSVLLEDCKFHECVSLDKFNKNHTIEFVPPDGSMELM 329
           +    G  E     K+F+    +G + + D           F K  T++F  P   M   
Sbjct: 255 ESVQAGPLEFGTQDKDFLSAHQSGVITMHDL----------FTKEQTLQF--PSKYMSSC 302

Query: 330 KYHVRDN 336
              VRD+
Sbjct: 303 VKVVRDS 309

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.135    0.404 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 52,577,816
Number of extensions: 2280726
Number of successful extensions: 5781
Number of sequences better than 10.0: 81
Number of HSP's gapped: 5727
Number of HSP's successfully gapped: 125
Length of query: 491
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 377
Effective length of database: 40,409,475
Effective search space: 15234372075
Effective search space used: 15234372075
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)