Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_15.561na 1ON54654629470.0
Skud_15.546na 1ON54254623310.0
Suva_8.436na 1ON54554622790.0
YOR380W (RDR1)na 1ON54654722120.0
Kwal_23.6537na 1ON55255515520.0
KLTH0C10516gna 1ON56155615260.0
Smik_5.9singletonOFF56501278e-09
KAFR0F014901.128ON6583351431e-08
KLTH0D07898g2.565ON6723781421e-08
Skud_10.101.128ON8333491394e-08
SAKL0D13464g2.565ON6873801351e-07
TDEL0C044802.231ON852851351e-07
Smik_2.1154.113ON971781351e-07
KNAG0I005601.128ON663561295e-07
TPHA0F013802.231ON890461297e-07
CAGL0A00451g4.113ON1107421297e-07
YBL005W (PDR3)4.113ON976841297e-07
Kpol_1039.112.231ON992481289e-07
SAKL0E08998g2.231ON823521271e-06
KNAG0C059804.113ON968431271e-06
TBLA0G026102.231ON1000561271e-06
Smik_10.251.128ON772631261e-06
KAFR0J017102.231ON848471261e-06
Skud_2.1064.113ON1010991262e-06
KLLA0F04609g2.231ON916421262e-06
YIL130W (ASG1)2.231ON964491243e-06
Suva_9.592.231ON926491243e-06
Smik_9.392.231ON1012491243e-06
NCAS0A016304.113ON1043611243e-06
Skud_9.372.231ON954391233e-06
Suva_2.1214.113ON971391233e-06
CAGL0G08844g2.231ON847481224e-06
NCAS0B065502.231ON906371215e-06
NDAI0B038502.231ON930371215e-06
Kwal_23.47542.231ON812371206e-06
KLTH0G09108g2.231ON782371207e-06
KNAG0E017602.231ON902371208e-06
SAKL0C03938g1.128ON780431208e-06
ZYRO0E06270g2.565ON912381191e-05
ZYRO0D06688g8.283ON595671181e-05
KLLA0C03201g1.128ON6503461181e-05
TPHA0F008304.113ON1192511172e-05
KLTH0E08140g4.121ON6321951162e-05
KAFR0C03730singletonON791501162e-05
TBLA0A007302.654ON1037421162e-05
SAKL0B06732gna 2ON878571162e-05
KAFR0B028208.283ON664361143e-05
YKL015W (PUT3)2.654ON979421144e-05
CAGL0B03421g1.380ON1355671144e-05
SAKL0B04620gna 3ON362361124e-05
KAFR0F034104.113ON995361136e-05
YJL206C1.128ON7583551126e-05
AFR117C1.380ON11521061136e-05
KAFR0A021302.565ON707371126e-05
TBLA0A012101.380ON1422461126e-05
ZYRO0C18150g1.128ON571471109e-05
KLLA0A06039g1.199ON657771109e-05
Ecym_53972.231ON826471101e-04
NCAS0A035804.113ON1113451101e-04
NCAS0A03570na 4ON978821101e-04
AER370W2.231ON801371101e-04
KLLA0A02585gna 3ON370471081e-04
KLLA0F22990g1.380ON1253901101e-04
KLTH0C00814g2.654ON834441091e-04
Smik_11.2402.654ON976391092e-04
KLTH0B09262gsingletonON820351092e-04
NCAS0H034202.654ON902421092e-04
Suva_11.2132.654ON985441082e-04
Skud_7.2744.113ON1080391082e-04
Smik_7.2774.113ON1069881082e-04
TDEL0C056801.128ON691431072e-04
KNAG0H002502.654ON896411082e-04
YGL013C (PDR1)4.113ON1068361082e-04
Skud_11.2142.654ON981441073e-04
NDAI0A03410na 4ON980951073e-04
KNAG0D035204.113ON1030361073e-04
ZYRO0B14476gna 5ON707531073e-04
KLTH0E00440gsingletonON688281063e-04
KLTH0B10076gsingletonON688281063e-04
SAKL0D01100g4.113ON940501073e-04
Kpol_1061.424.113ON1129441073e-04
KAFR0B039508.845ON1246461063e-04
ZYRO0G10252g4.113ON1036371063e-04
Ecym_7440na 2ON898361063e-04
NDAI0D035504.113ON1118351063e-04
NDAI0B015402.565ON803371063e-04
KLLA0A09119g4.113ON1082631064e-04
TDEL0B062601.380ON1247591064e-04
SAKL0C00242gna 6ON833791064e-04
NCAS0A127202.565ON759421055e-04
KNAG0M021202.565ON608351045e-04
Skud_13.1732.565ON920621055e-04
KLTH0G13200g8.283ON566341045e-04
Kpol_1061.261.380ON1274431055e-04
SAKL0G19470g2.654ON831421045e-04
TPHA0B036301.380ON1429541055e-04
KLTH0E06666gna 7ON9462171046e-04
ACL058Wna 7ON817461046e-04
ZYRO0E05412g1.380ON1244591046e-04
TBLA0C011201.380ON1486461047e-04
Suva_7.2684.113ON1000431047e-04
ZYRO0G14278g8.845ON1250471047e-04
Suva_13.1862.565ON894461037e-04
KLTH0E05786gna 6ON8171621037e-04
NDAI0A034204.113ON1108361037e-04
KLTH0E07854g4.113ON938371037e-04
Kpol_467.11.380ON12891121038e-04
CAGL0F09229gna 6ON835361038e-04
KLLA0D01452g8.845ON1445441038e-04
TPHA0O006001.380ON1372981038e-04
TDEL0D00820na 5ON685511028e-04
NDAI0G052601.380ON1581591039e-04
TBLA0C040504.113ON1207341030.001
Kwal_47.175064.113ON924371020.001
KAFR0I020301.380ON1233641020.001
TDEL0B005308.845ON1301471020.001
NCAS0A088401.380ON1478591020.001
NDAI0A010401.199ON995981020.001
NDAI0D034804.121ON708991010.001
Ecym_46168.845ON1577381020.001
Kwal_47.17233na 7ON948461010.001
SAKL0D01342g8.845ON1270381020.001
ZYRO0G22550gsingletonON724381010.001
Suva_13.4688.845ON1418381010.001
Smik_12.1578.283ON644521010.001
TDEL0F023304.113ON1086361010.001
AER183Cna 2ON879361010.001
SAKL0H24860gna 7ON971461010.001
Skud_5.331singletonON17042960.001
YBR297W (MAL33)na 8ON468611000.001
SAKL0D07898g1.380ON1244591010.002
KLLA0E18129g2.654ON865451000.002
Ecym_8404na 7ON885461000.002
KLTH0C03762g8.845ON1206471010.002
Kpol_1033.158.283ON594381000.002
TBLA0E019007.56ON840601000.002
YMR280C (CAT8)8.845ON1433381010.002
Skud_13.4528.845ON1432381010.002
CAGL0L03377g1.277ON1209391000.002
Smik_13.4938.845ON1433381000.002
YMR019W (STB4)2.565ON949361000.002
ABL121C8.845ON1285471000.002
KNAG0G021308.283ON632391000.002
Kwal_YGOB_0.1391.380ON1240591000.002
Kpol_1059.268.642ON42047990.002
TDEL0H007901.199ON827621000.002
Kwal_27.102328.845ON1209381000.002
NDAI0D03540na 4ON1107341000.002
YLR256W (HAP1)1.380ON1502431000.002
KLTH0H11572g1.380ON1237591000.002
NDAI0K003908.845ON1495391000.002
KNAG0I014501.380ON1476431000.002
Ecym_33922.654ON84795990.002
Kwal_0.142singletonOFF62959990.002
TDEL0D00260singletonON64732990.002
KLLA0F19602g8.283ON60344990.002
Ecym_72354.113ON94334990.002
TBLA0C062306.60ON79569990.002
CAGL0M03025g8.845ON125453990.002
KAFR0G005701.199ON86297990.002
NCAS0D04860singletonON70173990.002
Smik_12.3271.380ON150343990.002
Ecym_27321.380ON119843990.003
ZYRO0D02090g1.199ON84248990.003
Skud_12.3351.380ON147943990.003
CAGL0M05907g1.199ON89178990.003
Skud_7.627na 9ON47479980.003
Smik_2.438na 8ON46933980.003
Suva_10.3511.380ON32459970.003
Suva_16.25singletonON14338920.003
AGR061C8.283ON61239980.003
Kwal_47.175654.121ON62850980.003
NDAI0B025208.283ON71041980.003
Smik_13.1832.565ON91136980.003
CAGL0K05841g1.380ON137242980.003
Ecym_42868.283ON62738970.004
AFL160C6.279ON648388970.004
Kwal_14.9152.654ON822372970.004
Suva_6.2851.128ON78636970.004
KNAG0C011601.199ON83547970.004
NCAS0C003908.845ON116447970.004
Kwal_14.778na 10ON66588960.005
KLTH0E14454gna 2ON90236960.005
KLLA0D10153gsingletonON65537960.005
NCAS0E023107.56ON71839960.005
YER184Cna 6ON79448960.006
TPHA0L003505.525ON85967960.006
KLLA0C14212gna 11ON104037960.006
TDEL0C018807.360ON54098950.006
ADR404Cna 12ON87561950.007
CAGL0A00583g4.121ON646292940.008
Suva_11.2991.199ON88936940.008
KLLA0C18953gna 10ON70329940.008
Skud_7.638singletonON47333940.009
SAKL0A02860g6.279ON745186940.009
TDEL0B074902.654ON86535940.010
KAFR0C039002.654ON81842940.010
CAGL0F02519g1.128ON83239940.010
KLLA0C19228gsingletonON59130930.011
TPHA0N002307.17ON123259930.011
Kpol_1016.201.277ON108643930.012
KAFR0C013203.109ON100640930.012
KNAG0M00120singletonON88140930.013
TBLA0E034803.109ON104647930.013
KLTH0H02684g6.279ON749196920.014
Kwal_47.17681na 13ON85495920.016
YGR288W (MAL13)na 9ON47342910.016
Smik_17.27singletonON688328920.017
Skud_15.5027.56ON75938920.017
YOR337W (TEA1)7.56ON75938920.017
Suva_8.3877.56ON75938920.018
KLLA0C17050gna 7ON95546920.018
NDAI0F012206.279ON960187920.018
TPHA0C010808.283ON591364910.018
Kwal_26.68057.17ON944104910.019
Smik_15.5157.56ON75938910.019
KLTH0C10032g3.109ON86658910.019
TBLA0F012003.109ON108652910.020
TBLA0A04280singletonON89250910.020
Skud_14.399na 14ON60728910.020
KLLA0E13993gsingletonON67866910.022
Ecym_83278.642ON41242900.022
AGL233Cna 15ON87267910.023
Kwal_56.226053.109ON86567900.025
ZYRO0G00308gsingletonON64927900.026
TBLA0G005106.60ON93543900.027
Skud_15.643.109ON103282900.028
TBLA0J003708.642ON47191890.028
KAFR0E024107.56ON69154900.028
KAFR0A066904.113ON99739900.028
TPHA0I008601.260ON49658890.028
Smik_1.137.17ON104638900.029
NCAS0B051108.283ON62777890.030
KNAG0E041507.17ON113655900.032
SAKL0H00660gsingletonON91239890.032
YKR064W (OAF3)1.199ON86351890.032
KNAG0M006206.154ON45947890.033
Smik_15.673.109ON1030106890.033
NDAI0C034505.59ON776189890.033
KLTH0B00352gsingletonON93439890.034
ZYRO0E00572g2.654ON83854890.036
ZYRO0G15136g1.277ON102754890.036
NCAS0C047803.109ON914107890.039
SAKL0H22374g4.121ON640297880.040
Suva_15.425singletonON64424880.040
Kwal_34.15751na 16ON62851880.040
NDAI0C002602.654ON104149890.040
Smik_16.15singletonON46333880.042
Kwal_56.246707.360ON64339880.043
NDAI0E038507.56ON76848880.044
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_15.561
         (546 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_15.561 Chr15 (997239..998879) [1641 bp, 546 aa] {ON} YOR380...  1139   0.0  
Skud_15.546 Chr15 (990335..991963) [1629 bp, 542 aa] {ON} YOR380...   902   0.0  
Suva_8.436 Chr8 (788699..790336) [1638 bp, 545 aa] {ON} YOR380W ...   882   0.0  
YOR380W Chr15 (1051290..1052930) [1641 bp, 546 aa] {ON}  RDR1Tra...   856   0.0  
Kwal_23.6537 s23 complement(1632048..1633706) [1659 bp, 552 aa] ...   602   0.0  
KLTH0C10516g Chr3 (871091..872776) [1686 bp, 561 aa] {ON} simila...   592   0.0  
Smik_5.9 Chr5 complement(10186..10212,10216..10227,10231..10359)...    54   8e-09
KAFR0F01490 Chr6 complement(290988..292964) [1977 bp, 658 aa] {O...    60   1e-08
KLTH0D07898g Chr4 (672516..674534) [2019 bp, 672 aa] {ON} weakly...    59   1e-08
Skud_10.10 Chr10 complement(21672..24173) [2502 bp, 833 aa] {ON}...    58   4e-08
SAKL0D13464g Chr4 (1116277..1118340) [2064 bp, 687 aa] {ON} weak...    57   1e-07
TDEL0C04480 Chr3 (799022..801580) [2559 bp, 852 aa] {ON} Anc_2.2...    57   1e-07
Smik_2.115 Chr2 (210321..213236) [2916 bp, 971 aa] {ON} YBL005W ...    57   1e-07
KNAG0I00560 Chr9 complement(93785..95776) [1992 bp, 663 aa] {ON}...    54   5e-07
TPHA0F01380 Chr6 complement(318207..320879) [2673 bp, 890 aa] {O...    54   7e-07
CAGL0A00451g Chr1 (47557..50880) [3324 bp, 1107 aa] {ON} similar...    54   7e-07
YBL005W Chr2 (217470..220400) [2931 bp, 976 aa] {ON}  PDR3Transc...    54   7e-07
Kpol_1039.11 s1039 (29727..32705) [2979 bp, 992 aa] {ON} (29727....    54   9e-07
SAKL0E08998g Chr5 complement(747085..749556) [2472 bp, 823 aa] {...    54   1e-06
KNAG0C05980 Chr3 complement(1164771..1167677) [2907 bp, 968 aa] ...    54   1e-06
TBLA0G02610 Chr7 complement(689843..692845) [3003 bp, 1000 aa] {...    54   1e-06
Smik_10.25 Chr10 complement(45977..48295) [2319 bp, 772 aa] {ON}...    53   1e-06
KAFR0J01710 Chr10 complement(327570..330116) [2547 bp, 848 aa] {...    53   1e-06
Skud_2.106 Chr2 (200722..203754) [3033 bp, 1010 aa] {ON} YBL005W...    53   2e-06
KLLA0F04609g Chr6 complement(451579..454329) [2751 bp, 916 aa] {...    53   2e-06
YIL130W Chr9 (102782..105676) [2895 bp, 964 aa] {ON}  ASG1Zinc c...    52   3e-06
Suva_9.59 Chr9 (97521..100298) [2778 bp, 926 aa] {ON} YIL130W (R...    52   3e-06
Smik_9.39 Chr9 (80510..83548) [3039 bp, 1012 aa] {ON} YIL130W (R...    52   3e-06
NCAS0A01630 Chr1 complement(317259..320390) [3132 bp, 1043 aa] {...    52   3e-06
Skud_9.37 Chr9 (79947..82811) [2865 bp, 954 aa] {ON} YIL130W (REAL)    52   3e-06
Suva_2.121 Chr2 (211466..214381) [2916 bp, 971 aa] {ON} YBL005W ...    52   3e-06
CAGL0G08844g Chr7 complement(846590..849133) [2544 bp, 847 aa] {...    52   4e-06
NCAS0B06550 Chr2 complement(1242371..1245091) [2721 bp, 906 aa] ...    51   5e-06
NDAI0B03850 Chr2 complement(970366..973158) [2793 bp, 930 aa] {O...    51   5e-06
Kwal_23.4754 s23 (845550..847988) [2439 bp, 812 aa] {ON} YIL130W...    51   6e-06
KLTH0G09108g Chr7 (744062..746410) [2349 bp, 782 aa] {ON} weakly...    51   7e-06
KNAG0E01760 Chr5 (350254..352962) [2709 bp, 902 aa] {ON} Anc_2.2...    51   8e-06
SAKL0C03938g Chr3 complement(377431..379773) [2343 bp, 780 aa] {...    51   8e-06
ZYRO0E06270g Chr5 (475960..478698) [2739 bp, 912 aa] {ON} weakly...    50   1e-05
ZYRO0D06688g Chr4 (577455..577507,577577..579311) [1788 bp, 595 ...    50   1e-05
KLLA0C03201g Chr3 complement(286973..288925) [1953 bp, 650 aa] {...    50   1e-05
TPHA0F00830 Chr6 complement(188299..191877) [3579 bp, 1192 aa] {...    50   2e-05
KLTH0E08140g Chr5 (747649..749547) [1899 bp, 632 aa] {ON} conser...    49   2e-05
KAFR0C03730 Chr3 (759382..761757) [2376 bp, 791 aa] {ON}               49   2e-05
TBLA0A00730 Chr1 (156043..159156) [3114 bp, 1037 aa] {ON} Anc_2....    49   2e-05
SAKL0B06732g Chr2 complement(578508..581144) [2637 bp, 878 aa] {...    49   2e-05
KAFR0B02820 Chr2 complement(576317..578311) [1995 bp, 664 aa] {O...    49   3e-05
YKL015W Chr11 (408544..411483) [2940 bp, 979 aa] {ON}  PUT3Trans...    49   4e-05
CAGL0B03421g Chr2 complement(336071..340138) [4068 bp, 1355 aa] ...    49   4e-05
SAKL0B04620g Chr2 complement(406622..407710) [1089 bp, 362 aa] {...    48   4e-05
KAFR0F03410 Chr6 complement(677156..680143) [2988 bp, 995 aa] {O...    48   6e-05
YJL206C Chr10 complement(47659..49935) [2277 bp, 758 aa] {ON} Pu...    48   6e-05
AFR117C Chr6 complement(646829..650287) [3459 bp, 1152 aa] {ON} ...    48   6e-05
KAFR0A02130 Chr1 (447063..449186) [2124 bp, 707 aa] {ON} Anc_2.5...    48   6e-05
TBLA0A01210 Chr1 (276151..280419) [4269 bp, 1422 aa] {ON} Anc_1....    48   6e-05
ZYRO0C18150g Chr3 (1418645..1420360) [1716 bp, 571 aa] {ON} some...    47   9e-05
KLLA0A06039g Chr1 (557368..559341) [1974 bp, 657 aa] {ON} weakly...    47   9e-05
Ecym_5397 Chr5 (805712..808192) [2481 bp, 826 aa] {ON} similar t...    47   1e-04
NCAS0A03580 Chr1 complement(712039..715380) [3342 bp, 1113 aa] {...    47   1e-04
NCAS0A03570 Chr1 complement(708718..711654) [2937 bp, 978 aa] {O...    47   1e-04
AER370W Chr5 (1320487..1322892) [2406 bp, 801 aa] {ON} Syntenic ...    47   1e-04
KLLA0A02585g Chr1 complement(226562..227674) [1113 bp, 370 aa] {...    46   1e-04
KLLA0F22990g Chr6 (2134385..2138146) [3762 bp, 1253 aa] {ON} uni...    47   1e-04
KLTH0C00814g Chr3 (76637..79141) [2505 bp, 834 aa] {ON} similar ...    47   1e-04
Smik_11.240 Chr11 (395459..395932,395981..398437) [2931 bp, 976 ...    47   2e-04
KLTH0B09262g Chr2 (758773..761235) [2463 bp, 820 aa] {ON} weakly...    47   2e-04
NCAS0H03420 Chr8 complement(648059..650767) [2709 bp, 902 aa] {O...    47   2e-04
Suva_11.213 Chr11 (392506..392993,393045..395514) [2958 bp, 985 ...    46   2e-04
Skud_7.274 Chr7 complement(472171..475413) [3243 bp, 1080 aa] {O...    46   2e-04
Smik_7.277 Chr7 complement(461108..464317) [3210 bp, 1069 aa] {O...    46   2e-04
TDEL0C05680 Chr3 complement(1020646..1022721) [2076 bp, 691 aa] ...    46   2e-04
KNAG0H00250 Chr8 (37360..40050) [2691 bp, 896 aa] {ON} Anc_2.654...    46   2e-04
YGL013C Chr7 complement(469092..472298) [3207 bp, 1068 aa] {ON} ...    46   2e-04
Skud_11.214 Chr11 (389377..389855,389895..392361) [2946 bp, 981 ...    46   3e-04
NDAI0A03410 Chr1 complement(778569..781511) [2943 bp, 980 aa] {O...    46   3e-04
KNAG0D03520 Chr4 complement(642517..645609) [3093 bp, 1030 aa] {...    46   3e-04
ZYRO0B14476g Chr2 complement(1175759..1177882) [2124 bp, 707 aa]...    46   3e-04
KLTH0E00440g Chr5 complement(42945..45011) [2067 bp, 688 aa] {ON...    45   3e-04
KLTH0B10076g Chr2 (841024..843090) [2067 bp, 688 aa] {ON} some s...    45   3e-04
SAKL0D01100g Chr4 complement(81235..84057) [2823 bp, 940 aa] {ON...    46   3e-04
Kpol_1061.42 s1061 complement(116430..119819) [3390 bp, 1129 aa]...    46   3e-04
KAFR0B03950 Chr2 complement(823760..827500) [3741 bp, 1246 aa] {...    45   3e-04
ZYRO0G10252g Chr7 (819658..822768) [3111 bp, 1036 aa] {ON} simil...    45   3e-04
Ecym_7440 Chr7 complement(902108..904804) [2697 bp, 898 aa] {ON}...    45   3e-04
NDAI0D03550 Chr4 complement(843265..846621) [3357 bp, 1118 aa] {...    45   3e-04
NDAI0B01540 Chr2 complement(359639..362050) [2412 bp, 803 aa] {O...    45   3e-04
KLLA0A09119g Chr1 complement(797533..800781) [3249 bp, 1082 aa] ...    45   4e-04
TDEL0B06260 Chr2 (1104557..1108300) [3744 bp, 1247 aa] {ON} Anc_...    45   4e-04
SAKL0C00242g Chr3 (14453..16954) [2502 bp, 833 aa] {ON} weakly s...    45   4e-04
NCAS0A12720 Chr1 (2510574..2512853) [2280 bp, 759 aa] {ON} Anc_2...    45   5e-04
KNAG0M02120 Chr13 (395195..397021) [1827 bp, 608 aa] {ON} Anc_2....    45   5e-04
Skud_13.173 Chr13 (298693..298722,298729..301461) [2763 bp, 920 ...    45   5e-04
KLTH0G13200g Chr7 (1133333..1133382,1133450..1135100) [1701 bp, ...    45   5e-04
Kpol_1061.26 s1061 (69833..73657) [3825 bp, 1274 aa] {ON} (69833...    45   5e-04
SAKL0G19470g Chr7 complement(1677759..1680254) [2496 bp, 831 aa]...    45   5e-04
TPHA0B03630 Chr2 (844571..848860) [4290 bp, 1429 aa] {ON} Anc_1....    45   5e-04
KLTH0E06666g Chr5 (611348..614188) [2841 bp, 946 aa] {ON} conser...    45   6e-04
ACL058W Chr3 (261723..264176) [2454 bp, 817 aa] {ON} NOHBY305; N...    45   6e-04
ZYRO0E05412g Chr5 (410945..414679) [3735 bp, 1244 aa] {ON} simil...    45   6e-04
TBLA0C01120 Chr3 complement(233451..237911) [4461 bp, 1486 aa] {...    45   7e-04
Suva_7.268 Chr7 complement(460629..463631) [3003 bp, 1000 aa] {O...    45   7e-04
ZYRO0G14278g Chr7 complement(1141297..1145049) [3753 bp, 1250 aa...    45   7e-04
Suva_13.186 Chr13 (302887..305571) [2685 bp, 894 aa] {ON} YMR019...    44   7e-04
KLTH0E05786g Chr5 (517896..520349) [2454 bp, 817 aa] {ON} weakly...    44   7e-04
NDAI0A03420 Chr1 complement(782010..785336) [3327 bp, 1108 aa] {...    44   7e-04
KLTH0E07854g Chr5 (719642..722458) [2817 bp, 938 aa] {ON} weakly...    44   7e-04
Kpol_467.1 s467 (471..4340) [3870 bp, 1289 aa] {ON} (471..4340) ...    44   8e-04
CAGL0F09229g Chr6 complement(908186..910693) [2508 bp, 835 aa] {...    44   8e-04
KLLA0D01452g Chr4 (124018..128355) [4338 bp, 1445 aa] {ON} simil...    44   8e-04
TPHA0O00600 Chr15 complement(107944..112062) [4119 bp, 1372 aa] ...    44   8e-04
TDEL0D00820 Chr4 (151394..153451) [2058 bp, 685 aa] {ON}               44   8e-04
NDAI0G05260 Chr7 (1277631..1282376) [4746 bp, 1581 aa] {ON} Anc_...    44   9e-04
TBLA0C04050 Chr3 complement(980010..983633) [3624 bp, 1207 aa] {...    44   0.001
Kwal_47.17506 s47 (431921..434695) [2775 bp, 924 aa] {ON} YGL013...    44   0.001
KAFR0I02030 Chr9 complement(416471..420172) [3702 bp, 1233 aa] {...    44   0.001
TDEL0B00530 Chr2 (95898..99803) [3906 bp, 1301 aa] {ON} Anc_8.84...    44   0.001
NCAS0A08840 Chr1 (1746841..1751277) [4437 bp, 1478 aa] {ON} Anc_...    44   0.001
NDAI0A01040 Chr1 complement(220931..223918) [2988 bp, 995 aa] {O...    44   0.001
NDAI0D03480 Chr4 complement(818292..820418) [2127 bp, 708 aa] {O...    44   0.001
Ecym_4616 Chr4 complement(1204091..1208824) [4734 bp, 1577 aa] {...    44   0.001
Kwal_47.17233 s47 (309658..312504) [2847 bp, 948 aa] {ON} [conti...    44   0.001
SAKL0D01342g Chr4 (101095..104907) [3813 bp, 1270 aa] {ON} simil...    44   0.001
ZYRO0G22550g Chr7 complement(1856064..1858238) [2175 bp, 724 aa]...    44   0.001
Suva_13.468 Chr13 complement(809712..812654,812694..814007) [425...    44   0.001
Smik_12.157 Chr12 complement(317470..319404) [1935 bp, 644 aa] {...    44   0.001
TDEL0F02330 Chr6 complement(429974..433234) [3261 bp, 1086 aa] {...    44   0.001
AER183C Chr5 complement(975879..978518) [2640 bp, 879 aa] {ON} N...    44   0.001
SAKL0H24860g Chr8 complement(2162455..2165370) [2916 bp, 971 aa]...    44   0.001
Skud_5.331 Chr5 complement(543439..543951) [513 bp, 170 aa] {ON}...    42   0.001
YBR297W Chr2 (800523..801929) [1407 bp, 468 aa] {ON}  MAL33MAL-a...    43   0.001
SAKL0D07898g Chr4 complement(653332..657066) [3735 bp, 1244 aa] ...    44   0.002
KLLA0E18129g Chr5 (1613115..1615712) [2598 bp, 865 aa] {ON} simi...    43   0.002
Ecym_8404 Chr8 complement(834988..837645) [2658 bp, 885 aa] {ON}...    43   0.002
KLTH0C03762g Chr3 (324666..328286) [3621 bp, 1206 aa] {ON} simil...    44   0.002
Kpol_1033.15 s1033 complement(32885..34586,34699..34781) [1785 b...    43   0.002
TBLA0E01900 Chr5 (462299..464821) [2523 bp, 840 aa] {ON} Anc_7.5...    43   0.002
YMR280C Chr13 complement(827028..831329) [4302 bp, 1433 aa] {ON}...    44   0.002
Skud_13.452 Chr13 complement(800289..804587) [4299 bp, 1432 aa] ...    44   0.002
CAGL0L03377g Chr12 complement(384929..388558) [3630 bp, 1209 aa]...    43   0.002
Smik_13.493 Chr13 complement(810035..814336) [4302 bp, 1433 aa] ...    43   0.002
YMR019W Chr13 (312156..315005) [2850 bp, 949 aa] {ON}  STB4Putat...    43   0.002
ABL121C Chr2 complement(170782..174639) [3858 bp, 1285 aa] {ON} ...    43   0.002
KNAG0G02130 Chr7 complement(482333..484231) [1899 bp, 632 aa] {O...    43   0.002
Kwal_YGOB_0.139 s0 complement(61752..63560,63594..65507) [3723 b...    43   0.002
Kpol_1059.26 s1059 complement(57391..58653) [1263 bp, 420 aa] {O...    43   0.002
TDEL0H00790 Chr8 complement(132519..135002) [2484 bp, 827 aa] {O...    43   0.002
Kwal_27.10232 s27 (251015..254644) [3630 bp, 1209 aa] {ON} YMR28...    43   0.002
NDAI0D03540 Chr4 complement(838966..842289) [3324 bp, 1107 aa] {...    43   0.002
YLR256W Chr12 (646415..650923) [4509 bp, 1502 aa] {ON}  HAP1Zinc...    43   0.002
KLTH0H11572g Chr8 complement(989095..992808) [3714 bp, 1237 aa] ...    43   0.002
NDAI0K00390 Chr11 (84641..89128) [4488 bp, 1495 aa] {ON} Anc_8.845     43   0.002
KNAG0I01450 Chr9 (277513..281943) [4431 bp, 1476 aa] {ON}              43   0.002
Ecym_3392 Chr3 (741359..743902) [2544 bp, 847 aa] {ON} similar t...    43   0.002
Kwal_0.142 s0 complement(63621..65507) [1887 bp, 629 aa] {OFF} Y...    43   0.002
TDEL0D00260 Chr4 complement(44685..46628) [1944 bp, 647 aa] {ON}       43   0.002
KLLA0F19602g Chr6 complement(1814949..1816760) [1812 bp, 603 aa]...    43   0.002
Ecym_7235 Chr7 (489574..492405) [2832 bp, 943 aa] {ON} similar t...    43   0.002
TBLA0C06230 Chr3 (1509702..1512089) [2388 bp, 795 aa] {ON} Anc_6...    43   0.002
CAGL0M03025g Chr13 complement(341849..345613) [3765 bp, 1254 aa]...    43   0.002
KAFR0G00570 Chr7 complement(148813..151401) [2589 bp, 862 aa] {O...    43   0.002
NCAS0D04860 Chr4 (933920..936025) [2106 bp, 701 aa] {ON}               43   0.002
Smik_12.327 Chr12 (590984..595495) [4512 bp, 1503 aa] {ON} YLR25...    43   0.002
Ecym_2732 Chr2 (1410290..1413886) [3597 bp, 1198 aa] {ON} simila...    43   0.003
ZYRO0D02090g Chr4 complement(167354..169882) [2529 bp, 842 aa] {...    43   0.003
Skud_12.335 Chr12 (592952..597391) [4440 bp, 1479 aa] {ON} YLR25...    43   0.003
CAGL0M05907g Chr13 (622029..624704) [2676 bp, 891 aa] {ON} simil...    43   0.003
Skud_7.627 Chr7 (1048240..1049664) [1425 bp, 474 aa] {ON} YBR297...    42   0.003
Smik_2.438 Chr2 (786437..787846) [1410 bp, 469 aa] {ON} YBR297W ...    42   0.003
Suva_10.351 Chr10 (613486..614460) [975 bp, 324 aa] {ON} YLR256W...    42   0.003
Suva_16.25 Chr16 complement(31437..31868) [432 bp, 143 aa] {ON} ...    40   0.003
AGR061C Chr7 complement(831052..832890) [1839 bp, 612 aa] {ON} S...    42   0.003
Kwal_47.17565 s47 (457523..459409) [1887 bp, 628 aa] {ON} [conti...    42   0.003
NDAI0B02520 Chr2 complement(631209..633341) [2133 bp, 710 aa] {O...    42   0.003
Smik_13.183 Chr13 (304049..304060,304064..306787) [2736 bp, 911 ...    42   0.003
CAGL0K05841g Chr11 (573144..577262) [4119 bp, 1372 aa] {ON} simi...    42   0.003
Ecym_4286 Chr4 (613587..615470) [1884 bp, 627 aa] {ON} similar t...    42   0.004
AFL160C Chr6 complement(130842..132788) [1947 bp, 648 aa] {ON} S...    42   0.004
Kwal_14.915 s14 (110216..112684) [2469 bp, 822 aa] {ON} YKL015W ...    42   0.004
Suva_6.285 Chr6 (499581..501941) [2361 bp, 786 aa] {ON} YJL206C ...    42   0.004
KNAG0C01160 Chr3 complement(226939..229446) [2508 bp, 835 aa] {O...    42   0.004
NCAS0C00390 Chr3 (57333..60827) [3495 bp, 1164 aa] {ON} Anc_8.845      42   0.004
Kwal_14.778 s14 complement(40408..42405) [1998 bp, 665 aa] {ON} ...    42   0.005
KLTH0E14454g Chr5 complement(1282704..1285412) [2709 bp, 902 aa]...    42   0.005
KLLA0D10153g Chr4 (858016..859983) [1968 bp, 655 aa] {ON} some s...    42   0.005
NCAS0E02310 Chr5 (452368..454524) [2157 bp, 718 aa] {ON} Anc_7.56      42   0.005
YER184C Chr5 complement(556296..558680) [2385 bp, 794 aa] {ON} P...    42   0.006
TPHA0L00350 Chr12 complement(47367..49946) [2580 bp, 859 aa] {ON}      42   0.006
KLLA0C14212g Chr3 complement(1229219..1232341) [3123 bp, 1040 aa...    42   0.006
TDEL0C01880 Chr3 (332932..334554) [1623 bp, 540 aa] {ON} Anc_7.3...    41   0.006
ADR404C Chr4 complement(1432320..1434947) [2628 bp, 875 aa] {ON}...    41   0.007
CAGL0A00583g Chr1 (65286..67226) [1941 bp, 646 aa] {ON} weakly s...    41   0.008
Suva_11.299 Chr11 (546739..549408) [2670 bp, 889 aa] {ON} YKR064...    41   0.008
KLLA0C18953g Chr3 (1682246..1684357) [2112 bp, 703 aa] {ON} some...    41   0.008
Skud_7.638 Chr7 (1060062..1061483) [1422 bp, 473 aa] {ON} YFL052...    41   0.009
SAKL0A02860g Chr1 complement(259388..261625) [2238 bp, 745 aa] {...    41   0.009
TDEL0B07490 Chr2 complement(1314447..1317044) [2598 bp, 865 aa] ...    41   0.010
KAFR0C03900 Chr3 (787524..789980) [2457 bp, 818 aa] {ON} Anc_2.6...    41   0.010
CAGL0F02519g Chr6 (245120..247618) [2499 bp, 832 aa] {ON} weakly...    41   0.010
KLLA0C19228g Chr3 (1713787..1715562) [1776 bp, 591 aa] {ON} simi...    40   0.011
TPHA0N00230 Chr14 (39855..43553) [3699 bp, 1232 aa] {ON} Anc_7.1...    40   0.011
Kpol_1016.20 s1016 (51828..55088) [3261 bp, 1086 aa] {ON} (51828...    40   0.012
KAFR0C01320 Chr3 (273213..276233) [3021 bp, 1006 aa] {ON} Anc_3....    40   0.012
KNAG0M00120 Chr13 complement(12320..14965) [2646 bp, 881 aa] {ON}      40   0.013
TBLA0E03480 Chr5 (865043..868183) [3141 bp, 1046 aa] {ON} Anc_3....    40   0.013
KLTH0H02684g Chr8 complement(235527..237776) [2250 bp, 749 aa] {...    40   0.014
Kwal_47.17681 s47 complement(513119..515683) [2565 bp, 854 aa] {...    40   0.016
YGR288W Chr7 (1070293..1071714) [1422 bp, 473 aa] {ON}  MAL13MAL...    40   0.016
Smik_17.27 Chr17 complement(29476..31542) [2067 bp, 688 aa] {ON}...    40   0.017
Skud_15.502 Chr15 (894741..897020) [2280 bp, 759 aa] {ON} YOR337...    40   0.017
YOR337W Chr15 (954344..956623) [2280 bp, 759 aa] {ON}  TEA1Ty1 e...    40   0.017
Suva_8.387 Chr8 (696078..698357) [2280 bp, 759 aa] {ON} YOR337W ...    40   0.018
KLLA0C17050g Chr3 (1490472..1493339) [2868 bp, 955 aa] {ON} cons...    40   0.018
NDAI0F01220 Chr6 complement(295418..298300) [2883 bp, 960 aa] {O...    40   0.018
TPHA0C01080 Chr3 (246019..247794) [1776 bp, 591 aa] {ON} Anc_8.2...    40   0.018
Kwal_26.6805 s26 (71596..74430) [2835 bp, 944 aa] {ON} YAL051W (...    40   0.019
Smik_15.515 Chr15 (903950..906229) [2280 bp, 759 aa] {ON} YOR337...    40   0.019
KLTH0C10032g Chr3 complement(830334..832934) [2601 bp, 866 aa] {...    40   0.019
TBLA0F01200 Chr6 (295744..299004) [3261 bp, 1086 aa] {ON} Anc_3....    40   0.020
TBLA0A04280 Chr1 complement(1059254..1061932) [2679 bp, 892 aa] ...    40   0.020
Skud_14.399 Chr14 (715444..717267) [1824 bp, 607 aa] {ON} YNR063...    40   0.020
KLLA0E13993g Chr5 complement(1239566..1241602) [2037 bp, 678 aa]...    40   0.022
Ecym_8327 Chr8 (663876..665114) [1239 bp, 412 aa] {ON} similar t...    39   0.022
AGL233C Chr7 complement(260414..263032) [2619 bp, 872 aa] {ON} N...    40   0.023
Kwal_56.22605 s56 (200072..202669) [2598 bp, 865 aa] {ON} YOL089...    39   0.025
ZYRO0G00308g Chr7 (20674..22623) [1950 bp, 649 aa] {ON} similar ...    39   0.026
TBLA0G00510 Chr7 (104797..107604) [2808 bp, 935 aa] {ON} Anc_6.6...    39   0.027
Skud_15.64 Chr15 complement(109746..112844) [3099 bp, 1032 aa] {...    39   0.028
TBLA0J00370 Chr10 complement(67871..69286) [1416 bp, 471 aa] {ON...    39   0.028
KAFR0E02410 Chr5 (489279..491354) [2076 bp, 691 aa] {ON} Anc_7.5...    39   0.028
KAFR0A06690 Chr1 complement(1354262..1357255) [2994 bp, 997 aa] ...    39   0.028
TPHA0I00860 Chr9 complement(188725..190215) [1491 bp, 496 aa] {O...    39   0.028
Smik_1.13 Chr1 (31514..34654) [3141 bp, 1046 aa] {ON} YAL051W (R...    39   0.029
NCAS0B05110 Chr2 complement(951685..953485,953561..953643) [1884...    39   0.030
KNAG0E04150 Chr5 complement(823063..826473) [3411 bp, 1136 aa] {...    39   0.032
SAKL0H00660g Chr8 complement(78740..81478) [2739 bp, 912 aa] {ON...    39   0.032
YKR064W Chr11 (562547..565138) [2592 bp, 863 aa] {ON}  OAF3Putat...    39   0.032
KNAG0M00620 Chr13 (99320..100699) [1380 bp, 459 aa] {ON} Anc_6.1...    39   0.033
Smik_15.67 Chr15 complement(113506..116598) [3093 bp, 1030 aa] {...    39   0.033
NDAI0C03450 Chr3 (789514..791844) [2331 bp, 776 aa] {ON} Anc_5.59      39   0.033
KLTH0B00352g Chr2 complement(31952..34756) [2805 bp, 934 aa] {ON...    39   0.034
ZYRO0E00572g Chr5 (35940..38456) [2517 bp, 838 aa] {ON} similar ...    39   0.036
ZYRO0G15136g Chr7 complement(1218989..1222072) [3084 bp, 1027 aa...    39   0.036
NCAS0C04780 Chr3 (974254..976998) [2745 bp, 914 aa] {ON}               39   0.039
SAKL0H22374g Chr8 (1947498..1949420) [1923 bp, 640 aa] {ON} cons...    39   0.040
Suva_15.425 Chr15 (750153..752087) [1935 bp, 644 aa] {ON} YLR098...    39   0.040
Kwal_34.15751 s34 (40148..42034) [1887 bp, 628 aa] {ON} [contig ...    39   0.040
NDAI0C00260 Chr3 (40019..43144) [3126 bp, 1041 aa] {ON} Anc_2.65...    39   0.040
Smik_16.15 Chr16 complement(14421..15812) [1392 bp, 463 aa] {ON}...    39   0.042
Kwal_56.24670 s56 complement(1099601..1101532) [1932 bp, 643 aa]...    39   0.043
NDAI0E03850 Chr5 (846504..848810) [2307 bp, 768 aa] {ON} Anc_7.56      39   0.044
ACR241C Chr3 complement(784358..786745) [2388 bp, 795 aa] {ON} S...    39   0.045
Ecym_2672 Chr2 (1294580..1296799) [2220 bp, 739 aa] {ON} similar...    39   0.046
KLTH0H00968g Chr8 (103482..105353) [1872 bp, 623 aa] {ON} simila...    39   0.046
Skud_1.10 Chr1 (24510..27632) [3123 bp, 1040 aa] {ON} YAL051W (R...    39   0.046
TBLA0C02060 Chr3 (486966..489920) [2955 bp, 984 aa] {ON} Anc_1.1...    39   0.047
Kwal_26.7014 s26 complement(164333..166297) [1965 bp, 654 aa] {O...    39   0.048
Skud_2.427 Chr2 (769889..771295) [1407 bp, 468 aa] {ON} YGR288W ...    38   0.049
SAKL0B10538g Chr2 (910662..912767) [2106 bp, 701 aa] {ON} simila...    39   0.049
CAGL0L09691g Chr12 complement(1041796..1044270) [2475 bp, 824 aa...    39   0.049
Smik_25.2 Chr25 (2105..4462) [2358 bp, 785 aa] {ON} YER184C (REAL)     39   0.050
YNR063W Chr14 (746943..748766) [1824 bp, 607 aa] {ON} Putative z...    38   0.050
TBLA0E00700 Chr5 complement(138121..141945) [3825 bp, 1274 aa] {...    39   0.051
KAFR0G02540 Chr7 complement(524919..527486) [2568 bp, 855 aa] {O...    39   0.052
KNAG0J00250 Chr10 (33322..37035) [3714 bp, 1237 aa] {ON} Anc_8.8...    39   0.053
KLLA0A03443g Chr1 (311628..314555) [2928 bp, 975 aa] {ON} simila...    39   0.054
KLLA0F14322g Chr6 (1328925..1331078) [2154 bp, 717 aa] {ON} unip...    38   0.054
KLTH0F03014g Chr6 (260568..262406) [1839 bp, 612 aa] {ON} simila...    38   0.056
ADR365W Chr4 (1355407..1357512) [2106 bp, 701 aa] {ON} Syntenic ...    38   0.057
Suva_10.182 Chr10 complement(342360..344330) [1971 bp, 656 aa] {...    38   0.057
Smik_16.20 Chr16 complement(26236..27657) [1422 bp, 473 aa] {ON}...    38   0.061
ZYRO0C00726g Chr3 (53977..57084) [3108 bp, 1035 aa] {ON} similar...    38   0.062
KLLA0E02663g Chr5 (244696..248025) [3330 bp, 1109 aa] {ON} conse...    38   0.064
KAFR0A03060 Chr1 complement(626316..628898) [2583 bp, 860 aa] {O...    38   0.064
Suva_15.77 Chr15 complement(123654..126743) [3090 bp, 1029 aa] {...    38   0.067
KLTH0D16456g Chr4 complement(1360294..1362279) [1986 bp, 661 aa]...    38   0.067
SAKL0A00704g Chr1 complement(78811..80967) [2157 bp, 718 aa] {ON...    38   0.068
Skud_3.181 Chr3 (293773..296268) [2496 bp, 831 aa] {ON} YCR106W ...    38   0.069
TPHA0N00440 Chr14 complement(82249..84522) [2274 bp, 757 aa] {ON...    38   0.070
Ecym_2522 Chr2 (1017930..1020710) [2781 bp, 926 aa] {ON} similar...    38   0.070
SAKL0H00682g Chr8 complement(81989..84757) [2769 bp, 922 aa] {ON...    38   0.074
SAKL0H16544g Chr8 (1454826..1454875,1454943..1456692) [1800 bp, ...    38   0.075
KLLA0F02750g Chr6 complement(250368..253814) [3447 bp, 1148 aa] ...    38   0.075
CAGL0J07150g Chr10 complement(688858..691926) [3069 bp, 1022 aa]...    38   0.078
TPHA0A04540 Chr1 (1031790..1035326) [3537 bp, 1178 aa] {ON} Anc_...    38   0.080
CAGL0E05434g Chr5 (532814..535264) [2451 bp, 816 aa] {ON} simila...    38   0.082
Suva_8.216 Chr8 complement(389549..391894) [2346 bp, 781 aa] {ON...    38   0.088
KAFR0G02520 Chr7 complement(522206..524722) [2517 bp, 838 aa] {O...    38   0.090
KLTH0C07480g Chr3 (645219..647546) [2328 bp, 775 aa] {ON} simila...    37   0.094
Smik_3.209 Chr3 (306620..309118) [2499 bp, 832 aa] {ON} YCR106W ...    37   0.095
AFR096W Chr6 (606993..609551) [2559 bp, 852 aa] {ON} Syntenic ho...    37   0.098
KLTH0D03564g Chr4 (343546..346134) [2589 bp, 862 aa] {ON} weakly...    37   0.098
Suva_14.423 Chr14 (733379..735229) [1851 bp, 616 aa] {ON} YNR063...    37   0.099
TDEL0G04920 Chr7 complement(912754..914844) [2091 bp, 696 aa] {O...    37   0.099
NCAS0C05100 Chr3 complement(1038084..1041143) [3060 bp, 1019 aa]...    37   0.100
NDAI0C04790 Chr3 complement(1100952..1104053) [3102 bp, 1033 aa]...    37   0.10 
SAKL0F11616g Chr6 complement(901066..902841) [1776 bp, 591 aa] {...    37   0.10 
YAL051W Chr1 (48564..51707) [3144 bp, 1047 aa] {ON}  OAF1Oleate-...    37   0.10 
TDEL0D06620 Chr4 (1197405..1199084) [1680 bp, 559 aa] {ON}             37   0.11 
TPHA0N01100 Chr14 (231308..232501) [1194 bp, 397 aa] {ON} Anc_6....    37   0.11 
NDAI0A08790 Chr1 complement(2026171..2029350) [3180 bp, 1059 aa]...    37   0.11 
ACL096W Chr3 (169508..172015) [2508 bp, 835 aa] {ON} Syntenic ho...    37   0.11 
KLLA0F09559g Chr6 complement(876719..878695) [1977 bp, 658 aa] {...    37   0.11 
SAKL0D14520g Chr4 complement(1192788..1195739) [2952 bp, 983 aa]...    37   0.11 
Skud_12.346 Chr12 complement(616734..618818) [2085 bp, 694 aa] {...    37   0.12 
TBLA0G00520 Chr7 (108060..110696) [2637 bp, 878 aa] {ON} Anc_6.6...    37   0.13 
Suva_5.324 Chr5 (529581..530993) [1413 bp, 470 aa] {ON} YFL052W ...    37   0.13 
Kpol_1009.5 s1009 complement(10170..13706) [3537 bp, 1178 aa] {O...    37   0.13 
Ecym_6340 Chr6 complement(652943..655801) [2859 bp, 952 aa] {ON}...    37   0.14 
TDEL0G00830 Chr7 complement(170169..172229) [2061 bp, 686 aa] {O...    37   0.14 
SAKL0D05654g Chr4 (457485..460244) [2760 bp, 919 aa] {ON} weakly...    37   0.14 
YBR150C Chr2 complement(541209..544493) [3285 bp, 1094 aa] {ON} ...    37   0.14 
KLTH0E08778g Chr5 complement(795841..798462) [2622 bp, 873 aa] {...    37   0.15 
NCAS0B08200 Chr2 (1561174..1563801) [2628 bp, 875 aa] {ON} Anc_1...    37   0.15 
CAGL0I07755g Chr9 complement(745585..748746) [3162 bp, 1053 aa] ...    37   0.16 
Skud_11.300 Chr11 (544149..546746) [2598 bp, 865 aa] {ON} YKR064...    37   0.16 
Kwal_56.23058 s56 complement(381390..383717) [2328 bp, 775 aa] {...    37   0.17 
Suva_4.400 Chr4 complement(710591..713704) [3114 bp, 1037 aa] {O...    37   0.17 
TBLA0B07920 Chr2 complement(1877300..1879603) [2304 bp, 767 aa] ...    37   0.17 
YOL089C Chr15 complement(150398..153490) [3093 bp, 1030 aa] {ON}...    37   0.17 
KNAG0F03720 Chr6 (695079..697379) [2301 bp, 766 aa] {ON} Anc_7.5...    37   0.17 
Kwal_26.8662 s26 (888487..889554) [1068 bp, 355 aa] {ON} YPL133C...    36   0.18 
Ecym_4635 Chr4 complement(1238691..1241261) [2571 bp, 856 aa] {O...    37   0.18 
Kpol_1071.10 s1071 (22248..24344) [2097 bp, 698 aa] {ON} (22248....    37   0.18 
AGL206C Chr7 complement(311846..314053) [2208 bp, 735 aa] {ON} N...    37   0.18 
Kwal_47.16939 s47 (180147..182156) [2010 bp, 669 aa] {ON} [conti...    37   0.19 
Smik_23.3 Chr23 complement(4675..6111) [1437 bp, 478 aa] {ON} YB...    36   0.19 
Suva_1.14 Chr1 (25653..28790) [3138 bp, 1045 aa] {ON} YAL051W (R...    37   0.19 
KLLA0F02387g Chr6 complement(213669..215852) [2184 bp, 727 aa] {...    37   0.20 
Kpol_2001.16 s2001 (44110..46518) [2409 bp, 802 aa] {ON} (44110....    37   0.20 
Kpol_495.21 s495 (71447..74704) [3258 bp, 1085 aa] {ON} (71447.....    37   0.20 
Ecym_1146 Chr1 (302989..304986) [1998 bp, 665 aa] {ON} similar t...    36   0.21 
Skud_15.326 Chr15 complement(588275..590731) [2457 bp, 818 aa] {...    36   0.21 
KLLA0D11286g Chr4 complement(964642..966678) [2037 bp, 678 aa] {...    36   0.22 
YFL052W Chr6 (28232..29629) [1398 bp, 465 aa] {ON} Putative zinc...    36   0.22 
KLTH0E06116g Chr5 complement(553784..556297) [2514 bp, 837 aa] {...    36   0.23 
Smik_11.326 Chr11 (552455..555052) [2598 bp, 865 aa] {ON} YKR064...    36   0.24 
ZYRO0D04422g Chr4 (366583..368877) [2295 bp, 764 aa] {ON} simila...    36   0.25 
ADR199C Chr4 complement(1048528..1051362) [2835 bp, 944 aa] {ON}...    36   0.25 
Skud_2.277 Chr2 complement(508677..511877) [3201 bp, 1066 aa] {O...    36   0.26 
Kwal_23.6425 s23 (1574518..1576725) [2208 bp, 735 aa] {ON} YKL22...    36   0.26 
TBLA0G00490 Chr7 (99344..102100) [2757 bp, 918 aa] {ON}                36   0.28 
YLR266C Chr12 complement(675619..677724) [2106 bp, 701 aa] {ON} ...    36   0.28 
SAKL0H07370g Chr8 complement(641801..642982) [1182 bp, 393 aa] {...    36   0.28 
Suva_2.187 Chr2 complement(320833..323187) [2355 bp, 784 aa] {ON...    36   0.29 
KNAG0A04480 Chr1 complement(626229..629270) [3042 bp, 1013 aa] {...    36   0.29 
Suva_8.225 Chr8 (404288..406693) [2406 bp, 801 aa] {ON} YOR172W ...    36   0.29 
KLLA0D10593g Chr4 complement(900326..903103) [2778 bp, 925 aa] {...    36   0.30 
TBLA0F02920 Chr6 (700340..703111) [2772 bp, 923 aa] {ON} Anc_7.5...    36   0.31 
ZYRO0B02574g Chr2 complement(204817..206541) [1725 bp, 574 aa] {...    36   0.33 
TBLA0A09760 Chr1 complement(2398683..2403275) [4593 bp, 1530 aa]...    36   0.33 
ABL099W Chr2 (212830..215232) [2403 bp, 800 aa] {ON} Syntenic ho...    36   0.34 
TPHA0A06090 Chr1 complement(1372559..1375102) [2544 bp, 847 aa] ...    36   0.34 
ADR405C Chr4 complement(1435702..1438125) [2424 bp, 807 aa] {ON}...    35   0.37 
NDAI0H01580 Chr8 (382179..384908) [2730 bp, 909 aa] {ON} Anc_5.5...    35   0.38 
KLLA0F10373g Chr6 (957948..958994) [1047 bp, 348 aa] {ON} some s...    35   0.39 
NCAS0A07610 Chr1 complement(1512914..1515982) [3069 bp, 1022 aa]...    35   0.39 
SAKL0D14542g Chr4 complement(1195951..1198791) [2841 bp, 946 aa]...    35   0.40 
KLTH0C10098g Chr3 complement(836528..838843) [2316 bp, 771 aa] {...    35   0.40 
TBLA0C04000 Chr3 complement(961730..963748) [2019 bp, 672 aa] {O...    35   0.41 
SAKL0G07634g Chr7 (636596..639364) [2769 bp, 922 aa] {ON} some s...    35   0.42 
Smik_15.342 Chr15 complement(595611..595820,595851..598070) [243...    35   0.44 
Suva_4.499 Chr4 complement(871565..872917) [1353 bp, 450 aa] {ON...    35   0.45 
NDAI0G04140 Chr7 (994071..997076) [3006 bp, 1001 aa] {ON} Anc_3....    35   0.46 
YOR162C Chr15 complement(639560..641992) [2433 bp, 810 aa] {ON} ...    35   0.47 
ABR174W Chr2 (728570..731164) [2595 bp, 864 aa] {ON} Syntenic ho...    35   0.48 
Skud_9.220 Chr9 complement(396576..398957) [2382 bp, 793 aa] {ON...    35   0.48 
KAFR0A01480 Chr1 (294040..296217) [2178 bp, 725 aa] {ON} Anc_1.2...    35   0.48 
NCAS0D02720 Chr4 complement(520916..523189) [2274 bp, 757 aa] {O...    35   0.50 
Kwal_14.2619 s14 (835443..838946) [3504 bp, 1167 aa] {ON} YLR256...    35   0.51 
Kwal_23.6529 s23 (1627853..1629649) [1797 bp, 598 aa] {ON} YDR03...    35   0.51 
KLLA0F04213g Chr6 (400673..402979) [2307 bp, 768 aa] {ON} simila...    35   0.51 
TDEL0H03950 Chr8 (674423..676411) [1989 bp, 662 aa] {ON} Anc_7.5...    35   0.53 
KLTH0D02222g Chr4 (220570..223113) [2544 bp, 847 aa] {ON} weakly...    35   0.53 
SAKL0G02992g Chr7 (243859..247044) [3186 bp, 1061 aa] {ON} conse...    35   0.54 
TBLA0I02540 Chr9 (590352..594131) [3780 bp, 1259 aa] {ON} Anc_8....    35   0.55 
SAKL0D03586g Chr4 (290224..292629) [2406 bp, 801 aa] {ON} simila...    35   0.56 
TPHA0F03260 Chr6 (709472..710887) [1416 bp, 471 aa] {ON} Anc_8.6...    35   0.56 
Skud_6.7 Chr6 (12394..13791) [1398 bp, 465 aa] {ON} YPR196W (REAL)     35   0.57 
Ecym_6141 Chr6 complement(258221..258565) [345 bp, 114 aa] {ON} ...    33   0.58 
TPHA0I02820 Chr9 complement(620925..624059) [3135 bp, 1044 aa] {...    35   0.59 
Ecym_5015 Chr5 (29616..32099) [2484 bp, 827 aa] {ON} similar to ...    35   0.59 
CAGL0F07909g Chr6 (776659..779808) [3150 bp, 1049 aa] {ON} some ...    35   0.59 
ACR107W Chr3 (544402..545556) [1155 bp, 384 aa] {ON} Syntenic ho...    35   0.60 
KLLA0D10197g Chr4 complement(861726..864296) [2571 bp, 856 aa] {...    35   0.61 
KAFR0A03180 Chr1 complement(655176..657716) [2541 bp, 846 aa] {O...    35   0.62 
Kwal_23.3514 s23 (324012..325751) [1740 bp, 579 aa] {ON} YMR168C...    35   0.62 
KNAG0K00820 Chr11 complement(153470..156622) [3153 bp, 1050 aa] ...    35   0.63 
TPHA0F02540 Chr6 (556797..559178) [2382 bp, 793 aa] {ON} Anc_6.6...    35   0.64 
NCAS0H01240 Chr8 (235885..237312) [1428 bp, 475 aa] {ON} Anc_6.154     35   0.65 
NCAS0H00270 Chr8 complement(45600..48320) [2721 bp, 906 aa] {ON}...    35   0.68 
KLTH0D01804g Chr4 complement(173650..175608) [1959 bp, 652 aa] {...    35   0.68 
Kpol_260.2 s260 complement(3488..5758) [2271 bp, 756 aa] {ON} co...    35   0.71 
Kwal_23.3122 s23 complement(166388..168754) [2367 bp, 788 aa] {O...    35   0.72 
NDAI0H01990 Chr8 complement(481983..485468) [3486 bp, 1161 aa] {...    35   0.72 
Kpol_534.28 s534 (64772..66079) [1308 bp, 435 aa] {ON} (64772..6...    34   0.74 
ZYRO0A00440g Chr1 complement(27895..30447) [2553 bp, 850 aa] {ON...    35   0.75 
TDEL0A03890 Chr1 (695880..698375) [2496 bp, 831 aa] {ON} Anc_5.5...    35   0.75 
SAKL0C09944g Chr3 complement(899127..902312) [3186 bp, 1061 aa] ...    35   0.76 
TDEL0D05150 Chr4 (932888..935878) [2991 bp, 996 aa] {ON} Anc_3.1...    35   0.76 
Smik_26.8 Chr26 (8892..9242) [351 bp, 117 aa] {ON} YER184C (REAL)      33   0.76 
Kwal_26.6664 s26 complement(11094..12833) [1740 bp, 579 aa] {ON}...    35   0.76 
KNAG0E00210 Chr5 (24545..27391) [2847 bp, 948 aa] {ON} Anc_7.17 ...    35   0.77 
TBLA0A05850 Chr1 complement(1446872..1448845) [1974 bp, 657 aa] ...    35   0.77 
KLTH0H16170g Chr8 complement(1391996..1393855) [1860 bp, 619 aa]...    34   0.79 
TDEL0A02690 Chr1 (485785..487953) [2169 bp, 722 aa] {ON}               34   0.84 
Suva_10.364 Chr10 complement(637047..639170) [2124 bp, 707 aa] {...    34   0.85 
NDAI0G05530 Chr7 (1360413..1363973) [3561 bp, 1186 aa] {ON}            34   0.88 
KNAG0M00970 Chr13 (169393..172926) [3534 bp, 1177 aa] {ON} Anc_6...    34   0.88 
NCAS0D04190 Chr4 (793242..795914) [2673 bp, 890 aa] {ON} Anc_6.279     34   0.90 
YLR098C Chr12 complement(337527..339473) [1947 bp, 648 aa] {ON} ...    34   0.91 
YCR106W Chr3 (310958..313456) [2499 bp, 832 aa] {ON}  RDS1Putati...    34   0.92 
NCAS0D00890 Chr4 (166411..168324) [1914 bp, 637 aa] {ON} Anc_2.3...    34   0.92 
KLTH0D10428g Chr4 (861135..862196) [1062 bp, 353 aa] {ON} simila...    34   0.93 
NCAS0C01530 Chr3 (281676..282899) [1224 bp, 407 aa] {ON} Anc_8.642     34   0.94 
TPHA0C02220 Chr3 (504550..506658) [2109 bp, 702 aa] {ON} Anc_8.4...    34   0.95 
CAGL0D02904g Chr4 complement(302952..305615) [2664 bp, 887 aa] {...    34   0.95 
Suva_2.598 Chr2 (1064757..1067654) [2898 bp, 965 aa] {ON} YDR421...    34   0.97 
YPR196W Chr16 (931376..932788) [1413 bp, 470 aa] {ON} Putative m...    34   0.97 
TPHA0G00380 Chr7 complement(65673..68294) [2622 bp, 873 aa] {ON}       34   0.98 
Ecym_5001 Chr5 (915..2738) [1824 bp, 607 aa] {ON} similar to Ash...    34   0.99 
KAFR0G02450 Chr7 (508147..511353) [3207 bp, 1068 aa] {ON} Anc_6....    34   0.99 
Skud_4.287 Chr4 complement(501344..503698) [2355 bp, 784 aa] {ON...    34   1.00 
TDEL0H04340 Chr8 complement(746566..749535) [2970 bp, 989 aa] {O...    34   1.00 
Kpol_1049.19 s1049 (38439..41270) [2832 bp, 943 aa] {ON} (38439....    34   1.0  
NCAS0A15020 Chr1 (2957420..2959849) [2430 bp, 809 aa] {ON} Anc_7...    34   1.0  
KLLA0D12672g Chr4 complement(1076011..1078608) [2598 bp, 865 aa]...    34   1.0  
KNAG0B05120 Chr2 (982236..984902) [2667 bp, 888 aa] {ON}               34   1.0  
Kpol_538.42 s538 complement(89752..93018) [3267 bp, 1088 aa] {ON...    34   1.1  
YLR014C Chr12 complement(172268..174982) [2715 bp, 904 aa] {ON} ...    34   1.1  
Skud_12.166 Chr12 complement(320672..322621) [1950 bp, 649 aa] {...    34   1.1  
Skud_2.371 Chr2 complement(667091..668680) [1590 bp, 529 aa] {ON...    34   1.1  
Ecym_5131 Chr5 (278980..281292) [2313 bp, 770 aa] {ON} similar t...    34   1.1  
TBLA0B04800 Chr2 complement(1127000..1129333) [2334 bp, 777 aa] ...    34   1.1  
Ecym_2263 Chr2 (518089..519615) [1527 bp, 508 aa] {ON} similar t...    34   1.1  
KAFR0E01250 Chr5 complement(249538..251748) [2211 bp, 736 aa] {O...    34   1.1  
TDEL0E03910 Chr5 (732533..735121) [2589 bp, 862 aa] {ON} Anc_5.2...    34   1.1  
Kwal_55.21884 s55 (1020057..1022705) [2649 bp, 882 aa] {ON} YLR4...    34   1.1  
ZYRO0E08272g Chr5 (651705..654089) [2385 bp, 794 aa] {ON} simila...    34   1.1  
Smik_12.77 Chr12 complement(159125..161836) [2712 bp, 903 aa] {O...    34   1.1  
KLLA0F18084g Chr6 complement(1652031..1654613) [2583 bp, 860 aa]...    34   1.1  
ZYRO0A13596g Chr1 complement(1080653..1082599) [1947 bp, 648 aa]...    34   1.2  
Skud_4.87 Chr4 (152240..153826) [1587 bp, 528 aa] {ON} YDL170W (...    34   1.2  
NCAS0F01070 Chr6 (211085..213799) [2715 bp, 904 aa] {ON} Anc_5.5...    34   1.2  
TPHA0F02550 Chr6 (559614..562013) [2400 bp, 799 aa] {ON} Anc_6.6...    34   1.2  
ZYRO0F06556g Chr6 (542397..543476) [1080 bp, 359 aa] {ON} simila...    33   1.2  
TBLA0C01910 Chr3 complement(448085..448684,448765..451611) [3447...    34   1.2  
YLR278C Chr12 complement(699999..704024) [4026 bp, 1341 aa] {ON}...    34   1.2  
Ecym_7203 Chr7 (415869..418523) [2655 bp, 884 aa] {ON} similar t...    34   1.3  
KLLA0C04620g Chr3 complement(422705..426514) [3810 bp, 1269 aa] ...    34   1.3  
Suva_10.376 Chr10 complement(660780..664688) [3909 bp, 1302 aa] ...    34   1.3  
KLTH0H16236g Chr8 (1400457..1402148) [1692 bp, 563 aa] {ON} cons...    34   1.3  
NDAI0D00900 Chr4 (205039..207636) [2598 bp, 865 aa] {ON}               34   1.3  
KLTH0H05720g Chr8 (505672..507006) [1335 bp, 444 aa] {ON} simila...    33   1.3  
NCAS0A06710 Chr1 (1324253..1326562) [2310 bp, 769 aa] {ON} Anc_5...    34   1.3  
Smik_12.357 Chr12 complement(638342..642208) [3867 bp, 1288 aa] ...    34   1.3  
CAGL0K06985g Chr11 (681944..683734) [1791 bp, 596 aa] {ON} simil...    33   1.4  
Smik_6.452 Chr6 (741922..744558) [2637 bp, 878 aa] {ON} YPL248C ...    34   1.4  
TBLA0H00680 Chr8 complement(144914..147556) [2643 bp, 880 aa] {O...    34   1.4  
YPL248C Chr16 complement(79711..82356) [2646 bp, 881 aa] {ON}  G...    34   1.4  
Ecym_2265 Chr2 (521409..523064) [1656 bp, 551 aa] {ON} similar t...    33   1.4  
Skud_12.361 Chr12 complement(641047..645075) [4029 bp, 1342 aa] ...    34   1.4  
Kpol_534.29 s534 (66570..67142,67144..67155,67158..68246) [1674 ...    33   1.4  
Ecym_3001 Chr3 (1150..3042) [1893 bp, 630 aa] {ON} similar to As...    33   1.4  
Kwal_55.20722 s55 (530982..533465) [2484 bp, 827 aa] {ON} YCR106...    33   1.5  
NCAS0F00310 Chr6 (49514..52084) [2571 bp, 856 aa] {ON}                 33   1.5  
Kpol_1061.37 s1061 complement(102667..104616) [1950 bp, 649 aa] ...    33   1.5  
KLTH0F05258g Chr6 complement(462417..464825) [2409 bp, 802 aa] {...    33   1.5  
YOR172W Chr15 (654210..656570) [2361 bp, 786 aa] {ON}  YRM1Zn2-C...    33   1.5  
AFL033W Chr6 (373485..374633) [1149 bp, 382 aa] {ON} Syntenic ho...    33   1.5  
Ecym_4153 Chr4 complement(330831..333281) [2451 bp, 816 aa] {ON}...    33   1.5  
Skud_12.82 Chr12 complement(164119..166818) [2700 bp, 899 aa] {O...    33   1.6  
KNAG0D05240 Chr4 (953893..956502) [2610 bp, 869 aa] {ON} Anc_7.5...    33   1.6  
TPHA0N01110 Chr14 (232891..233982) [1092 bp, 363 aa] {ON} Anc_6....    33   1.6  
NCAS0G01100 Chr7 complement(193052..195859) [2808 bp, 935 aa] {O...    33   1.6  
Kpol_1008.13 s1008 (21147..23855) [2709 bp, 902 aa] {ON} (21147....    33   1.8  
Kwal_14.1631 s14 (397794..399125) [1332 bp, 443 aa] {ON} YBR240C...    33   1.8  
ZYRO0D14058g Chr4 (1188615..1190891) [2277 bp, 758 aa] {ON} simi...    33   1.8  
NCAS0D01290 Chr4 complement(233978..236194) [2217 bp, 738 aa] {O...    33   1.8  
Ecym_5183 Chr5 complement(385669..388101) [2433 bp, 810 aa] {ON}...    33   1.9  
NDAI0K02840 Chr11 (640461..643634) [3174 bp, 1057 aa] {ON} Anc_6...    33   1.9  
Ecym_3382 Chr3 (724394..726190) [1797 bp, 598 aa] {ON} similar t...    33   1.9  
Skud_15.532 Chr15 complement(959437..962439) [3003 bp, 1000 aa] ...    33   2.0  
Skud_20.3 Chr20 (4504..5916) [1413 bp, 470 aa] {ON} YBR297W (REAL)     33   2.0  
Kpol_1042.6 s1042 (9848..11548,11550..11612,11615..12193) [2343 ...    33   2.0  
SAKL0D05236g Chr4 complement(414228..415826) [1599 bp, 532 aa] {...    33   2.0  
Kpol_345.3 s345 complement(7411..11517) [4107 bp, 1368 aa] {ON} ...    33   2.0  
TDEL0D01450 Chr4 (284869..287706) [2838 bp, 945 aa] {ON} Anc_1.2...    33   2.0  
Ecym_5017 Chr5 (36647..39583) [2937 bp, 978 aa] {ON} similar to ...    33   2.0  
Kwal_8.580 s8 (13266..15182) [1917 bp, 638 aa] {ON} [contig 311]...    33   2.1  
SAKL0D12254g Chr4 complement(1013532..1017065) [3534 bp, 1177 aa...    33   2.1  
Ecym_6355 Chr6 (689363..691132) [1770 bp, 589 aa] {ON} similar t...    33   2.1  
Kwal_26.7095 s26 (211883..214399) [2517 bp, 838 aa] {ON} YOR363C...    33   2.1  
SAKL0F00418g Chr6 (34751..36430) [1680 bp, 559 aa] {ON} conserve...    33   2.1  
KAFR0G03520 Chr7 complement(728360..729694) [1335 bp, 444 aa] {O...    33   2.2  
KNAG0B01720 Chr2 complement(314126..315787) [1662 bp, 553 aa] {O...    33   2.2  
CAGL0H00396g Chr8 complement(37005..39827) [2823 bp, 940 aa] {ON...    33   2.3  
SAKL0D00264g Chr4 complement(24754..27300) [2547 bp, 848 aa] {ON...    33   2.4  
NCAS0H00780 Chr8 complement(140472..143201) [2730 bp, 909 aa] {O...    33   2.4  
Smik_2.382 Chr2 complement(684520..686112) [1593 bp, 530 aa] {ON...    33   2.5  
TPHA0F02630 Chr6 complement(583511..587299) [3789 bp, 1262 aa] {...    33   2.5  
KNAG0D00690 Chr4 (105640..108267) [2628 bp, 875 aa] {ON} Anc_6.2...    33   2.5  
TPHA0H01980 Chr8 (467688..470669) [2982 bp, 993 aa] {ON} Anc_6.2...    33   2.5  
YDR421W Chr4 (1312040..1314892) [2853 bp, 950 aa] {ON}  ARO80Zin...    33   2.6  
Suva_10.94 Chr10 complement(178366..181086) [2721 bp, 906 aa] {O...    33   2.6  
ZYRO0D14080g Chr4 (1191418..1194183) [2766 bp, 921 aa] {ON} weak...    33   2.7  
KLTH0E03256g Chr5 complement(294997..297021) [2025 bp, 674 aa] {...    33   2.8  
TDEL0G04090 Chr7 complement(744499..746730) [2232 bp, 743 aa] {O...    33   2.8  
KNAG0F03040 Chr6 complement(576753..580325) [3573 bp, 1190 aa] {...    33   2.8  
ADR403C Chr4 complement(1429115..1432027) [2913 bp, 970 aa] {ON}...    33   2.8  
NDAI0I02190 Chr9 (501867..504074) [2208 bp, 735 aa] {ON} Anc_6.6...    33   2.8  
NCAS0A10550 Chr1 (2100725..2102950) [2226 bp, 741 aa] {ON} Anc_3...    33   2.8  
TDEL0H01310 Chr8 (224588..226165) [1578 bp, 525 aa] {ON} Anc_1.2...    33   2.9  
NDAI0F02050 Chr6 complement(503400..504740) [1341 bp, 446 aa] {O...    32   2.9  
KLLA0F13904g Chr6 complement(1287758..1289497) [1740 bp, 579 aa]...    33   2.9  
TDEL0E00160 Chr5 (16083..17978) [1896 bp, 631 aa] {ON}                 33   3.0  
ZYRO0G17512g Chr7 complement(1447970..1449541) [1572 bp, 523 aa]...    33   3.0  
CAGL0L04576g Chr12 (528957..531554) [2598 bp, 865 aa] {ON} simil...    33   3.0  
YDL170W Chr4 (156318..157904) [1587 bp, 528 aa] {ON}  UGA3Transc...    32   3.0  
TBLA0I01890 Chr9 complement(423851..426328) [2478 bp, 825 aa] {O...    33   3.1  
NDAI0D01770 Chr4 (411567..413924) [2358 bp, 785 aa] {ON} Anc_5.322     33   3.1  
KLLA0C07535g Chr3 (658746..660620) [1875 bp, 624 aa] {ON} some s...    32   3.2  
Suva_15.415 Chr15 (726296..728899) [2604 bp, 867 aa] {ON} YCR106...    33   3.3  
Kwal_26.8200 s26 (688203..690161) [1959 bp, 652 aa] {ON} YMR019W...    32   3.4  
Suva_8.421 Chr8 complement(757924..760932) [3009 bp, 1002 aa] {O...    32   3.4  
Smik_15.547 Chr15 complement(966368..969355) [2988 bp, 995 aa] {...    32   3.4  
Kpol_1042.7 s1042 (12882..15233) [2352 bp, 783 aa] {ON} (12882.....    32   3.4  
Smik_18.8 Chr18 (12069..14396) [2328 bp, 775 aa] {ON} YOR172W (R...    32   3.5  
NDAI0I01940 Chr9 (450330..454112) [3783 bp, 1260 aa] {ON} Anc_6.75     32   3.5  
KAFR0B04830 Chr2 (1003592..1005487) [1896 bp, 631 aa] {ON} Anc_2...    32   3.6  
KAFR0H02600 Chr8 complement(496353..497432) [1080 bp, 359 aa] {O...    32   3.6  
Skud_2.372 Chr2 complement(669194..670552) [1359 bp, 452 aa] {ON...    32   3.6  
NCAS0D02960 Chr4 complement(563406..566924) [3519 bp, 1172 aa] {...    32   3.7  
ZYRO0D01650g Chr4 complement(131688..134270) [2583 bp, 860 aa] {...    32   3.7  
YBR240C Chr2 complement(700490..701842) [1353 bp, 450 aa] {ON}  ...    32   3.8  
KNAG0A04550 Chr1 (642548..645208) [2661 bp, 886 aa] {ON} Anc_8.4...    32   3.8  
YOR363C Chr15 complement(1020222..1023212) [2991 bp, 996 aa] {ON...    32   3.8  
NDAI0D00220 Chr4 complement(43353..46187) [2835 bp, 944 aa] {ON}...    32   3.8  
NCAS0A03070 Chr1 (603639..605609) [1971 bp, 656 aa] {ON}               32   3.9  
KAFR0C04980 Chr3 (987900..990755) [2856 bp, 951 aa] {ON} Anc_7.1...    32   3.9  
Suva_16.59 Chr16 complement(88631..91318) [2688 bp, 895 aa] {ON}...    32   3.9  
Ecym_3112 Chr3 (203876..207310) [3435 bp, 1144 aa] {ON} similar ...    32   3.9  
TPHA0H01240 Chr8 (274496..277129) [2634 bp, 877 aa] {ON} Anc_5.5...    32   4.0  
Smik_6.15 Chr6 (22860..24260) [1401 bp, 466 aa] {ON} YFL052W (REAL)    32   4.0  
NDAI0A05750 Chr1 complement(1302180..1304459) [2280 bp, 759 aa] ...    32   4.1  
ZYRO0G19338g Chr7 complement(1601895..1603856) [1962 bp, 653 aa]...    32   4.2  
TBLA0G00570 Chr7 (120848..123202) [2355 bp, 784 aa] {ON} Anc_4.1...    32   4.2  
Smik_2.383 Chr2 complement(686676..688022) [1347 bp, 448 aa] {ON...    32   4.3  
TDEL0G04890 Chr7 (903504..903581,903640..905316) [1755 bp, 584 a...    32   4.4  
NDAI0D02730 Chr4 (629970..633647) [3678 bp, 1225 aa] {ON} Anc_6....    32   4.4  
ZYRO0D14432g Chr4 complement(1222977..1226489) [3513 bp, 1170 aa...    32   4.6  
TBLA0J00620 Chr10 complement(140248..142545) [2298 bp, 765 aa] {...    32   4.6  
Skud_7.646 Chr7 (1073386..1074795) [1410 bp, 469 aa] {ON} YPR196...    32   4.8  
Kwal_14.1636 s14 (400872..402242) [1371 bp, 456 aa] {ON} YBR239C...    32   5.0  
KLLA0F20680g Chr6 (1924148..1926511) [2364 bp, 787 aa] {ON} weak...    32   5.3  
KLLA0D15356g Chr4 (1301848..1303722) [1875 bp, 624 aa] {ON} some...    32   5.4  
Suva_4.498 Chr4 complement(868844..870101,870741..871066) [1584 ...    32   5.5  
NDAI0D03180 Chr4 (759984..762953) [2970 bp, 989 aa] {ON} Anc_4.3...    32   5.5  
TDEL0F02240 Chr6 complement(409453..411393) [1941 bp, 646 aa] {O...    32   5.6  
KLLA0A03421g Chr1 (308414..311056) [2643 bp, 880 aa] {ON} weakly...    32   5.8  
NCAS0F00370 Chr6 complement(61819..65148) [3330 bp, 1109 aa] {ON...    32   5.8  
Kpol_1018.30 s1018 complement(81534..83840,83842..84180) [2646 b...    32   5.8  
SAKL0C13200g Chr3 (1167325..1168065) [741 bp, 246 aa] {ON} simil...    31   5.8  
TPHA0E00880 Chr5 complement(177030..180164) [3135 bp, 1044 aa] {...    32   6.1  
AGR280C Chr7 complement(1266912..1270232) [3321 bp, 1106 aa] {ON...    32   6.1  
Smik_12.6 Chr12 complement(17429..19966) [2538 bp, 845 aa] {ON} ...    32   6.1  
TPHA0K01100 Chr11 (228134..231619) [3486 bp, 1161 aa] {ON} Anc_6...    32   6.2  
TBLA0B07050 Chr2 (1669768..1671996) [2229 bp, 742 aa] {ON}             32   6.3  
KAFR0D04590 Chr4 (900318..902840) [2523 bp, 840 aa] {ON} Anc_5.3...    32   6.4  
Kwal_55.20674 s55 complement(515392..516147) [756 bp, 252 aa] {O...    31   6.5  
CAGL0M02651g Chr13 complement(304583..305971) [1389 bp, 462 aa] ...    32   6.5  
Suva_10.10 Chr10 complement(16722..18389) [1668 bp, 555 aa] {ON}...    32   6.8  
KLLA0D00484g Chr4 (44879..47893) [3015 bp, 1004 aa] {ON} conserv...    32   6.8  
KLTH0H05764g Chr8 (508783..510153) [1371 bp, 456 aa] {ON} simila...    31   6.9  
ZYRO0C18282g Chr3 (1431515..1433665) [2151 bp, 716 aa] {ON} cons...    32   6.9  
TDEL0B06360 Chr2 complement(1127150..1130095) [2946 bp, 981 aa] ...    32   7.1  
TBLA0E01110 Chr5 (243534..246755) [3222 bp, 1073 aa] {ON} Anc_6....    32   7.1  
Kpol_1043.23 s1043 complement(44809..46680) [1872 bp, 623 aa] {O...    31   7.3  
KLTH0G15180g Chr7 (1326581..1329871) [3291 bp, 1096 aa] {ON} sim...    32   7.3  
YBR239C Chr2 complement(698354..699943) [1590 bp, 529 aa] {ON}  ...    31   7.4  
Suva_11.187 Chr11 (348570..352085) [3516 bp, 1171 aa] {ON} YKL03...    31   8.2  
TBLA0H00720 Chr8 (157413..159269) [1857 bp, 618 aa] {ON} Anc_8.4...    31   8.2  
KLTH0F07854g Chr6 complement(677647..680013) [2367 bp, 788 aa] {...    31   8.4  
NCAS0D02540 Chr4 complement(484060..486732) [2673 bp, 890 aa] {O...    31   8.5  
KNAG0J01530 Chr10 (281029..282111) [1083 bp, 360 aa] {ON} Anc_8....    31   9.2  
Smik_6.23 Chr6 complement(37285..38955) [1671 bp, 556 aa] {ON} Y...    31   9.3  
Kwal_56.22462 s56 complement(139779..144404) [4626 bp, 1541 aa] ...    31   9.3  
CAGL0G09757g Chr7 (930351..934622) [4272 bp, 1423 aa] {ON} some ...    31   9.5  
KLTH0G03718g Chr7 (292858..295431) [2574 bp, 857 aa] {ON} simila...    31   9.7  

>Smik_15.561 Chr15 (997239..998879) [1641 bp, 546 aa] {ON} YOR380W
           (REAL)
          Length = 546

 Score = 1139 bits (2947), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 546/546 (100%), Positives = 546/546 (100%)

Query: 1   MASSVPNIPSYKRQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMDKDRSSSSSFP 60
           MASSVPNIPSYKRQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMDKDRSSSSSFP
Sbjct: 1   MASSVPNIPSYKRQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMDKDRSSSSSFP 60

Query: 61  VQKLDELPHAPESKPFAASNIHGNEVSSVDTQTVTNQSITDPVKSRYTIQHSAVAFPRCL 120
           VQKLDELPHAPESKPFAASNIHGNEVSSVDTQTVTNQSITDPVKSRYTIQHSAVAFPRCL
Sbjct: 61  VQKLDELPHAPESKPFAASNIHGNEVSSVDTQTVTNQSITDPVKSRYTIQHSAVAFPRCL 120

Query: 121 GLELRSANPPRLHSFAWHCGIRPEENPSSHVLLSELITKEEYYRVSKVYFSVVHPIFDVV 180
           GLELRSANPPRLHSFAWHCGIRPEENPSSHVLLSELITKEEYYRVSKVYFSVVHPIFDVV
Sbjct: 121 GLELRSANPPRLHSFAWHCGIRPEENPSSHVLLSELITKEEYYRVSKVYFSVVHPIFDVV 180

Query: 181 DPKQLAKNVEEYWAGNISNFEYGAVIAGVVALGSFFLGSIGHPREMDVVQYAKGILDDPT 240
           DPKQLAKNVEEYWAGNISNFEYGAVIAGVVALGSFFLGSIGHPREMDVVQYAKGILDDPT
Sbjct: 181 DPKQLAKNVEEYWAGNISNFEYGAVIAGVVALGSFFLGSIGHPREMDVVQYAKGILDDPT 240

Query: 241 FSRIPTVEHVSAWVLRTIYLRATSRPHVAWLASCVTIHLSEAIGLHQDIDKGEFSMTSGV 300
           FSRIPTVEHVSAWVLRTIYLRATSRPHVAWLASCVTIHLSEAIGLHQDIDKGEFSMTSGV
Sbjct: 241 FSRIPTVEHVSAWVLRTIYLRATSRPHVAWLASCVTIHLSEAIGLHQDIDKGEFSMTSGV 300

Query: 301 TLRRTAGFNEHTKRLFWCAWSINTILSYDYGRSSVALNRITCKPVEETEGSYTIHLVALA 360
           TLRRTAGFNEHTKRLFWCAWSINTILSYDYGRSSVALNRITCKPVEETEGSYTIHLVALA
Sbjct: 301 TLRRTAGFNEHTKRLFWCAWSINTILSYDYGRSSVALNRITCKPVEETEGSYTIHLVALA 360

Query: 361 QTIPQGTVNTDLTQLLNALTAIHKSPNAHPFLLLTKCDICLSLYRRLRLLNHVLDKSVVL 420
           QTIPQGTVNTDLTQLLNALTAIHKSPNAHPFLLLTKCDICLSLYRRLRLLNHVLDKSVVL
Sbjct: 361 QTIPQGTVNTDLTQLLNALTAIHKSPNAHPFLLLTKCDICLSLYRRLRLLNHVLDKSVVL 420

Query: 421 QIIDIGNAALSAAYALVKLGQSWWNVLSTSFQYVCVLLAIDTPESLSHVAAAMKTLDNIT 480
           QIIDIGNAALSAAYALVKLGQSWWNVLSTSFQYVCVLLAIDTPESLSHVAAAMKTLDNIT
Sbjct: 421 QIIDIGNAALSAAYALVKLGQSWWNVLSTSFQYVCVLLAIDTPESLSHVAAAMKTLDNIT 480

Query: 481 EVLGTHIALEAQKTAKLLLEDSMKKKRQEIQQLEQATHDRSTFENTNSLDIDWDALFDPS 540
           EVLGTHIALEAQKTAKLLLEDSMKKKRQEIQQLEQATHDRSTFENTNSLDIDWDALFDPS
Sbjct: 481 EVLGTHIALEAQKTAKLLLEDSMKKKRQEIQQLEQATHDRSTFENTNSLDIDWDALFDPS 540

Query: 541 GTLGFM 546
           GTLGFM
Sbjct: 541 GTLGFM 546

>Skud_15.546 Chr15 (990335..991963) [1629 bp, 542 aa] {ON} YOR380W
           (REAL)
          Length = 542

 Score =  902 bits (2331), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/546 (80%), Positives = 479/546 (87%), Gaps = 4/546 (0%)

Query: 1   MASSVPNIPSYKRQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMDKDRSSSSSFP 60
           M SS  N   YKRQRVRKACVPCRERKRKCNGKSPCEMCI+YGY CHY D D SS+S   
Sbjct: 1   MVSSGSNSQPYKRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYTDVDGSSTSP-- 58

Query: 61  VQKLDELPHAPESKPFAASNIHGNEVSSVDTQTVTNQSITDPVKSRYTIQHSAVAFPRCL 120
             ++DE P+  +++P++  NI  NE  SVD Q VTNQ+I DP+KSRYTIQHSAVAFPRCL
Sbjct: 59  --RVDETPYGTDNRPYSLPNILRNEARSVDAQNVTNQNIIDPIKSRYTIQHSAVAFPRCL 116

Query: 121 GLELRSANPPRLHSFAWHCGIRPEENPSSHVLLSELITKEEYYRVSKVYFSVVHPIFDVV 180
           GLELRS NPPRLHSFAWHCGIRPEENP+SH+LLS L+TKEEYYR+SKVYFSVVHPIFDVV
Sbjct: 117 GLELRSTNPPRLHSFAWHCGIRPEENPNSHILLSGLVTKEEYYRISKVYFSVVHPIFDVV 176

Query: 181 DPKQLAKNVEEYWAGNISNFEYGAVIAGVVALGSFFLGSIGHPREMDVVQYAKGILDDPT 240
           DP+QLAKNVE YW G++   EYGAVIAGV+ALGSFFLGS+GHPREMDVVQYAKGILDDPT
Sbjct: 177 DPEQLAKNVERYWDGDVKMLEYGAVIAGVIALGSFFLGSLGHPREMDVVQYAKGILDDPT 236

Query: 241 FSRIPTVEHVSAWVLRTIYLRATSRPHVAWLASCVTIHLSEAIGLHQDIDKGEFSMTSGV 300
           F RIPTVE VSAWVLRTIYLRATSRPHVAWLASC+TIHLSEAIGLH +ID+ +  MTS V
Sbjct: 237 FCRIPTVEQVSAWVLRTIYLRATSRPHVAWLASCITIHLSEAIGLHHEIDREDLVMTSNV 296

Query: 301 TLRRTAGFNEHTKRLFWCAWSINTILSYDYGRSSVALNRITCKPVEETEGSYTIHLVALA 360
            LRRT   +EHT+RLFWCAWSINTILSYDYGRSSV LNRITCK V+ETEG++T+HLVALA
Sbjct: 297 PLRRTTEVSEHTRRLFWCAWSINTILSYDYGRSSVTLNRITCKSVKETEGNHTVHLVALA 356

Query: 361 QTIPQGTVNTDLTQLLNALTAIHKSPNAHPFLLLTKCDICLSLYRRLRLLNHVLDKSVVL 420
           Q IPQ  VN + TQLL AL A+HKSPNAHPFL LTK DICLSLYRRLRLLNH+LDKSVVL
Sbjct: 357 QLIPQDCVNANATQLLQALAAVHKSPNAHPFLSLTKSDICLSLYRRLRLLNHILDKSVVL 416

Query: 421 QIIDIGNAALSAAYALVKLGQSWWNVLSTSFQYVCVLLAIDTPESLSHVAAAMKTLDNIT 480
           QIIDIGN ALSAAYALVKL Q+WWNVLSTSFQYVCVLLAIDTPESLSHVAAAM+TLDNIT
Sbjct: 417 QIIDIGNTALSAAYALVKLDQAWWNVLSTSFQYVCVLLAIDTPESLSHVAAAMRTLDNIT 476

Query: 481 EVLGTHIALEAQKTAKLLLEDSMKKKRQEIQQLEQATHDRSTFENTNSLDIDWDALFDPS 540
           +VLGTHIA EAQKTAKLLLEDSMKKKRQEIQQLE+ATH RST E T+ LDIDWD L DPS
Sbjct: 477 QVLGTHIAYEAQKTAKLLLEDSMKKKRQEIQQLERATHQRSTVETTHLLDIDWDVLLDPS 536

Query: 541 GTLGFM 546
            TL FM
Sbjct: 537 DTLNFM 542

>Suva_8.436 Chr8 (788699..790336) [1638 bp, 545 aa] {ON} YOR380W
           (REAL)
          Length = 545

 Score =  882 bits (2279), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/546 (75%), Positives = 476/546 (87%), Gaps = 1/546 (0%)

Query: 1   MASSVPNIPSYKRQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMDKDRSSSSSFP 60
           MASS  N   YKRQRVRKACVPCRERKRKCNGKSPCEMC++YGYVCHY ++D   +SS  
Sbjct: 1   MASSGSNPQPYKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTEEDGPLASSR- 59

Query: 61  VQKLDELPHAPESKPFAASNIHGNEVSSVDTQTVTNQSITDPVKSRYTIQHSAVAFPRCL 120
           + +++ELPH  +++P+   +I GN   S D+Q VTN +I D  KSRYTIQHSAVAFPR L
Sbjct: 60  MNQVEELPHDTKNRPYVPLDIIGNGTHSTDSQHVTNGNIIDRTKSRYTIQHSAVAFPRSL 119

Query: 121 GLELRSANPPRLHSFAWHCGIRPEENPSSHVLLSELITKEEYYRVSKVYFSVVHPIFDVV 180
           GLELRS NPPRLH FAWHCGIRPEE PS HV LS+++TKEEYYR+SKVYFSVVHPIFD+V
Sbjct: 120 GLELRSTNPPRLHCFAWHCGIRPEEKPSFHVPLSDIVTKEEYYRISKVYFSVVHPIFDIV 179

Query: 181 DPKQLAKNVEEYWAGNISNFEYGAVIAGVVALGSFFLGSIGHPREMDVVQYAKGILDDPT 240
           DP+QL KNVE+YW G+    EYGAVIAGV+ALGSFFLGS+GHPREMD++QYAKGILDDPT
Sbjct: 180 DPEQLGKNVEKYWNGDAETSEYGAVIAGVIALGSFFLGSLGHPREMDIIQYAKGILDDPT 239

Query: 241 FSRIPTVEHVSAWVLRTIYLRATSRPHVAWLASCVTIHLSEAIGLHQDIDKGEFSMTSGV 300
           FSRIP+VE +SAWVLRTIYLRAT+RPHVAWLASC+TIHLSEAIGLH +ID+ + ++T+ V
Sbjct: 240 FSRIPSVEQISAWVLRTIYLRATARPHVAWLASCLTIHLSEAIGLHHEIDREDLALTNNV 299

Query: 301 TLRRTAGFNEHTKRLFWCAWSINTILSYDYGRSSVALNRITCKPVEETEGSYTIHLVALA 360
            L+RT   +EHT+RLFW AWSINTILSYDYGRSSV LNRITCKPV+ET+G+YT++LV+LA
Sbjct: 300 PLKRTTEVSEHTRRLFWSAWSINTILSYDYGRSSVTLNRITCKPVKETDGNYTVNLVSLA 359

Query: 361 QTIPQGTVNTDLTQLLNALTAIHKSPNAHPFLLLTKCDICLSLYRRLRLLNHVLDKSVVL 420
           Q +PQ +VN ++TQLL AL A+H+SP+AHPFL LTK DICLS YRRLRLLNH+LDKSVV 
Sbjct: 360 QLVPQESVNANVTQLLQALAAVHESPDAHPFLSLTKADICLSFYRRLRLLNHILDKSVVS 419

Query: 421 QIIDIGNAALSAAYALVKLGQSWWNVLSTSFQYVCVLLAIDTPESLSHVAAAMKTLDNIT 480
           QIIDIGN AL+AAYALVK+ Q+WWNVLSTSFQYVCVLLAIDTPESLSHVAAAM+TLDNIT
Sbjct: 420 QIIDIGNTALAAAYALVKIDQAWWNVLSTSFQYVCVLLAIDTPESLSHVAAAMRTLDNIT 479

Query: 481 EVLGTHIALEAQKTAKLLLEDSMKKKRQEIQQLEQATHDRSTFENTNSLDIDWDALFDPS 540
           +VLGTHIA EAQKTAKLLLEDS+KKKRQEIQQLEQATH RS  E T+ LDIDWDAL DPS
Sbjct: 480 QVLGTHIAFEAQKTAKLLLEDSVKKKRQEIQQLEQATHQRSAPETTHLLDIDWDALLDPS 539

Query: 541 GTLGFM 546
            TL FM
Sbjct: 540 DTLSFM 545

>YOR380W Chr15 (1051290..1052930) [1641 bp, 546 aa] {ON}
           RDR1Transcriptional repressor involved in the control of
           multidrug resistance; negatively regulates expression of
           the PDR5 gene; member of the Gal4p family of zinc
           cluster proteins
          Length = 546

 Score =  856 bits (2212), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/547 (78%), Positives = 476/547 (87%), Gaps = 2/547 (0%)

Query: 1   MASSVPNIPSYKRQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMDKDRSSSSSFP 60
           MAS       +KRQRVRKACVPCRERKRKCNGKSPCEMC++YGYVCHY+D  R  S+S  
Sbjct: 1   MASPGSTALPHKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYID-GRVPSASPQ 59

Query: 61  VQKLDELPHAPESKPFAASNIHGNEVSS-VDTQTVTNQSITDPVKSRYTIQHSAVAFPRC 119
           VQ++ E     ES+PF    IH NE    ++TQ VT+Q+I DP KSRYTIQHSAVAFPRC
Sbjct: 60  VQQVGETSPDTESRPFVLPGIHRNEQPQPINTQNVTSQNIVDPTKSRYTIQHSAVAFPRC 119

Query: 120 LGLELRSANPPRLHSFAWHCGIRPEENPSSHVLLSELITKEEYYRVSKVYFSVVHPIFDV 179
           LGLELRS NPPRLHSFAWHCGIRPEENP+SHVLLS+L+TKEEYYR+SKVYFSVVHPIFDV
Sbjct: 120 LGLELRSTNPPRLHSFAWHCGIRPEENPNSHVLLSDLVTKEEYYRISKVYFSVVHPIFDV 179

Query: 180 VDPKQLAKNVEEYWAGNISNFEYGAVIAGVVALGSFFLGSIGHPREMDVVQYAKGILDDP 239
           V+P+QLAKNVE+YW G++   EYGAVIAGV+ALGSFF+GS+GHPREMD+VQYAKGILDDP
Sbjct: 180 VNPEQLAKNVEKYWDGDVKTLEYGAVIAGVIALGSFFMGSLGHPREMDIVQYAKGILDDP 239

Query: 240 TFSRIPTVEHVSAWVLRTIYLRATSRPHVAWLASCVTIHLSEAIGLHQDIDKGEFSMTSG 299
           TFSRIPTVE VSAWVLRTIYLRATSRPHVAWLASCVTIHLSEAIGLH +ID+ + ++++ 
Sbjct: 240 TFSRIPTVEQVSAWVLRTIYLRATSRPHVAWLASCVTIHLSEAIGLHHEIDREDIAISNN 299

Query: 300 VTLRRTAGFNEHTKRLFWCAWSINTILSYDYGRSSVALNRITCKPVEETEGSYTIHLVAL 359
           V  +RT   +EHT+RLFWCAWSINTILSYDYGRSSV LNRITCKPV+ET+G++T HLVAL
Sbjct: 300 VPPKRTTVVSEHTRRLFWCAWSINTILSYDYGRSSVTLNRITCKPVKETDGNFTAHLVAL 359

Query: 360 AQTIPQGTVNTDLTQLLNALTAIHKSPNAHPFLLLTKCDICLSLYRRLRLLNHVLDKSVV 419
           A  IPQ +VN +  QLL AL A+H+SPNAHPFL LTK DICLSLYRRLRLLNH+LDK+VV
Sbjct: 360 AHLIPQDSVNANAAQLLQALAAVHESPNAHPFLSLTKGDICLSLYRRLRLLNHILDKNVV 419

Query: 420 LQIIDIGNAALSAAYALVKLGQSWWNVLSTSFQYVCVLLAIDTPESLSHVAAAMKTLDNI 479
           LQIIDIGN ALSAAYALVKL Q+WWNVLSTSFQYVCVLLAIDTPESLSHVA AMKTLDNI
Sbjct: 420 LQIIDIGNTALSAAYALVKLDQAWWNVLSTSFQYVCVLLAIDTPESLSHVATAMKTLDNI 479

Query: 480 TEVLGTHIALEAQKTAKLLLEDSMKKKRQEIQQLEQATHDRSTFENTNSLDIDWDALFDP 539
           T++LGT IA EAQKTAKLLLEDSMKKKRQEIQQLEQATH RS  E T+ LDIDWDAL DP
Sbjct: 480 TQILGTRIAFEAQKTAKLLLEDSMKKKRQEIQQLEQATHQRSNLETTHLLDIDWDALLDP 539

Query: 540 SGTLGFM 546
           S TL FM
Sbjct: 540 SDTLNFM 546

>Kwal_23.6537 s23 complement(1632048..1633706) [1659 bp, 552 aa]
           {ON} YOR380W (RDR1) - Transcriptional repressor (zinc
           cluster protein) [contig 358] FULL
          Length = 552

 Score =  602 bits (1552), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/555 (54%), Positives = 388/555 (69%), Gaps = 19/555 (3%)

Query: 1   MASSVPNIPSYKRQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMDKDRSSSSSFP 60
           M ++  ++P  KR RVRKAC+PCR+RKRKC+   PC MC SYGY C Y D D       P
Sbjct: 1   MVATGADVPRNKRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDDVDG------P 54

Query: 61  VQKLDELPHAPESKPFAASNIHGNEVS--SVDTQTVTNQSITDPVKSRYTIQHSAVAFPR 118
           +   ++ P   +S   + S I   EV   S+ +   + + I DP KSRY   HSAVAFPR
Sbjct: 55  LSFYEKRPSPKQST--SPSTIQKKEVERPSMLSPCSSERGIFDPSKSRYMSLHSAVAFPR 112

Query: 119 CLGLELRSANPPRLHSFAWHCGIRPEENPSSHVLLSELITKEEYYRVSKVYFSVVHPIFD 178
            LGLEL+S NPP LHSFAW+CGIRPEEN +SH  L+ +I+K++  R + VYF VVHP+FD
Sbjct: 113 YLGLELQSVNPPHLHSFAWNCGIRPEENSTSHPDLANIISKDDCNRFTDVYFEVVHPMFD 172

Query: 179 VVDPKQLAKNVEEYWAG--NISNFEYGAVIAGVVALGSFFLGSIGHPREMDVVQYAKGIL 236
           ++DP Q  ++++ YW G  N+S F+  AVI GVVALGSFF  + GH RE+D+VQYAK IL
Sbjct: 173 IIDPSQFRQSLDSYWGGARNVSAFD--AVIGGVVALGSFFSRNFGHARELDIVQYAKDIL 230

Query: 237 DDPTFSRIPTVEHVSAWVLRTIYLRATSRPHVAWLASCVTIHLSEAIGLHQDIDKGEFSM 296
           +DPTFS  P++E +SAWVLR+IYLRAT+RPHVAWLASC+T+HL EA  LH ++DK E + 
Sbjct: 231 EDPTFSSQPSIEQISAWVLRSIYLRATARPHVAWLASCMTMHLVEATALHHEVDKVELAT 290

Query: 297 TSGVTL-RRTAGFNEHTKRLFWCAWSINTILSYDYGRSSVALNRITCKPVEETEGSYTIH 355
            +   L  R     E  +RLFWCAW INTI+SY+YGRS V LN+I+CK ++E+  +YT  
Sbjct: 291 RNDAPLPPRANSVCERARRLFWCAWCINTIISYEYGRSCVTLNKISCKLLKESTKNYTAE 350

Query: 356 LVALAQTIPQGTVNTD----LTQLLNALTAIHKSPNAHPFLLLTKCDICLSLYRRLRLLN 411
           +V LA+ IP  +  +D    +  L+ A+  ++K+ + HPFL LTK D+C S YRRLRLLN
Sbjct: 351 MVELARMIPTTSQCSDPASQVAALIEAIDRVYKAADVHPFLSLTKADLCHSFYRRLRLLN 410

Query: 412 HVLDKSVVLQIIDIGNAALSAAYALVKLGQSWWNVLSTSFQYVCVLLAIDTPESLSHVAA 471
           HVLD+SVVLQII+IG +ALSAA  LV+   +WWNVLST F Y CVLLAID+P+SLS+VAA
Sbjct: 411 HVLDRSVVLQIINIGTSALSAAEDLVRKNHTWWNVLSTVFHYFCVLLAIDSPDSLSNVAA 470

Query: 472 AMKTLDNITEVLGTHIALEAQKTAKLLLEDSMKKKRQEIQQLEQATHDRSTFENTNSLDI 531
           A    D+I ++L THIA EAQ TAKLLL DSMKKK++EI  LE A  +        S DI
Sbjct: 471 AKSIFDSIVKILDTHIAKEAQATAKLLLRDSMKKKKREIAHLEIADKEGPAPNTNYSPDI 530

Query: 532 DWDALFDPSGTLGFM 546
           DWDAL DPS +L  M
Sbjct: 531 DWDALLDPSNSLNLM 545

>KLTH0C10516g Chr3 (871091..872776) [1686 bp, 561 aa] {ON} similar
           to uniprot|P23172 Saccharomyces cerevisiae YOR380W RDR1
           Transcriptional repressor involved in the control of
           multidrug resistance negatively regulates expression of
           the PDR5 gene member of the Gal4p family of zinc cluster
           proteins
          Length = 561

 Score =  592 bits (1526), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/556 (51%), Positives = 373/556 (67%), Gaps = 12/556 (2%)

Query: 1   MASSVPNIPSYKRQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMDKDRSSSSSFP 60
           M++ +P++P  KRQR RKACVPCR+RKR+C+G +PC MC+SY Y CHY   ++   ++ P
Sbjct: 1   MSTGIPSVPHKKRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHY--DEQGDPATLP 58

Query: 61  VQKLDELPHA------PESKPFAASNIHGNEVSSVDTQTVTNQSITDPVKSRYTIQHSAV 114
              + E+P +      P ++  A       ++    TQ   +Q + D  KSRY    SAV
Sbjct: 59  APLIPEIPDSTRSISPPRTRMVAKPPSIRTKILLNSTQCAADQGVFDAAKSRYMGLSSAV 118

Query: 115 AFPRCLGLELRSANPPRLHSFAWHCGIRPEENPSSHVLLSELITKEEYYRVSKVYFSVVH 174
           AF R LG+EL+SANPP LHSFAW+CG+R EE  ++H  L +LITKEE +  +++YFS +H
Sbjct: 119 AFARSLGIELQSANPPHLHSFAWNCGLRSEEKSNTHCALHDLITKEETFHFTQIYFSAIH 178

Query: 175 PIFDVVDPKQLAKNVEEYWAGNISNFEYGAVIAGVVALGSFFLGSIGHPREMDVVQYAKG 234
           P+FDVVDP+   K+VE YW        +GAV+ G++ALGS F G  GHPRE+++VQYAK 
Sbjct: 179 PVFDVVDPEHFKKSVESYWNDGCKVSAFGAVVGGIIALGSLFSGRPGHPRELEIVQYAKN 238

Query: 235 ILDDPTFSRIPTVEHVSAWVLRTIYLRATSRPHVAWLASCVTIHLSEAIGLHQDIDKGEF 294
           +L+DPTFSR+P+ E VSAWVLRT+YLRAT+RPH AWLASCVTIHL+EA  LH +++  E 
Sbjct: 239 VLEDPTFSRLPSAEQVSAWVLRTLYLRATTRPHAAWLASCVTIHLAEASALHHEVENVEL 298

Query: 295 SMTSGVTLRRTAGFNEHTKRLFWCAWSINTILSYDYGRSSVALNRITCKPVEETEGSYTI 354
           +        RT    E  +RLFWCAWSIN+ILSYDYGRSS +L  I+CK   +++G+YT 
Sbjct: 299 TANDKALPPRTKKITERARRLFWCAWSINSILSYDYGRSSASLGGISCKLPTKSDGNYTA 358

Query: 355 HLVALAQTIP----QGTVNTDLTQLLNALTAIHKSPNAHPFLLLTKCDICLSLYRRLRLL 410
            LV LA  IP    + +  T +  LL ALT ++++P+ H FL L K D+C S YRRLRL 
Sbjct: 359 QLVDLALIIPPANTEASKETRVADLLQALTLVYETPDEHNFLSLVKADLCNSFYRRLRLF 418

Query: 411 NHVLDKSVVLQIIDIGNAALSAAYALVKLGQSWWNVLSTSFQYVCVLLAIDTPESLSHVA 470
           N+ LD  VV Q+  + N ALSAAY LV+    WWNVLS  FQY+CVLLAI+T ESL++VA
Sbjct: 419 NYTLDSEVVFQLTTVCNHALSAAYDLVERKLPWWNVLSAPFQYICVLLAINTSESLANVA 478

Query: 471 AAMKTLDNITEVLGTHIALEAQKTAKLLLEDSMKKKRQEIQQLEQATHDRSTFENTNSLD 530
            A    D I   L TH+A+EAQ T KLLL+DS+KKKRQE+  LE A    +  E   + +
Sbjct: 479 KAKNIFDRIVSNLNTHMAIEAQNTIKLLLQDSIKKKRQELTDLEAADQAGTASEAPFTAE 538

Query: 531 IDWDALFDPSGTLGFM 546
           IDWD L DPS  L  M
Sbjct: 539 IDWDVLLDPSHALHLM 554

>Smik_5.9 Chr5 complement(10186..10212,10216..10227,10231..10359)
          [168 bp, 56 aa] {OFF} YOR380W (HSP)
          Length = 56

 Score = 53.5 bits (127), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 30/50 (60%)

Query: 14 QRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMDKDRSSSSSFPVQK 63
          +RV+  CV  RERK+  N +  CEMC  +GYVC+Y+D   SS     V K
Sbjct: 1  ERVQNICVQIRERKKTYNDRFSCEMCFGHGYVCNYIDSYESSVPGVQVAK 50

>KAFR0F01490 Chr6 complement(290988..292964) [1977 bp, 658 aa] {ON}
           Anc_1.128 YJL206C
          Length = 658

 Score = 59.7 bits (143), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 70/335 (20%), Positives = 136/335 (40%), Gaps = 61/335 (18%)

Query: 13  RQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMDKDRSSSSSFPVQKLDELPHAPE 72
           R RV KAC+ CR++KR+C+GKSPC  C     +C Y +  R                 P 
Sbjct: 25  RLRVFKACIACRKKKRRCDGKSPCSHCARTSIICEYTNTAR-----------------PR 67

Query: 73  SKPFAASNIHGNEVSSVDTQTVTN------QSITDPVKSRYTIQHSAVAFPRCLGLE--- 123
           S   A +N   N++  +D+ T +           +P K+     +S  +      L    
Sbjct: 68  SHSIAFANDVSNDIHLIDSTTSSRSHSPKLSDKVNPYKTLIERLYSGASLESLQNLSREQ 127

Query: 124 -LRSANPPRLHSFAWHCGIRPEENPSSHVLL---SELITKEEYYRVSKVYFSVVHPIFDV 179
            +++ N   ++       + P +     +L    S  +    Y+R S V   ++  ++++
Sbjct: 128 LIKTLNSEEVNKNDT-ISLPPRDIALKLILKTWSSACVLFRFYHRPSLV--KILDSLYEL 184

Query: 180 -VDPKQLAKNVEEYWAGNISNFEYGAVIAGVVALGSFFLG--SIGHPREMDVVQYAKGIL 236
             +PK + +   E            ++I  V+A+G  F    +  + R ++    AK ++
Sbjct: 185 GTNPKTIKQRKAE------------SLIFAVLAVGELFSQEENNSYSRGLNYFNKAKTLI 232

Query: 237 DDPTFSRIPTVEHVSAWVLRTIYLRATSRPHVAWLASCVTIHLSEAIGLHQDIDKGEFSM 296
           D   F  I  +  + A  + TI+L+ +      +    + + ++    LH+     + S+
Sbjct: 233 D---FKDINDIHSIQAIFMMTIFLQCSGDLKACYYYIGIALRIAIRENLHR-----KPSL 284

Query: 297 TSGVTLRRTAGFNEHTKRLFWCAWSINTILSYDYG 331
           T       TA  +E  KRLFW  + ++  ++   G
Sbjct: 285 TGP-----TAIEDETKKRLFWSIYKVDIYMNCTLG 314

>KLTH0D07898g Chr4 (672516..674534) [2019 bp, 672 aa] {ON} weakly
           similar to uniprot|P50104 Saccharomyces cerevisiae
           YMR019W STB4 Protein that binds Sin3p in a two- hybrid
           assay
          Length = 672

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 83/378 (21%), Positives = 134/378 (35%), Gaps = 81/378 (21%)

Query: 13  RQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMDK--DRSSSSSF------PVQKL 64
           R RVRKAC  C+ RK KCNG+ PC  C  +G VCHY  +   R +S++       P   L
Sbjct: 25  RIRVRKACGTCKRRKVKCNGQQPCAGCAKHGSVCHYKVEPVTRPASAALKAGAPGPAGTL 84

Query: 65  DELPHAPESKPFAASNIHGNEVSSVDTQTVTNQSITDPVKSRYTIQHSAVAFPRCLGLEL 124
             L   P    FA      +                 P K R+  +H  +  P  LG  L
Sbjct: 85  PALSQVPAPSDFATGPAPASPWQRF-----------SPGKYRFHRRHQNLV-PYYLGQAL 132

Query: 125 RSANP-----------PRLHSFAWHC--GIRPEEN-----PSSHVLLSELITKEE----- 161
            S+ P           PRL  + W+   G   ++      P   V   +L  + +     
Sbjct: 133 ISSLPPALVQKYALRAPRLQFYGWNMSGGHYLKQGSTFGAPQGTVWRWDLAVELQRQILE 192

Query: 162 -----YYRVSKVYFSVVHP----------IFDVVDPKQLAKNVEEYWAGNIS----NFEY 202
                +++    + S+VH             D  D K  + ++ E     I+     F Y
Sbjct: 193 KCASFFFQHVNRFVSIVHEQAFWQQFRGGFLDGSDGKNGSSDLFEAILNLIAAIALRFSY 252

Query: 203 G--------AVIAGVVALGSFFLGSIGHPREMDVVQYAKGILDDPTFSRIPTVEHVSAWV 254
                    A+ A  V      L   G   E  + + A  +    +F    + E + AW+
Sbjct: 253 SGAGASVCEALTAAEVTWLDLHLTRHGRHLEETLFERAYAVTTRLSFE-WESFELIQAWL 311

Query: 255 LRTIYLRATSRPHVAWLASCVTIHLSEAIGLHQDIDKGEFSMTSGVTLRRTAGFNEHTKR 314
           L  +YLR   R    W A    + +   + L+           +    + TA      + 
Sbjct: 312 LAAVYLRTCHRQVSCWQALSRAVQMCNGMSLY----------LNRFPEKHTAYDECRARN 361

Query: 315 LFWCAWSINTILSYDYGR 332
            +W  + ++ ++S+  GR
Sbjct: 362 CYWACFVLDRLISFQMGR 379

>Skud_10.10 Chr10 complement(21672..24173) [2502 bp, 833 aa] {ON}
           YJL206C (REAL)
          Length = 833

 Score = 58.2 bits (139), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 84/349 (24%), Positives = 145/349 (41%), Gaps = 53/349 (15%)

Query: 13  RQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMDKDRSSSSSFPVQKLDELPHAPE 72
           R R  +ACV CR+RK +C+G++PC +C +  + C Y D+   +SS+F  +  D+ P   +
Sbjct: 27  RGRAHRACVACRKRKVRCSGQTPCRLCQNNSFECKY-DRPPRNSSAFDKELSDDSPLYSQ 85

Query: 73  SKPFAASNIHGNEVSSVDTQTVT---------NQSITDPVKSRYTIQHSAVAFPRCLGLE 123
                  N +    S +D + +T         NQ  T P         +   + +   L+
Sbjct: 86  RASHQDHNDNKGRQSVIDYKKITETIFTPEALNQIFTSPSFDNQLFLDTIKRYLQQGQLD 145

Query: 124 LRSANPPRL-HSFAWHCGIRPEENPSSHVLLSELITKEEYYRVSKVYFSVVH--PIFDVV 180
           + +     L  + +WH        P    L  + I K   +  + V F   H   I  ++
Sbjct: 146 VNNVIRQSLPKNASWHLKTSVPLPPRGIAL--KFIQKT--WDCACVLFRFYHRPTIISIL 201

Query: 181 DPKQLAKNV-EEYWAGNISNFEYGAVIAGVVALGSFF-----LGSIGHPREM---DVVQY 231
           D    A+ + +EY A  +       +I  V+A+G+ F            RE    +  +Y
Sbjct: 202 DSIYEAEKLGKEYTAEQVKT---QPLIYSVLAVGALFSKEDLSKDSNATREFYTDEGYRY 258

Query: 232 ---AKGILDDPTFSRIPTVEHVSAWVLRTIYLRATSRPHVAWLASCVTIHLSEAI--GLH 286
              AK  LD   FS I  +  + A  + TI+L+ ++     +  S + I L  A+  GLH
Sbjct: 259 FLEAKKSLD---FSNITEIYSIQAIFMMTIFLQCSANLKACY--SFIGIALRAALKEGLH 313

Query: 287 QDIDKGEFSMTSGVTLRRTAGFNEHTKRLFWCAWSI----NTILSYDYG 331
           +     + S+     ++     +E  KRLFW  + +    N IL +  G
Sbjct: 314 R-----KSSIVGPTPIQ-----DETKKRLFWSVYKLDLYMNCILGFPSG 352

>SAKL0D13464g Chr4 (1116277..1118340) [2064 bp, 687 aa] {ON} weakly
           similar to uniprot|P50104 Saccharomyces cerevisiae
           YMR019W STB4 Protein that binds Sin3p in a two- hybrid
           assay
          Length = 687

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 79/380 (20%), Positives = 139/380 (36%), Gaps = 74/380 (19%)

Query: 10  SYKRQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMDKDRSS--SSSFPVQKLDEL 67
           S +R RVRKAC  C++RK KC+G  PC  C      C Y   D +S  S   P + LD+ 
Sbjct: 18  SKQRLRVRKACEICKKRKIKCDGHQPCTSCTKNSVQCVYKFTDTASPISKPKPGRSLDK- 76

Query: 68  PHAPESKPFAASNIHGNEVSSVDTQTVT------------NQSITDPV------KSRYTI 109
               ES   A   +  + ++ +D++               + S+  P       K R+  
Sbjct: 77  ----ESIANALLQLESSLLAKIDSKPTPTPTPTPPNLVHFSSSLPSPWQTFSLDKYRFHR 132

Query: 110 QHSAVAFPRCLGLELRSANP-----------PRLHSFAWH-CGIRPEENPSSHVL----L 153
           ++  +  P  LG  L  + P           PR+ ++ W+  G    +N S   L     
Sbjct: 133 RYQNL-LPYYLGQSLMQSLPPQTIQHHNLKTPRVQNYGWNMSGGHYLKNGSDSSLDIINF 191

Query: 154 SELITKEEYYRVSKVYFSVVHPIFDVVDPKQLAKNVEEYWAGNISN-------------- 199
            + +  +   ++ + YF  ++P+F +V  +   +     +     N              
Sbjct: 192 DDPVQLDIVNKLLRFYFDHLNPVFSIVHEQVFLQQFNTGFLNKRRNSSKLFISMLYLILA 251

Query: 200 ----FEYGAVIAGVVALGSF---FLGSIGHPREMDVVQYAKGILDDPTFSRIPTVEHVSA 252
               F  G   +  VA       +L       E  +  +A  I+   +F    + E + +
Sbjct: 252 TSLRFYEGYSQSQPVAFSQHQLDWLFKTNSSLEERLFHFAHEIVSRLSF-EWESFELIQS 310

Query: 253 WVLRTIYLRATSRPHVAWLASCVTIHLSEAIGLHQDIDKGEFSMTSGVTLRRTAGFNEHT 312
           W+L   YLR   R    W A    I + + + L+           +    R T       
Sbjct: 311 WLLIAFYLRTCHRQTSCWNALGSAIRMCKGMALY----------LNRFPQRHTLYEETKV 360

Query: 313 KRLFWCAWSINTILSYDYGR 332
           K  FW  + ++ ++S+  GR
Sbjct: 361 KNCFWSCFIMDKVISFQMGR 380

>TDEL0C04480 Chr3 (799022..801580) [2559 bp, 852 aa] {ON}
          Anc_2.231 YIL130W possible pseudogene; NNN added to
          avoid internal stop codon
          Length = 852

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 42/85 (49%), Gaps = 4/85 (4%)

Query: 1  MASSVPNIPSYKRQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMDKDR----SSS 56
          M      I   KR+RV +AC  CR++K KC+G+ PC  C  Y Y C Y    +    S+S
Sbjct: 1  MGDQQQQILQNKRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTYNQPTKRSNTSAS 60

Query: 57 SSFPVQKLDELPHAPESKPFAASNI 81
          +  P     + PH P +   ++ NI
Sbjct: 61 TQSPQSANQQRPHGPSNGSGSSLNI 85

>Smik_2.115 Chr2 (210321..213236) [2916 bp, 971 aa] {ON} YBL005W
          (REAL)
          Length = 971

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 42/78 (53%), Gaps = 8/78 (10%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMDKDRSSSSSFPVQKLDELPHAPE 72
          R +V  ACV CR+RK KC GK PC  CISY   C ++ K+ +       +K   LP A  
Sbjct: 8  RSKVPTACVNCRKRKIKCTGKYPCTNCISYDCTCVFLKKNLTQ------EKDTSLPLATT 61

Query: 73 SKPFAASNIHGNEVSSVD 90
          + P ++S  H NE  S D
Sbjct: 62 TVPRSSS--HHNEKVSAD 77

>KNAG0I00560 Chr9 complement(93785..95776) [1992 bp, 663 aa] {ON}
          Anc_1.128 YJL206C
          Length = 663

 Score = 54.3 bits (129), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 31/56 (55%)

Query: 2  ASSVPNIPSYKRQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMDKDRSSSS 57
          A+SV      K QRVR AC  CR +KRKC+G+ PC  C    Y C Y +    S++
Sbjct: 17 ANSVTRQLQLKEQRVRTACSMCRRKKRKCDGRVPCSFCTKNHYQCIYKNASHGSTT 72

>TPHA0F01380 Chr6 complement(318207..320879) [2673 bp, 890 aa] {ON}
           Anc_2.231 YIL130W
          Length = 890

 Score = 54.3 bits (129), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 21/46 (45%), Positives = 31/46 (67%)

Query: 3   SSVPNIPSYKRQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHY 48
           S+V ++   KR+RV +AC  CR++K KC+G++PC  C  Y Y C Y
Sbjct: 55  SNVASVTQKKRRRVTRACDECRKKKVKCDGQNPCIHCTVYSYKCSY 100

>CAGL0A00451g Chr1 (47557..50880) [3324 bp, 1107 aa] {ON} similar
          to uniprot|P12383 Saccharomyces cerevisiae YGL013c PDR1
          transcription factor
          Length = 1107

 Score = 54.3 bits (129), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 23/42 (54%), Positives = 25/42 (59%)

Query: 9  PSYKRQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMD 50
          PS +R +V KAC  CR RK KCNG  PC  C  YG  C Y D
Sbjct: 20 PSTRRTKVGKACDSCRRRKIKCNGLKPCPSCTIYGCECTYTD 61

>YBL005W Chr2 (217470..220400) [2931 bp, 976 aa] {ON}
          PDR3Transcriptional activator of the pleiotropic drug
          resistance network, regulates expression of ATP-binding
          cassette (ABC) transporters through binding to
          cis-acting sites known as PDREs (PDR responsive
          elements); post-translationally up-regulated in cells
          lacking a functional mitochondrial genome
          Length = 976

 Score = 54.3 bits (129), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 39/84 (46%), Gaps = 16/84 (19%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMDK----DRSSSSSFPVQKLDELP 68
          R +V  ACV CR+RK KC GK PC  CISY   C ++ K       SS S P   +    
Sbjct: 8  RSKVSTACVNCRKRKIKCTGKYPCTNCISYDCTCVFLKKHLPQKEDSSQSLPTTAV---- 63

Query: 69 HAPESKPFAASNIHGNEVSSVDTQ 92
           AP S        H N  +S D Q
Sbjct: 64 -APPSS-------HANVEASADVQ 79

>Kpol_1039.11 s1039 (29727..32705) [2979 bp, 992 aa] {ON}
          (29727..32705) [2979 nt, 993 aa]
          Length = 992

 Score = 53.9 bits (128), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 30/48 (62%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMDKDRSSSSSF 59
          KR+RV +AC  CR++K KC+G+ PC  C  Y Y C Y    + S+S+ 
Sbjct: 28 KRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYNCTYNQPSKRSNSNL 75

>SAKL0E08998g Chr5 complement(747085..749556) [2472 bp, 823 aa]
          {ON} similar to uniprot|P40467 Saccharomyces cerevisiae
          YIL130W ASG1 Proposed transcriptional activator member
          of the Gal4p family of zinc cluster proteins
          Length = 823

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 29/52 (55%)

Query: 9  PSYKRQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMDKDRSSSSSFP 60
          P  KR+RV +AC  CR++K KC+G+ PC  C  Y Y C Y    +   S  P
Sbjct: 4  PQSKRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTYNQPTKRGGSCAP 55

>KNAG0C05980 Chr3 complement(1164771..1167677) [2907 bp, 968 aa]
          {ON} 
          Length = 968

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 21/43 (48%), Positives = 28/43 (65%)

Query: 9  PSYKRQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMDK 51
          P+++R++   AC  CR RK KC GK PC  C +Y  VC Y+DK
Sbjct: 17 PAHRRRKTVLACTNCRRRKIKCTGKWPCSNCEAYSCVCEYVDK 59

>TBLA0G02610 Chr7 complement(689843..692845) [3003 bp, 1000 aa] {ON}
           Anc_2.231 YIL130W
          Length = 1000

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 34/56 (60%), Gaps = 3/56 (5%)

Query: 12  KRQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMD---KDRSSSSSFPVQKL 64
           KR+RV +AC  CR++K KC+G+ PC  C  Y Y C Y     +  +S+SS P+  +
Sbjct: 58  KRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTYNQPSTRRNNSNSSTPISTM 113

>Smik_10.25 Chr10 complement(45977..48295) [2319 bp, 772 aa] {ON}
           YJL206C (REAL)
          Length = 772

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 38/63 (60%), Gaps = 1/63 (1%)

Query: 13  RQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMDKDRSSSSSFPVQKLDELPHAPE 72
           R R  +ACV CR+RK +C+G++PC +C +  + C Y D+   +SS F  +  D+    P+
Sbjct: 51  RGRAHRACVACRKRKVRCSGQTPCRLCQNNSFECKY-DRPPRNSSVFDREVSDDSSSYPQ 109

Query: 73  SKP 75
           S P
Sbjct: 110 SIP 112

>KAFR0J01710 Chr10 complement(327570..330116) [2547 bp, 848 aa]
          {ON} Anc_2.231 YIL130W
          Length = 848

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 21/47 (44%), Positives = 30/47 (63%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMDKDRSSSSS 58
          KR+RV +AC  CR++K KC+G+ PC  C  Y Y C Y    + ++SS
Sbjct: 10 KRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTYNQPSKRTNSS 56

>Skud_2.106 Chr2 (200722..203754) [3033 bp, 1010 aa] {ON} YBL005W
           (REAL)
          Length = 1010

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 47/99 (47%), Gaps = 10/99 (10%)

Query: 13  RQRVRKACVPCRERKRKCNGKSPCEMCISYGYVC----HYMDKDRSSSSSFPVQKLDELP 68
           R +V  ACV CR+RK KC GK PC  CISY   C     Y+ + + +   FP        
Sbjct: 49  RSKVSTACVNCRKRKIKCTGKHPCTNCISYDCTCVFLKRYLPQGKDAPQPFPAATAPSSS 108

Query: 69  HAPESKPFAASNIHG-NEVSSVDTQ---TVTNQSITDPV 103
             P+     ++++H  N V  +D Q    + N+ I  PV
Sbjct: 109 SHPDVD--LSTDMHQLNTVIKLDNQDYFKLMNEPIQTPV 145

>KLLA0F04609g Chr6 complement(451579..454329) [2751 bp, 916 aa]
          {ON} similar to uniprot|P40467 Saccharomyces cerevisiae
          YIL130W ASG1 Proposed transcriptional activator member
          of the Gal4p family of zinc cluster proteins
          Length = 916

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 26/42 (61%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMDKDR 53
          KR+RV +AC  CR++K KC+GK PC  C  Y Y C Y    R
Sbjct: 6  KRRRVTRACDECRKKKVKCDGKQPCIHCTVYNYECTYNQPTR 47

>YIL130W Chr9 (102782..105676) [2895 bp, 964 aa] {ON}  ASG1Zinc
          cluster protein proposed to function as a
          transcriptional regulator involved in the stress
          response; null mutants have a respiratory deficiency,
          calcofluor white sensitivity and slightly increased
          cycloheximide resistance
          Length = 964

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 30/49 (61%)

Query: 10 SYKRQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMDKDRSSSSS 58
          S KR+RV +AC  CR++K KC+G+ PC  C  Y Y C Y    + + +S
Sbjct: 11 SVKRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTYKKPTKRTQNS 59

>Suva_9.59 Chr9 (97521..100298) [2778 bp, 926 aa] {ON} YIL130W
          (REAL)
          Length = 926

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 30/49 (61%)

Query: 10 SYKRQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMDKDRSSSSS 58
          S KR+RV +AC  CR++K KC+G+ PC  C  Y Y C Y    + + +S
Sbjct: 11 SVKRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTYKKPTKRTQNS 59

>Smik_9.39 Chr9 (80510..83548) [3039 bp, 1012 aa] {ON} YIL130W
          (REAL)
          Length = 1012

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 30/49 (61%)

Query: 10 SYKRQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMDKDRSSSSS 58
          S KR+RV +AC  CR++K KC+G+ PC  C  Y Y C Y    + + +S
Sbjct: 11 SVKRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTYKKPTKRTQNS 59

>NCAS0A01630 Chr1 complement(317259..320390) [3132 bp, 1043 aa] {ON}
           Anc_4.113
          Length = 1043

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 34/61 (55%), Gaps = 2/61 (3%)

Query: 15  RVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMDKDRSSSSSFPVQKLD--ELPHAPE 72
           +V KAC  CR+RK KC GK PC  C +Y   C Y  + R +S      K++  E+P+ P 
Sbjct: 43  KVSKACDNCRKRKIKCTGKQPCATCEAYQCPCIYSTQKRKTSKRNNTAKMEQPEIPNGPN 102

Query: 73  S 73
           S
Sbjct: 103 S 103

>Skud_9.37 Chr9 (79947..82811) [2865 bp, 954 aa] {ON} YIL130W
          (REAL)
          Length = 954

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 26/39 (66%)

Query: 10 SYKRQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHY 48
          S KR+RV +AC  CR++K KC+G+ PC  C  Y Y C Y
Sbjct: 11 SVKRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTY 49

>Suva_2.121 Chr2 (211466..214381) [2916 bp, 971 aa] {ON} YBL005W
          (REAL)
          Length = 971

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 25/39 (64%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMDK 51
          R +V  AC+ CR+RK KC GK PC  CISY   C ++ K
Sbjct: 8  RSKVSTACINCRKRKIKCTGKHPCTNCISYNCTCVFLRK 46

>CAGL0G08844g Chr7 complement(846590..849133) [2544 bp, 847 aa]
          {ON} similar to uniprot|P40467 Saccharomyces cerevisiae
          YIL130w
          Length = 847

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 29/48 (60%)

Query: 1  MASSVPNIPSYKRQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHY 48
          M  +VP+    KR++V +AC  CR++K KC+G  PC  C  Y Y C Y
Sbjct: 1  MNLTVPHRQEGKRRKVTRACDDCRKKKVKCDGNQPCIHCTVYSYECTY 48

>NCAS0B06550 Chr2 complement(1242371..1245091) [2721 bp, 906 aa]
          {ON} Anc_2.231
          Length = 906

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 25/37 (67%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHY 48
          KR+RV +AC  CR++K KC+G+ PC  C  Y Y C Y
Sbjct: 29 KRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTY 65

>NDAI0B03850 Chr2 complement(970366..973158) [2793 bp, 930 aa]
          {ON} Anc_2.231 YIL130W
          Length = 930

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 25/37 (67%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHY 48
          KR+RV +AC  CR++K KC+G+ PC  C  Y Y C Y
Sbjct: 31 KRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTY 67

>Kwal_23.4754 s23 (845550..847988) [2439 bp, 812 aa] {ON} YIL130W
          (GIN1) - 1:1 [contig 5] FULL
          Length = 812

 Score = 50.8 bits (120), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 25/37 (67%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHY 48
          KR+RV +AC  CR++K KC+G+ PC  C  Y Y C Y
Sbjct: 7  KRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTY 43

>KLTH0G09108g Chr7 (744062..746410) [2349 bp, 782 aa] {ON} weakly
          similar to uniprot|P40467 Saccharomyces cerevisiae
          YIL130W ASG1 Proposed transcriptional activator member
          of the Gal4p family of zinc cluster proteins
          Length = 782

 Score = 50.8 bits (120), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 25/37 (67%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHY 48
          KR+RV +AC  CR++K KC+G+ PC  C  Y Y C Y
Sbjct: 7  KRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTY 43

>KNAG0E01760 Chr5 (350254..352962) [2709 bp, 902 aa] {ON}
          Anc_2.231 YIL130W
          Length = 902

 Score = 50.8 bits (120), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 25/37 (67%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHY 48
          KR+RV +AC  CR++K KC+G+ PC  C  Y Y C Y
Sbjct: 29 KRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTY 65

>SAKL0C03938g Chr3 complement(377431..379773) [2343 bp, 780 aa]
          {ON} weakly similar to uniprot|P40467 Saccharomyces
          cerevisiae YIL130W ASG1 Proposed transcriptional
          activator member of the Gal4p family of zinc cluster
          proteins and to YJL206C uniprot|P39529 Saccharomyces
          cerevisiae YJL206C
          Length = 780

 Score = 50.8 bits (120), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 20/43 (46%), Positives = 26/43 (60%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMDKDRS 54
          KR RV +AC  CR+RK +C+G+ PC  C  Y Y C Y    R+
Sbjct: 24 KRLRVSRACDVCRQRKVRCDGRQPCIHCTVYSYNCTYNPTSRT 66

>ZYRO0E06270g Chr5 (475960..478698) [2739 bp, 912 aa] {ON} weakly
          similar to uniprot|P50104 Saccharomyces cerevisiae
          YMR019W STB4 Protein that binds Sin3p in a two- hybrid
          assay
          Length = 912

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 24/38 (63%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYM 49
           R RVRKAC  C+ RK KC+G  PC  C+ +G  C Y+
Sbjct: 9  NRLRVRKACEICKRRKVKCDGSQPCANCVKHGQECKYI 46

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 28/116 (24%), Positives = 48/116 (41%), Gaps = 25/116 (21%)

Query: 224 REMDVVQYAKGILDDPTFSRIPTVEHVSAWVLRTIYLRATSRPHVAWLASCVTIHLSEAI 283
           RE  + +YA  ++   TF    + E + +W+L T Y R   R    W A      L +AI
Sbjct: 342 REEAMFKYAYSVITQLTF-EWESFELIQSWLLITFYFRTCYRQTACWNA------LGQAI 394

Query: 284 GLHQDIDKGEFSMTSGVTLRRTAGFNEHTK-------RLFWCAWSINTILSYDYGR 332
                      +M +G++L        H+K         FW  + ++ ++S+  GR
Sbjct: 395 -----------NMCNGMSLYLNRFPRTHSKYDESRAWHCFWACFIMDKLISFQMGR 439

>ZYRO0D06688g Chr4 (577455..577507,577577..579311) [1788 bp, 595
          aa] {ON} similar to uniprot|P43634 Saccharomyces
          cerevisiae YLR098C CHA4 Zinc-finger protein with
          Zn[2]-Cys[6] fungal- type binuclear cluster domain
          DNA-binding transcriptional activator or CHA1
          Length = 595

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 41/67 (61%), Gaps = 5/67 (7%)

Query: 2  ASSVPNIPSYKRQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMDKD--RSSSSSF 59
          + S P+ PS  R   + AC  CR+R+RKCN + PC  C+ YG  C  +D+D  R+  ++ 
Sbjct: 4  SGSSPDEPSNSR---KLACQNCRKRRRKCNSEIPCSNCVKYGIECVPVDQDLRRTRYTAS 60

Query: 60 PVQKLDE 66
           V++L++
Sbjct: 61 YVKELED 67

>KLLA0C03201g Chr3 complement(286973..288925) [1953 bp, 650 aa] {ON}
           similar to uniprot|P39529 Saccharomyces cerevisiae
           YJL206C and some similarities with YIL130W
           uniprot|P40467 Saccharomyces cerevisiae YIL130W ASG1
           Proposed transcriptional activator member of the Gal4p
           family of zinc cluster proteins
          Length = 650

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 84/346 (24%), Positives = 138/346 (39%), Gaps = 69/346 (19%)

Query: 13  RQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMDKDRSSSSSFPVQKLDELPHAPE 72
           R +V+ AC  C+ERK +C+G+SPC  CI+    C Y+   +      P++K  ++     
Sbjct: 29  RHKVKHACSSCKERKVRCDGQSPCASCINARVKCEYVMNMK------PLKKKRKV----- 77

Query: 73  SKPFAASNIHGNE-------VSSVDTQTVTNQSITDPVKSRYTIQHSAVAFPRCLGLELR 125
              F  SN+  NE       +SS + Q V  + +   +     +  S +     + +   
Sbjct: 78  --SFIRSNLSKNELKGGSSVISSQNAQGVDYKKVFHSLFPDVDLSQSNLCTESLISIVKS 135

Query: 126 SANPPRLHSFAWHCGIRPEENPSSHVLLSELITKEEYYRVSKVYFSVVH-PIFDVVDPKQ 184
           S   P+    +     R    P   + L+ LI+K   +  + + F   H P F       
Sbjct: 136 SNECPQTQVPSSR---RKLILPPKQIALT-LISKS--WDSACLLFRFYHRPTF------- 182

Query: 185 LAKNVEEYWAGNISNFEYGA-------VIAGVVALGSFFLGSIG----HPREMDVVQ--- 230
             K VE  +   + NFEY         ++  V+A+G+ F  S      H + M+  Q   
Sbjct: 183 -IKVVESLYT--VKNFEYSEKQKRFLPLVYSVIAVGALFCKSYAETTDHKQMMEFFQDEG 239

Query: 231 -----YAKGILDDPTFSRIPTVEHVSAWVLRTIYLRATSRPHVAWLASCVTIHLSEAIGL 285
                 AK +L DP  S+   VE + A  + TI+L+ +     A L+S  T      I L
Sbjct: 240 HKYFIEAKCLL-DPINSQ--DVESLQAIFMLTIFLQCS-----ANLSSGYTYI---GIAL 288

Query: 286 HQDIDKGEFSMTSGVTLRRTAGFNEHTKRLFWCAWSINTILSYDYG 331
              I +     TS   L       E  K+LFW  +  +  ++   G
Sbjct: 289 RTAIKQNFHRKTSLQNLNLLE--QETIKKLFWTIYKTDIYMNCILG 332

>TPHA0F00830 Chr6 complement(188299..191877) [3579 bp, 1192 aa]
          {ON} Anc_4.113 YGL013C
          Length = 1192

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 28/51 (54%)

Query: 7  NIPSYKRQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMDKDRSSSS 57
          N    +R +V KAC  CR RK KCNG +PC  C +Y   C Y   D +S +
Sbjct: 15 NTAKKQRNKVSKACQSCRRRKIKCNGINPCSNCTTYECECIYSIPDSNSQT 65

>KLTH0E08140g Chr5 (747649..749547) [1899 bp, 632 aa] {ON} conserved
           hypothetical protein
          Length = 632

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 46/195 (23%), Positives = 79/195 (40%), Gaps = 39/195 (20%)

Query: 12  KRQRVRKACVPCRERKRKCNGKSPCEMCISYG---YVCHYMDKDR------SSSSSFPV- 61
           KR+R  K+C  C E K KCN +SPC  C   G   +  +   KD       SS+ +F   
Sbjct: 5   KRRRSIKSCKYCYEHKLKCNKQSPCNNCARLGITNFCVYGFKKDEVDAKPLSSTETFKPK 64

Query: 62  -QKLDELPHAPESKPFAASNIHGNEVSSVDTQTVTNQSITDPVKSRYTIQHSAVAFPRCL 120
            Q L      P++KP+       N    +  +   +++ TD    R  + +      +C+
Sbjct: 65  DQVLKTSSTHPKTKPYYPYLSGANAEEVLSNRHQAHKNPTDACMKRNEVTNFNKFDVKCM 124

Query: 121 GLE-LRSANPPRLHSFAWHCGIRPEENPSSHVLLSELITKEEYYRVSKVYFSVVHPIFDV 179
            +E + S  PP                           ++   + V  VYF  +HPI  V
Sbjct: 125 SVEEVASLIPP---------------------------SQASTFLVVDVYFHKIHPIIPV 157

Query: 180 VDPKQLAKNVEEYWA 194
           +D +++ + +EE ++
Sbjct: 158 LDREEVFRQIEEVYS 172

>KAFR0C03730 Chr3 (759382..761757) [2376 bp, 791 aa] {ON} 
          Length = 791

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 29/50 (58%), Gaps = 3/50 (6%)

Query: 2  ASSVPNIPSYKRQ---RVRKACVPCRERKRKCNGKSPCEMCISYGYVCHY 48
           SS+    +Y ++   RV +AC  CR+RK KCNG  PC  CI+    CHY
Sbjct: 3  GSSITKPYTYNKRSSHRVSRACNSCRKRKVKCNGVQPCSKCITSNLRCHY 52

>TBLA0A00730 Chr1 (156043..159156) [3114 bp, 1037 aa] {ON}
          Anc_2.654 YKL015W
          Length = 1037

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 28/42 (66%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMDKDR 53
          K++++ +AC+ CRER  KC G  PC+ C+   ++C + + ++
Sbjct: 51 KKRKITRACIRCRERHIKCPGNDPCQKCLEANHICKFSEPNK 92

>SAKL0B06732g Chr2 complement(578508..581144) [2637 bp, 878 aa]
          {ON} some similarities with uniprot|Q12180
          Saccharomyces cerevisiae YOL089C HAL9 Putative
          transcription factor containing a zinc finger
          overexpression increases salt tolerance through
          increased expression of the ENA1 (Na /Li extrusion
          pump) gene while gene disruption decreases both salt
          tolerance and ENA1 expression
          Length = 878

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 33/57 (57%), Gaps = 3/57 (5%)

Query: 11 YKRQRVRKACVPCRERKRKCNGKSPCEMCISYGYVC---HYMDKDRSSSSSFPVQKL 64
          + R+RV KAC  CR +K KCNG+  C  C+ YG  C   H + K + +S+    +KL
Sbjct: 7  HSRRRVSKACDSCRSKKIKCNGEQTCSNCLKYGCPCTYTHTIKKRKPASTRVSNRKL 63

>KAFR0B02820 Chr2 complement(576317..578311) [1995 bp, 664 aa]
          {ON} Anc_8.283 YLR098C
          Length = 664

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 25/36 (69%)

Query: 17 RKACVPCRERKRKCNGKSPCEMCISYGYVCHYMDKD 52
          R AC+ CR+R+RKC+ + PC +CI +G  C +  +D
Sbjct: 16 RLACITCRQRRRKCDMQEPCSICIKFGTRCVFTGED 51

>YKL015W Chr11 (408544..411483) [2940 bp, 979 aa] {ON}
          PUT3Transcriptional activator of proline utilization
          genes, constitutively binds PUT1 and PUT2 promoter
          sequences as a dimer and undergoes a conformational
          change to form the active state; differentially
          phosphorylated in the presence of different nitrogen
          sources; has a Zn(2)-Cys(6) binuclear cluster domain
          Length = 979

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 27/42 (64%)

Query: 9  PSYKRQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMD 50
          P  ++QR   AC+ CR+R  KC G +PC+ C++   +C Y++
Sbjct: 23 PQKRQQRSSVACLSCRKRHIKCPGGNPCQKCVTSNAICEYLE 64

>CAGL0B03421g Chr2 complement(336071..340138) [4068 bp, 1355 aa]
          {ON} similar to uniprot|P12351 Saccharomyces cerevisiae
          YLR256w HAP1 transcription factor
          Length = 1355

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 37/67 (55%), Gaps = 3/67 (4%)

Query: 9  PSYKRQRVRKACVPCRERKRKCNGKSP-CEMCISYG--YVCHYMDKDRSSSSSFPVQKLD 65
          P  KR R+  +C  CR+RK KC+   P C  C   G  ++CHYM+++ +  +   + K +
Sbjct: 12 PKKKRNRIPLSCTICRKRKVKCDKTRPHCNQCTKTGVAHLCHYMEQNWAQDAKKEISKDN 71

Query: 66 ELPHAPE 72
          EL +  E
Sbjct: 72 ELKNLKE 78

>SAKL0B04620g Chr2 complement(406622..407710) [1089 bp, 362 aa]
          {ON} conserved hypothetical protein
          Length = 362

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 25/36 (69%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHY 48
          ++RV KAC  CR+ K KC+G+ PC+ C+S   +C Y
Sbjct: 4  KKRVSKACDTCRKSKTKCDGERPCQRCLSENKICTY 39

>KAFR0F03410 Chr6 complement(677156..680143) [2988 bp, 995 aa]
          {ON} Anc_4.113 YGL013C
          Length = 995

 Score = 48.1 bits (113), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 19/36 (52%), Positives = 23/36 (63%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHY 48
          R +VR+AC  CR+RK KC GK PC  C +Y   C Y
Sbjct: 16 RIKVRQACDNCRKRKLKCTGKQPCSTCEAYSCDCIY 51

>YJL206C Chr10 complement(47659..49935) [2277 bp, 758 aa] {ON}
           Putative protein of unknown function; similar to
           transcriptional regulators from the Zn[2]-Cys[6]
           binuclear cluster protein family; mRNA is weakly cell
           cycle regulated, peaking in S phase; induced rapidly
           upon MMS treatment
          Length = 758

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 83/355 (23%), Positives = 138/355 (38%), Gaps = 66/355 (18%)

Query: 13  RQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMDKDRSSSSSFPVQKLDELPHAPE 72
           + R  +AC+ CR+RK +C+G  PC +C +  Y C Y D+   +SS F  +  D      +
Sbjct: 40  KGRAHRACIACRKRKVRCSGNIPCRLCQTNSYECKY-DRPPRNSSVFDREVSD------D 92

Query: 73  SKPFAASNIHGNE-----VSSVDTQTVTNQSITDP-------VKSRYTIQHSAVAFPRCL 120
           S  +A    H  E     +SS+D + V  ++I  P         S +  Q+       CL
Sbjct: 93  SSLYAQRASHEREDSKGPISSIDYKKVV-ETIFPPETLRQILASSSFNSQNFLDTIKTCL 151

Query: 121 GLELRSANPPRLHSF----AWHCGIRPEENPSSHVLLSELITKEEYYRVSKVYFSVVH-- 174
                + N     S      WH        P    L  + I K   +  + V F   H  
Sbjct: 152 LQGQLNVNQVIRQSLPKDTPWHMQTSVPLPPREIAL--KFIQKT--WDCACVLFRFYHRP 207

Query: 175 PIFDVVDP-KQLAKNVEEYWAGNISNFEYGAVIAGVVALGSFFLGSIGHPREMDVVQY-- 231
            I  ++D   +  K+ ++Y    +       +I  V+A+G+ F             ++  
Sbjct: 208 TIISILDSIYEAEKHGKQYTPEQVKT---QPLIYSVLAVGALFSKEDLSKDSKATREFYT 264

Query: 232 ---------AKGILDDPTFSRIPTVEHVSAWVLRTIYLRATSRPHVAWLASCVTIHLSEA 282
                    AK  LD   FS I  +  + A  + TI+L+ ++     +  S + I L  A
Sbjct: 265 DEGYRYFLEAKNSLD---FSNITDIYSIQAIFMMTIFLQCSANLKACY--SFIGIALRAA 319

Query: 283 I--GLHQDIDKGEFSMTSGVTLRRTAGFNEHTKRLFWCAWSI----NTILSYDYG 331
           +  GLH+       S+     ++     +E  KRLFW  + +    N IL +  G
Sbjct: 320 LKEGLHR-----RSSIVGPTPIQ-----DETKKRLFWSVYKLDLYMNCILGFPSG 364

>AFR117C Chr6 complement(646829..650287) [3459 bp, 1152 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR256W
           (HAP1)
          Length = 1152

 Score = 48.1 bits (113), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 49/106 (46%), Gaps = 10/106 (9%)

Query: 12  KRQRVRKACVPCRERKRKCNGKSP-CEMCISYG--YVCHYMDKDRSSSSSFPVQKLDELP 68
           KR RV  +C  CR+RK KC+   P C  C   G  ++CHYM++  +  +   + K  EL 
Sbjct: 11  KRNRVPLSCTICRKRKVKCDKTRPHCNQCTKTGVAHLCHYMEQTWAGEAEKELSKDAELK 70

Query: 69  HAPESKPF------AASNIHGN-EVSSVDTQTVTNQSITDPVKSRY 107
           H  E           A N  G+  VS  D    + + + D V+ RY
Sbjct: 71  HLRERIRLLEEALGKACNGSGSLPVSPADLAQASPRLVEDGVRGRY 116

>KAFR0A02130 Chr1 (447063..449186) [2124 bp, 707 aa] {ON}
          Anc_2.565 YMR019W
          Length = 707

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 24/37 (64%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHY 48
          +R RV+KAC  C+ RK KC+G SPC  CI +   C Y
Sbjct: 8  QRLRVQKACDICKRRKVKCDGLSPCSNCIRHNVDCTY 44

 Score = 36.2 bits (82), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 26/114 (22%), Positives = 47/114 (41%), Gaps = 15/114 (13%)

Query: 222 HPREMDVVQYAKGILDDPTFSRIPTVEHVSAWVLRTIYLRATSRPHVAWLASCVTIHLSE 281
           H +E  +  Y+  I+   TF    + E + +W+L T YLR   R    W A    + + +
Sbjct: 311 HDKEGKLFNYSYSIVSKLTF-EWESFELLQSWLLITFYLRTCHRQIACWSALGKAVTMCK 369

Query: 282 AIGLHQDIDKGEFSMTSGVTLRRTAGFNEHTK--RLFWCAWSINTILSYDYGRS 333
            + LH +             L      N+  K    FW  + ++ ++S+  GR+
Sbjct: 370 GMSLHLN------------QLPEIHSENDRIKAWNCFWAVFIMDKLISFQIGRA 411

>TBLA0A01210 Chr1 (276151..280419) [4269 bp, 1422 aa] {ON} Anc_1.380
           YLR256W
          Length = 1422

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 28/46 (60%), Gaps = 3/46 (6%)

Query: 9   PSYKRQRVRKACVPCRERKRKCNGKSP-CEMCISYG--YVCHYMDK 51
           P  KR R+  +C  CR+RK KC+ K P C  C   G  ++CHYM++
Sbjct: 107 PKRKRNRIPLSCTICRKRKVKCDKKRPHCNQCTKTGVSHLCHYMEQ 152

>ZYRO0C18150g Chr3 (1418645..1420360) [1716 bp, 571 aa] {ON} some
          similarities with uniprot|P39529 Saccharomyces
          cerevisiae YJL206C
          Length = 571

 Score = 47.0 bits (110), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 30/47 (63%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMDKDRSSSSS 58
          KR RV  AC  CR +K+KC+G+ PC++C +    C Y D+ R ++ +
Sbjct: 20 KRLRVSHACDNCRLKKKKCDGQQPCKLCKNSENECIYSDRRRLTTGT 66

>KLLA0A06039g Chr1 (557368..559341) [1974 bp, 657 aa] {ON} weakly
          similar to uniprot|P36023 Saccharomyces cerevisiae
          YKR064W
          Length = 657

 Score = 47.0 bits (110), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 37/77 (48%), Gaps = 3/77 (3%)

Query: 8  IPSYKRQRVRKACVPCRERKRKCN-GKSPCEMCISYGYVCHYM-DKDRSSSSSFPVQKLD 65
          +P  KR R    C+ CR RK KC+ GK  C  C+  G  C Y  D D ++S     + +D
Sbjct: 9  VPVKKRHRPTLVCLNCRRRKTKCDRGKPSCSNCLKLGETCVYSEDTDENASKKVRYEYMD 68

Query: 66 ELPHAPESKPFAASNIH 82
          +L   PE    A   +H
Sbjct: 69 DLG-LPEFINMAPKGLH 84

>Ecym_5397 Chr5 (805712..808192) [2481 bp, 826 aa] {ON} similar to
          Ashbya gossypii AER370W
          Length = 826

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 27/47 (57%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMDKDRSSSSS 58
          KR+R+ +AC  CR++K KC+ + PC  C  Y Y C Y    R +  +
Sbjct: 14 KRRRITRACDECRKKKVKCDNRHPCIHCTVYSYECTYNQPARRTGGN 60

>NCAS0A03580 Chr1 complement(712039..715380) [3342 bp, 1113 aa]
          {ON} 
          Length = 1113

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 25/45 (55%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMDKDRSSSS 57
          R++V KAC  CR RK KC G  PC  C +Y   C + D    SS+
Sbjct: 30 RKKVSKACANCRRRKIKCTGTYPCSNCAAYQCECIFDDLKEDSSN 74

>NCAS0A03570 Chr1 complement(708718..711654) [2937 bp, 978 aa]
          {ON} 
          Length = 978

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 37/82 (45%), Gaps = 12/82 (14%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMDKDRSSSSSFPVQKLDELPHAP 71
          K+ R  +AC  CR RK KC+G  PC  C  YG +C +           PV  +   P   
Sbjct: 10 KKLRSSRACSNCRRRKIKCSGIQPCPNCEIYGCLCVFE----------PVNGMT--PMNF 57

Query: 72 ESKPFAASNIHGNEVSSVDTQT 93
           SKP      HGN + SV  +T
Sbjct: 58 SSKPSETEFHHGNSMHSVKPKT 79

>AER370W Chr5 (1320487..1322892) [2406 bp, 801 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YIL130W
          Length = 801

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 24/37 (64%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHY 48
          KR+RV +AC  CR++K KC+ + PC  C  Y Y C Y
Sbjct: 10 KRRRVTRACDECRKKKVKCDSRHPCIHCTVYSYECTY 46

>KLLA0A02585g Chr1 complement(226562..227674) [1113 bp, 370 aa]
          {ON} conserved hypothetical protein
          Length = 370

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 28/47 (59%), Gaps = 1/47 (2%)

Query: 2  ASSVPNIPSYKRQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHY 48
          + S   +P+ KR RV KAC  CR+ K KC+G+ PC  C+    +C Y
Sbjct: 5  SRSSAELPTIKR-RVSKACDACRKSKTKCDGERPCSRCLKENKLCTY 50

>KLLA0F22990g Chr6 (2134385..2138146) [3762 bp, 1253 aa] {ON}
           uniprot|Q6DR96 Kluyveromyces lactis HAP1
          Length = 1253

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 44/90 (48%), Gaps = 3/90 (3%)

Query: 12  KRQRVRKACVPCRERKRKCN-GKSPCEMCI--SYGYVCHYMDKDRSSSSSFPVQKLDELP 68
           KR RV  +C  CR+RK KC+ G+  C+ C+    G++CHYM++  +  +   + K  EL 
Sbjct: 17  KRNRVPLSCTICRKRKVKCDKGRPQCQQCVKTGVGHLCHYMEQTWAEEAEKELSKDSELK 76

Query: 69  HAPESKPFAASNIHGNEVSSVDTQTVTNQS 98
              E        +     ++ +  T  NQS
Sbjct: 77  QLRERVKSLEETLSKVHATTTNPMTSANQS 106

>KLTH0C00814g Chr3 (76637..79141) [2505 bp, 834 aa] {ON} similar
          to uniprot|P25502 Saccharomyces cerevisiae YKL015W PUT3
          Positive regulator of PUT (proline utilization) genes
          zinc-finger transcription factor of the Zn(2)-Cys(6)
          binuclear cluster domain type
          Length = 834

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 28/44 (63%), Gaps = 3/44 (6%)

Query: 13 RQRVRK---ACVPCRERKRKCNGKSPCEMCISYGYVCHYMDKDR 53
          ++R+++   ACV CR R  KC+G+ PC  C++    C YM+ ++
Sbjct: 43 KRRIKRSGLACVRCRRRHAKCSGEKPCSTCVAANIACEYMEPNK 86

>Smik_11.240 Chr11 (395459..395932,395981..398437) [2931 bp, 976
          aa] {ON} YKL015W (REAL)
          Length = 976

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 26/39 (66%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMD 50
          ++QR   AC+ CR+R  KC G +PC+ C++   +C Y++
Sbjct: 26 RQQRSSIACLSCRKRHIKCPGGNPCQKCVASNAICEYLE 64

>KLTH0B09262g Chr2 (758773..761235) [2463 bp, 820 aa] {ON} weakly
          similar to uniprot|P39961 Saccharomyces cerevisiae
          YER184C Hypothetical ORF
          Length = 820

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 17/35 (48%), Positives = 23/35 (65%)

Query: 14 QRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHY 48
          +R  +AC+ CR RK KC+G+SPC  C +Y   C Y
Sbjct: 12 ERAARACLNCRRRKVKCSGQSPCANCRNYNCACTY 46

>NCAS0H03420 Chr8 complement(648059..650767) [2709 bp, 902 aa]
          {ON} Anc_2.654
          Length = 902

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 26/42 (61%)

Query: 9  PSYKRQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMD 50
          PS KR+    AC+ CR+R  KC+G +PC  CI +   C Y++
Sbjct: 18 PSSKRRPKSLACILCRKRHIKCSGGNPCARCIKHDLKCEYIE 59

>Suva_11.213 Chr11 (392506..392993,393045..395514) [2958 bp, 985
          aa] {ON} YKL015W (REAL)
          Length = 985

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 27/44 (61%), Gaps = 6/44 (13%)

Query: 13 RQRVRK------ACVPCRERKRKCNGKSPCEMCISYGYVCHYMD 50
          +QR RK      AC+ CR+R  KC G +PC+ CI+   +C Y++
Sbjct: 21 KQRQRKQPRSAVACLSCRKRHIKCPGGNPCQKCITSNAICEYLE 64

>Skud_7.274 Chr7 complement(472171..475413) [3243 bp, 1080 aa]
          {ON} YGL013C (REAL)
          Length = 1080

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/39 (48%), Positives = 23/39 (58%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMDK 51
          R +V KAC  CR+RK KCNGK PC  C  Y   C +  +
Sbjct: 36 RSKVSKACDNCRKRKIKCNGKFPCASCEIYSCECTFTSR 74

>Smik_7.277 Chr7 complement(461108..464317) [3210 bp, 1069 aa] {ON}
           YGL013C (REAL)
          Length = 1069

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 37/88 (42%), Gaps = 26/88 (29%)

Query: 13  RQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHY----------------------MD 50
           R +V KAC  CR+RK KCNGK PC  C  Y   C +                        
Sbjct: 36  RSKVSKACDNCRKRKIKCNGKFPCASCEIYSCECTFTTRQGGNRIKNLQKANLEGTIVQG 95

Query: 51  KDRSSSSSFPVQKLDELPHAPESKPFAA 78
           K+ + SSS P+ K    P    S+P+A 
Sbjct: 96  KEETDSSSTPLPK----PQPYASRPYAT 119

>TDEL0C05680 Chr3 complement(1020646..1022721) [2076 bp, 691 aa]
           {ON} Anc_1.128 YJL206C
          Length = 691

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 29/43 (67%), Gaps = 1/43 (2%)

Query: 13  RQRVRKACVPCRERKRKCNGKSPCEMCISYGYV-CHYMDKDRS 54
           + RV +AC  CR +K+KC+G+ PC++C   G V C Y+++  S
Sbjct: 123 KGRVSRACEFCRSKKKKCDGQQPCDLCKLVGKVPCVYLNRKNS 165

>KNAG0H00250 Chr8 (37360..40050) [2691 bp, 896 aa] {ON} Anc_2.654
           YKL015W
          Length = 896

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 23/41 (56%)

Query: 13  RQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMDKDR 53
           R R+  ACV CR R  KC G +PC  CI+    C Y++  +
Sbjct: 69  RSRLPVACVACRRRHSKCPGGNPCSKCIAANLTCEYIEPSK 109

>YGL013C Chr7 complement(469092..472298) [3207 bp, 1068 aa] {ON}
          PDR1Zinc cluster protein that is a master regulator
          involved in recruiting other zinc cluster proteins to
          pleiotropic drug response elements (PDREs) to fine tune
          the regulation of multidrug resistance genes
          Length = 1068

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/36 (52%), Positives = 22/36 (61%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHY 48
          R +V KAC  CR+RK KCNGK PC  C  Y   C +
Sbjct: 39 RSKVSKACDNCRKRKIKCNGKFPCASCEIYSCECTF 74

>Skud_11.214 Chr11 (389377..389855,389895..392361) [2946 bp, 981
          aa] {ON} YKL015W (REAL)
          Length = 981

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 27/44 (61%), Gaps = 6/44 (13%)

Query: 13 RQRVRK------ACVPCRERKRKCNGKSPCEMCISYGYVCHYMD 50
          +QR R+      AC+ CR+R  KC G SPC+ CI+   +C Y++
Sbjct: 21 KQRQRRQPRSAVACLSCRKRHIKCPGGSPCQKCITSNAICEYLE 64

>NDAI0A03410 Chr1 complement(778569..781511) [2943 bp, 980 aa] {ON} 
          Length = 980

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 42/95 (44%), Gaps = 1/95 (1%)

Query: 12  KRQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMDKDRSSSSSFPVQKLDELPHA- 70
           K+ R  +AC  CR RK KC+G  PC  C  Y   C +    R + S   ++++    H  
Sbjct: 10  KKTRSSRACENCRARKIKCSGNQPCSNCEIYNCPCAFTPIKRKNLSDKGIERIANNDHLF 69

Query: 71  PESKPFAASNIHGNEVSSVDTQTVTNQSITDPVKS 105
            E+     +NI  +  S+ D     + S   P+ S
Sbjct: 70  QENNASTTTNIRSDFESTNDANKPASSSEVSPIDS 104

>KNAG0D03520 Chr4 complement(642517..645609) [3093 bp, 1030 aa]
          {ON} Anc_4.113 YGL013C
          Length = 1030

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 23/36 (63%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHY 48
          R +VR+AC  CR+RK KC G  PC  C +YG  C +
Sbjct: 28 RNKVRRACNNCRKRKIKCTGLHPCASCEAYGCPCIF 63

>ZYRO0B14476g Chr2 complement(1175759..1177882) [2124 bp, 707 aa]
          {ON} conserved hypothetical protein
          Length = 707

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 10 SYKRQRVRKACVPCRERKRKCNGKS--PCEMCISYGYVCHYMDKDRSSSSSFP 60
          +Y+ +R  K C  C++R+ KC  +   PCE C+ +G  C Y D++  S +  P
Sbjct: 3  NYESRRRTKPCASCKQRRLKCQYQETLPCERCVKHGIACFYPDENLRSKAQEP 55

>KLTH0E00440g Chr5 complement(42945..45011) [2067 bp, 688 aa] {ON}
          some similarities with uniprot|P25502 Saccharomyces
          cerevisiae YKL015W PUT3 Positive regulator of PUT
          (proline utilization) genes zinc-finger transcription
          factor of the Zn(2)-Cys(6) binuclear cluster domain
          type
          Length = 688

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 24/28 (85%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCI 40
          R+++ KAC+ C++RK+KC+G+ PC+ C+
Sbjct: 3  RKKMMKACIKCKQRKKKCSGQLPCDYCV 30

>KLTH0B10076g Chr2 (841024..843090) [2067 bp, 688 aa] {ON} some
          similarities with uniprot|P25502 Saccharomyces
          cerevisiae YKL015W PUT3 Positive regulator of PUT
          (proline utilization) genes zinc-finger transcription
          factor of the Zn(2)-Cys(6) binuclear cluster domain
          type
          Length = 688

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 24/28 (85%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCI 40
          R+++ KAC+ C++RK+KC+G+ PC+ C+
Sbjct: 3  RKKMMKACIKCKQRKKKCSGQLPCDYCV 30

>SAKL0D01100g Chr4 complement(81235..84057) [2823 bp, 940 aa] {ON}
          weakly similar to uniprot|P33200 Saccharomyces
          cerevisiae YBL005W PDR3 Transcriptional activator of
          the pleiotropic drug resistance network regulates
          expression of ATP-binding cassette (ABC) transporters
          through binding to cis-acting sites known as PDREs (PDR
          responsive elements)
          Length = 940

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 28/50 (56%), Gaps = 4/50 (8%)

Query: 3  SSVPNIPSYK----RQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHY 48
          +SVP++P  +      +V +AC  CR RK KC GK PC  C +Y   C Y
Sbjct: 7  ASVPHMPPKRVTKSSSKVSRACDNCRRRKIKCTGKQPCSNCQAYQCHCEY 56

>Kpol_1061.42 s1061 complement(116430..119819) [3390 bp, 1129 aa]
          {ON} complement(116430..119819) [3390 nt, 1130 aa]
          Length = 1129

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 25/44 (56%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMDKDRSSS 56
          R +V +AC  CR RK KC+G  PC  CI+Y   C +   D  +S
Sbjct: 33 RSKVSRACEGCRRRKIKCSGNWPCSSCITYDCECIFTSSDSINS 76

>KAFR0B03950 Chr2 complement(823760..827500) [3741 bp, 1246 aa]
          {ON} Anc_8.845 YMR280C
          Length = 1246

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 26/46 (56%), Gaps = 1/46 (2%)

Query: 7  NIPSYKRQRVRKACVPCRERKRKCNGKSP-CEMCISYGYVCHYMDK 51
          N PS    RV +AC  CR +K +C+G+ P C  C + G+ C   DK
Sbjct: 19 NHPSSSNYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDK 64

>ZYRO0G10252g Chr7 (819658..822768) [3111 bp, 1036 aa] {ON}
          similar to uniprot|P12383 Saccharomyces cerevisiae
          YGL013C PDR1 Zinc cluster protein that is a master
          regulator involved in recruiting other zinc cluster
          proteins to pleiotropic drug response elements (PDREs)
          to fine tune the regulation of multidrug resistance
          genes
          Length = 1036

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 21/37 (56%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYM 49
          R +V +AC  CR RK KC GK PC  C +Y   C Y 
Sbjct: 10 RNKVNRACYNCRRRKIKCTGKYPCSSCEAYQCECLYF 46

>Ecym_7440 Chr7 complement(902108..904804) [2697 bp, 898 aa] {ON}
          similar to Ashbya gossypii AER183C
          Length = 898

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 22/36 (61%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHY 48
          R+RV KAC  CR +K KCNG+ PC  C  +   C Y
Sbjct: 20 RKRVSKACDTCRAKKIKCNGEEPCSNCGKHDLECAY 55

>NDAI0D03550 Chr4 complement(843265..846621) [3357 bp, 1118 aa]
          {ON} Anc_4.113
          Length = 1118

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 22/35 (62%)

Query: 14 QRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHY 48
           +V KAC  CR RK KC GK+PC  C +Y  +C Y
Sbjct: 57 NKVTKACDNCRRRKIKCTGKTPCATCEAYQCLCIY 91

>NDAI0B01540 Chr2 complement(359639..362050) [2412 bp, 803 aa]
          {ON} Anc_2.565
          Length = 803

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 23/37 (62%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHY 48
          +R RV++AC  C++RK KC+G  PC  CI     C Y
Sbjct: 17 QRLRVQRACAICKKRKVKCDGMKPCSNCIKRSKDCTY 53

 Score = 36.2 bits (82), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 48/111 (43%), Gaps = 17/111 (15%)

Query: 225 EMDVVQYAKGILDDPTFSRIPTVEHVSAWVLRTIYLRATSRPHVAWLASCVTIHLSEAIG 284
           E  +  Y+  I+   TF    + E + +W+L T YLR   R   +W A    I+L   + 
Sbjct: 380 EDSMFNYSYSIISKLTF-EWESFELIQSWLLITFYLRTCYRQTSSWHALGQAINLCNGMS 438

Query: 285 LHQDIDKGEFSMTSGVTLRRTAGFNEHTKRLFWCAWS---INTILSYDYGR 332
           LH +    EF           + + E   +LF C W+   I+  +S+  GR
Sbjct: 439 LHLN----EFPHIH-------SKYEE--SKLFHCFWACFIIDKFISFQLGR 476

>KLLA0A09119g Chr1 complement(797533..800781) [3249 bp, 1082 aa]
           {ON} weakly similar to uniprot|P12383 Saccharomyces
           cerevisiae YGL013C PDR1 Zinc cluster protein that is a
           master regulator involved in recruiting other zinc
           cluster proteins to pleiotropic drug response elements
           (PDREs) to fine tune the regulation of multidrug
           resistance genes
          Length = 1082

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 34/63 (53%), Gaps = 11/63 (17%)

Query: 13  RQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHY-----------MDKDRSSSSSFPV 61
           R++V +AC  CR++K KC+G  PC+ C +YG  C Y               +S SS+F  
Sbjct: 48  RRKVSRACDSCRKKKIKCSGTLPCKSCETYGCECVYSHAPYGVAKGKKKTAKSDSSAFTK 107

Query: 62  QKL 64
           +KL
Sbjct: 108 EKL 110

>TDEL0B06260 Chr2 (1104557..1108300) [3744 bp, 1247 aa] {ON}
          Anc_1.380 YLR256W
          Length = 1247

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 34/59 (57%), Gaps = 3/59 (5%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSP-CEMCISYG--YVCHYMDKDRSSSSSFPVQKLDEL 67
          KR R+  +C  CR+RK KC+   P C+ C+  G  ++CHYM++  +  +   + K  EL
Sbjct: 24 KRNRIPLSCTICRKRKVKCDKTRPHCDQCVKTGVAHLCHYMEQSWAEEAEKEISKETEL 82

>SAKL0C00242g Chr3 (14453..16954) [2502 bp, 833 aa] {ON} weakly
          similar to uniprot|P39961 Saccharomyces cerevisiae
          YER184C Hypothetical ORF
          Length = 833

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 39/79 (49%), Gaps = 12/79 (15%)

Query: 1  MASSVPN----IPSYKRQ--RVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMDKDRS 54
          M SS P     +   K+Q  +V +AC  CR+RK KC+G  PC  C  Y  VC Y  K  +
Sbjct: 1  MKSSAPTSSKVLKRQKKQPDKVFRACKSCRKRKIKCSGFQPCSNCEVYKCVCEYKAKRPA 60

Query: 55 SSSSF------PVQKLDEL 67
          +   F       +QK+D L
Sbjct: 61 AKLPFYNNNDKVIQKIDAL 79

>NCAS0A12720 Chr1 (2510574..2512853) [2280 bp, 759 aa] {ON}
          Anc_2.565
          Length = 759

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 24/42 (57%), Gaps = 2/42 (4%)

Query: 9  PSYKRQRVR--KACVPCRERKRKCNGKSPCEMCISYGYVCHY 48
          P  K+QR+R  +AC  C+ RK KC+G  PC  CI     C Y
Sbjct: 21 PERKKQRIRVQRACNICKRRKVKCDGNKPCLNCIKKEIDCEY 62

>KNAG0M02120 Chr13 (395195..397021) [1827 bp, 608 aa] {ON}
          Anc_2.565 YMR019W
          Length = 608

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 17/35 (48%), Positives = 21/35 (60%)

Query: 14 QRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHY 48
          +RVR AC  C+ RK KC+GK PC  C     +C Y
Sbjct: 7  RRVRAACAVCQRRKLKCDGKQPCSRCARTDRICRY 41

>Skud_13.173 Chr13 (298693..298722,298729..301461) [2763 bp, 920 aa]
           {ON} YMR019W (REAL)
          Length = 920

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 33/62 (53%), Gaps = 5/62 (8%)

Query: 10  SYKRQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMDK-----DRSSSSSFPVQKL 64
           S  R RV+KAC  C++RK KC+G  PC  C  +   C Y  K      R   ++ P+Q +
Sbjct: 47  SRGRLRVQKACELCKKRKVKCDGNKPCLNCFKHQKECRYEFKATNRRRRRRQATSPIQNV 106

Query: 65  DE 66
           +E
Sbjct: 107 NE 108

>KLTH0G13200g Chr7 (1133333..1133382,1133450..1135100) [1701 bp,
          566 aa] {ON} highly similar to uniprot|Q04176
          Saccharomyces cerevisiae YDR397C NCB2 Beta subunit of
          the NC2 dimeric histone-fold complex represses RNA
          polymerase II transcription through binding to TBP and
          inhibition of TFIIA and TFIIB homologous to the Dr1
          subunit of the mammalian NC2 (negative
          cofactor2)[INTRON]
          Length = 566

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 23/34 (67%)

Query: 19 ACVPCRERKRKCNGKSPCEMCISYGYVCHYMDKD 52
          AC  CR+R+RKCN +SPC  C  YG  C  +++D
Sbjct: 17 ACQSCRKRRRKCNLESPCSNCQKYGVECVPINQD 50

>Kpol_1061.26 s1061 (69833..73657) [3825 bp, 1274 aa] {ON}
          (69833..73657) [3825 nt, 1275 aa]
          Length = 1274

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 27/43 (62%), Gaps = 3/43 (6%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSP-CEMCISYG--YVCHYMDK 51
          KR R+  +C  CR+RK KC+   P C  CI  G  ++CHYM++
Sbjct: 12 KRNRIPLSCTICRKRKVKCDKTHPHCNQCIKTGVHHLCHYMEQ 54

>SAKL0G19470g Chr7 complement(1677759..1680254) [2496 bp, 831 aa]
          {ON} similar to uniprot|P25502 Saccharomyces cerevisiae
          YKL015W PUT3 Positive regulator of PUT (proline
          utilization) genes zinc-finger transcription factor of
          the Zn(2)-Cys(6) binuclear cluster domain type
          Length = 831

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 25/42 (59%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMDKDR 53
          +++R   ACV CR R  KC G +PC  CI+    C Y++ ++
Sbjct: 40 RQKRSSMACVRCRRRHVKCPGGNPCSKCIAANIACEYIEPNK 81

>TPHA0B03630 Chr2 (844571..848860) [4290 bp, 1429 aa] {ON}
          Anc_1.380 YLR256W
          Length = 1429

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 31/54 (57%), Gaps = 3/54 (5%)

Query: 1  MASSVPNIPSYKRQRVRKACVPCRERKRKCNGKSP-CEMCISYG--YVCHYMDK 51
          ++ S  N    KR R+  +C  CR+RK KC+   P C  C+  G  ++CHYM++
Sbjct: 26 ISESAKNKIKRKRNRIPLSCTICRKRKVKCDKTHPHCNQCVKTGVQHLCHYMEQ 79

>KLTH0E06666g Chr5 (611348..614188) [2841 bp, 946 aa] {ON} conserved
           hypothetical protein
          Length = 946

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 48/217 (22%), Positives = 83/217 (38%), Gaps = 36/217 (16%)

Query: 11  YKRQRVRKACVPCRERKRKCNGKSP-CEMCISYGYVCHYMDKDRSSSSSFPVQKLD---- 65
           ++RQR   +CVPC +RK KC  + P C  C+   + C Y   DR S    P  +      
Sbjct: 26  HRRQRKILSCVPCHKRKIKCTREQPSCSKCLKRNWDCSYFLNDRVSRGGQPTAETRTEGS 85

Query: 66  -ELP-------HAPESKPFAASNIHGNEVSSVDTQTV-------------------TNQS 98
            +LP       H P+ K      I   +    D + +                   T+Q 
Sbjct: 86  AQLPTNIVSGKHDPQKKKQLLMAIEKAKSMINDERNLLELNRKQKREYPRRKQAWETDQP 145

Query: 99  ITDPVKSRYTIQHSAVAFPRCLGLELRSANPPRLHSFAWHCGIRPEENPSS--HVLLSEL 156
           ++  V    +  H+   +P        S + P +     +  ++    P S  + L   L
Sbjct: 146 VSGTVTP--SGGHNQHEYPVASVTSGTSQSTPTISPPMSYSSMQDSPRPLSGENSLPMYL 203

Query: 157 ITKEEYYRVSKVYFSVVHPIFDVVDPKQLAKNVEEYW 193
            T++    + +VY + VHPI  ++D  +   + E +W
Sbjct: 204 PTRQRAVELFEVYRNTVHPIIPLLDFSKFMSDQETFW 240

>ACL058W Chr3 (261723..264176) [2454 bp, 817 aa] {ON} NOHBY305; No
          homolog in Saccharomyces cerevisiae
          Length = 817

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 21/46 (45%), Positives = 25/46 (54%), Gaps = 1/46 (2%)

Query: 11 YKRQRVRKACVPCRERKRKCNGKSP-CEMCISYGYVCHYMDKDRSS 55
          +KRQR    C+PC +RK KCN   P C+ C    Y C Y   DR S
Sbjct: 29 HKRQRRVLNCMPCHKRKVKCNRARPVCDHCEKNRYACAYFVNDRVS 74

>ZYRO0E05412g Chr5 (410945..414679) [3735 bp, 1244 aa] {ON}
          similar to uniprot|P12351 Saccharomyces cerevisiae
          YLR256W HAP1
          Length = 1244

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 33/59 (55%), Gaps = 3/59 (5%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSP-CEMCISYG--YVCHYMDKDRSSSSSFPVQKLDEL 67
          KR R+  +C  CR+RK KC+   P CE C   G  ++CHYM++  +  +   + K  EL
Sbjct: 27 KRNRIPLSCTICRKRKVKCDKTRPNCEQCSKTGVAHLCHYMEQTWAEEAEKEISKESEL 85

>TBLA0C01120 Chr3 complement(233451..237911) [4461 bp, 1486 aa]
          {ON} Anc_1.380 YLR256W
          Length = 1486

 Score = 44.7 bits (104), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 27/46 (58%), Gaps = 3/46 (6%)

Query: 9  PSYKRQRVRKACVPCRERKRKCNGKSP-CEMCISYG--YVCHYMDK 51
          P  KR R+  +C  CR+RK KC+   P C  C   G  ++CHYM++
Sbjct: 8  PKRKRNRIPLSCTICRKRKVKCDKTHPYCVQCTKTGMSHLCHYMEQ 53

>Suva_7.268 Chr7 complement(460629..463631) [3003 bp, 1000 aa]
          {ON} YGL013C (REAL)
          Length = 1000

 Score = 44.7 bits (104), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 20/43 (46%), Positives = 25/43 (58%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMDKDRSS 55
          R +V KAC  CR+RK KCNGK PC  C  Y   C +  +  S+
Sbjct: 36 RSKVSKACDNCRKRKIKCNGKFPCASCEIYLCECTFTTRHGSN 78

>ZYRO0G14278g Chr7 complement(1141297..1145049) [3753 bp, 1250 aa]
           {ON} similar to uniprot|Q75DZ4 Ashbya gossypii ABL121C
           ABL121Cp and similar to YMR280C uniprot|P39113
           Saccharomyces cerevisiae YMR280C CAT8 Zinc cluster
           transcriptional activator
          Length = 1250

 Score = 44.7 bits (104), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 27/47 (57%), Gaps = 3/47 (6%)

Query: 15  RVRKACVPCRERKRKCNGKSP-CEMCISYGYVCHYMDKDRSSSSSFP 60
           RV +AC  CR +K +C+GK P C  C + G+ C     DR S  +FP
Sbjct: 99  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKI--SDRLSRRAFP 143

>Suva_13.186 Chr13 (302887..305571) [2685 bp, 894 aa] {ON} YMR019W
          (REAL)
          Length = 894

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 26/46 (56%)

Query: 3  SSVPNIPSYKRQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHY 48
          ++  N  S  R RV+KAC  C++RK KC+G  PC  C  +   C Y
Sbjct: 15 TAASNENSKTRLRVQKACELCKKRKVKCDGNKPCLNCSKHQKECRY 60

 Score = 34.3 bits (77), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 31/121 (25%), Positives = 51/121 (42%), Gaps = 28/121 (23%)

Query: 221 GHP--REMDVVQYAKGILDDPTFSRIPTVEHVSAWVLRTIYLRATSRPHVAWLASCVTIH 278
           G P   EM + +YA  I++  TF    + E + +W+L   Y R   R    W A      
Sbjct: 430 GKPFIEEM-MFEYAYSIINTLTF-EWESFELIQSWLLIAFYFRTCYRQTACWNA------ 481

Query: 279 LSEAIGLHQDIDKGEFSMTSGVTLRRTAGFNEHTK-------RLFWCAWSINTILSYDYG 331
           LS+A+           +M +G+TL        H+          FWC + ++ ++S+  G
Sbjct: 482 LSQAV-----------NMCNGMTLYLNKFPEIHSTYDESKAWHCFWCCFIMDKLISFQTG 530

Query: 332 R 332
           R
Sbjct: 531 R 531

>KLTH0E05786g Chr5 (517896..520349) [2454 bp, 817 aa] {ON} weakly
           similar to uniprot|P39961 Saccharomyces cerevisiae
           YER184C Hypothetical ORF
          Length = 817

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 45/162 (27%), Positives = 69/162 (42%), Gaps = 21/162 (12%)

Query: 1   MASSVPNIPSYKRQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMDKDRSSSSSFP 60
           MA+      +Y  ++  +AC+ CR RK KCNG  PC  C + G  C Y       + S  
Sbjct: 32  MATPRVTKRAYTIRKTPQACISCRRRKVKCNGCRPCSSCKTNGLECAY------DTPSLE 85

Query: 61  VQKLDELPHAPESKPFA-ASNIHGN--EVSSV--DTQTVTNQSITD------PVKSRYTI 109
              +   PH   S+     SN+H     +SS+  D     + ++TD       ++SR  +
Sbjct: 86  QVNIKGKPHIDTSEALRLISNLHSTLRNLSSLAQDDPGSMSSTVTDISMRVHDLESRLHM 145

Query: 110 QHSAVAFPRCLGLELRSANPPRLHSFAWHCGIRPEENPSSHV 151
           Q +      C G     +   +L SF     +  EENP+S V
Sbjct: 146 QLNPYKAANCRG---EKSLEYKLASFG-PAKVGYEENPNSPV 183

>NDAI0A03420 Chr1 complement(782010..785336) [3327 bp, 1108 aa]
          {ON} 
          Length = 1108

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 22/36 (61%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHY 48
          R++V KAC+ CR RK KC G  PC  C +Y   C +
Sbjct: 10 RKKVVKACLNCRRRKIKCTGTFPCSNCAAYQCECVF 45

>KLTH0E07854g Chr5 (719642..722458) [2817 bp, 938 aa] {ON} weakly
          similar to uniprot|P12383 Saccharomyces cerevisiae
          YGL013C PDR1 Zinc cluster protein that is a master
          regulator involved in recruiting other zinc cluster
          proteins to pleiotropic drug response elements (PDREs)
          to fine tune the regulation of multidrug resistance
          genes
          Length = 938

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 22/37 (59%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHY 48
          KR +V +AC  CR RK KC G +PC  C +Y   C Y
Sbjct: 15 KRSKVSRACNNCRRRKIKCTGANPCLNCQTYKCECTY 51

>Kpol_467.1 s467 (471..4340) [3870 bp, 1289 aa] {ON} (471..4340)
           [3870 nt, 1290 aa]
          Length = 1289

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 53/112 (47%), Gaps = 13/112 (11%)

Query: 12  KRQRVRKACVPCRERKRKCNGKSP-CEMCISYG--YVCHYMDKDRSSSSSFPVQKLDELP 68
           KR R+  +C  CR+RK KC+   P C  C   G  ++CHYM++  +  +   + K  EL 
Sbjct: 19  KRNRIPLSCTICRKRKVKCDKTRPHCNQCTKTGVAHLCHYMEQSWAEEAEKELSKEAELK 78

Query: 69  HAPES--------KPFAASNIHGNEVSSVDTQTVTNQSITD-PVKSRYTIQH 111
              E             + NI+ N  +S +  T  + S+TD P+K +  I +
Sbjct: 79  QLKERVKSLKDMLADLQSKNIYRNGNTS-ENSTSGSPSLTDLPMKIKTEINN 129

>CAGL0F09229g Chr6 complement(908186..910693) [2508 bp, 835 aa]
          {ON} weakly similar to uniprot|P39961 Saccharomyces
          cerevisiae YER184c
          Length = 835

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 23/36 (63%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHY 48
          + RV +AC  CR+RK KC+G  PC  C++   VC Y
Sbjct: 14 KDRVIRACDVCRKRKVKCDGDQPCSSCMTASTVCIY 49

>KLLA0D01452g Chr4 (124018..128355) [4338 bp, 1445 aa] {ON} similar
           to uniprot|Q75DZ4 Ashbya gossypii ABL121C ABL121Cp and
           similar to YMR280C uniprot|P39113 Saccharomyces
           cerevisiae YMR280C CAT8 Zinc cluster transcriptional
           activator
          Length = 1445

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 26/44 (59%), Gaps = 4/44 (9%)

Query: 9   PSYKRQRVRKACVPCRERKRKCNGKSP-CEMCISYGYVCHYMDK 51
           PSY   RV +AC  CR +K +C+GK P C  C + G+ C   DK
Sbjct: 175 PSY---RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDK 215

>TPHA0O00600 Chr15 complement(107944..112062) [4119 bp, 1372 aa]
           {ON} Anc_1.380 YLR256W
          Length = 1372

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 47/98 (47%), Gaps = 9/98 (9%)

Query: 12  KRQRVRKACVPCRERKRKCNGKSP-CEMCISYG--YVCHYMDK------DRSSSSSFPVQ 62
           KR R+  +C  CR+RK KC+   P C+ C   G  ++CHYM++      ++  S    +Q
Sbjct: 74  KRNRIPLSCTICRKRKVKCDKTRPHCDPCSKTGVAHLCHYMEQTWAEEAEKELSKENELQ 133

Query: 63  KLDELPHAPESKPFAASNIHGNEVSSVDTQTVTNQSIT 100
           +L E   + E       N H     ++D   + ++ IT
Sbjct: 134 QLKERVKSLEKTIVKLRNQHEMINDNMDNDNIKDKEIT 171

>TDEL0D00820 Chr4 (151394..153451) [2058 bp, 685 aa] {ON} 
          Length = 685

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 30/51 (58%), Gaps = 2/51 (3%)

Query: 10 SYKRQRVRKACVPCRERKRKCNGKS--PCEMCISYGYVCHYMDKDRSSSSS 58
          SY+ ++  + CV C+ +K KC  K   PCE CI +G  C++    + S+++
Sbjct: 3  SYESKKRTRPCVSCKRQKLKCQYKESLPCERCIKHGMACYFPTTQKQSATA 53

>NDAI0G05260 Chr7 (1277631..1282376) [4746 bp, 1581 aa] {ON}
           Anc_1.380 YLR256W
          Length = 1581

 Score = 44.3 bits (103), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 33/59 (55%), Gaps = 3/59 (5%)

Query: 12  KRQRVRKACVPCRERKRKCNGKSP-CEMCISYG--YVCHYMDKDRSSSSSFPVQKLDEL 67
           KR RV  +C  CR+RK KC+   P C+ C   G  ++CHYM++  +  +   + K  EL
Sbjct: 58  KRNRVPLSCTICRKRKVKCDKIRPHCQQCTKTGVAHLCHYMEQSWAEEAEKELSKETEL 116

>TBLA0C04050 Chr3 complement(980010..983633) [3624 bp, 1207 aa]
          {ON} Anc_4.113 YGL013C
          Length = 1207

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 21/34 (61%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCISYGYVC 46
          R +V KAC  CR RK KC+G+ PC  C +Y   C
Sbjct: 10 RSKVSKACDNCRRRKIKCSGERPCAGCKTYNCEC 43

>Kwal_47.17506 s47 (431921..434695) [2775 bp, 924 aa] {ON} YGL013C
          (PDR1) - zinc-finger transcription factor of the
          Zn(2)-Cys(6) binuclear cluster domain type [contig 207]
          FULL
          Length = 924

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 21/37 (56%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHY 48
          KR +V +AC  CR RK KC G  PC  C +Y   C Y
Sbjct: 11 KRSKVSRACNNCRRRKIKCTGAQPCLNCQTYRCECTY 47

>KAFR0I02030 Chr9 complement(416471..420172) [3702 bp, 1233 aa]
          {ON} Anc_1.380 YLR256W
          Length = 1233

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 35/64 (54%), Gaps = 3/64 (4%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSP-CEMCISYG--YVCHYMDKDRSSSSSFPVQKLDELP 68
          KR R+  +C  CR+RK KC+   P C  C   G  ++CHYM++  +  +   + K +E+ 
Sbjct: 30 KRNRIPLSCTICRKRKVKCDKIRPHCNQCTKTGVAHLCHYMEQSWAEEAEKELSKENEIK 89

Query: 69 HAPE 72
          +  E
Sbjct: 90 NLKE 93

>TDEL0B00530 Chr2 (95898..99803) [3906 bp, 1301 aa] {ON} Anc_8.845
           YMR280C
          Length = 1301

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 27/47 (57%), Gaps = 3/47 (6%)

Query: 15  RVRKACVPCRERKRKCNGKSP-CEMCISYGYVCHYMDKDRSSSSSFP 60
           RV +AC  CR +K +C+GK P C  C + G+ C   DK   S  +FP
Sbjct: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDK--LSRRAFP 141

>NCAS0A08840 Chr1 (1746841..1751277) [4437 bp, 1478 aa] {ON}
          Anc_1.380
          Length = 1478

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 33/59 (55%), Gaps = 3/59 (5%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSP-CEMCISYG--YVCHYMDKDRSSSSSFPVQKLDEL 67
          KR RV  +C  CR+RK KC+   P C+ C   G  ++CHYM++  +  +   + K  EL
Sbjct: 35 KRNRVPLSCTICRKRKVKCDKIRPHCQQCTKTGVAHLCHYMEQSWAEEAEKELSKETEL 93

>NDAI0A01040 Chr1 complement(220931..223918) [2988 bp, 995 aa] {ON}
           Anc_1.199
          Length = 995

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 40/98 (40%), Gaps = 23/98 (23%)

Query: 6   PNIPSYKRQRVRKACVPCRERKRKCNGKSPCEMC--ISYGYVCHYMDKDRSSSSSFPVQK 63
           PN PS KR R    C  C++RK KC+   PC  C  +  G  C Y               
Sbjct: 58  PNQPSRKRHRSTVVCTNCKKRKSKCDRSRPCGTCKRLGDGNSCFY--------------- 102

Query: 64  LDELPHAPESKPFAASNIHGNEVSSVDTQTVTNQSITD 101
              +P  P+ KP   S    + +S++    V+N +  D
Sbjct: 103 ---IPEVPKVKP---SKSRKSSISNIPINPVSNNNSGD 134

>NDAI0D03480 Chr4 complement(818292..820418) [2127 bp, 708 aa] {ON}
           Anc_4.121
          Length = 708

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 46/99 (46%), Gaps = 12/99 (12%)

Query: 12  KRQRVRKACVPCRERKRKCNGKSPCEMCISYGYV--CHY-MDKDRSSSSSFPVQKLDELP 68
           KR+R+ K+C  C   K KCN + PC  CI+ G +  C Y  DK         +Q  D   
Sbjct: 13  KRKRLIKSCKYCYTHKLKCNKEKPCSKCIAVGLIDECIYGFDKGE-------LQNHDSTS 65

Query: 69  HAPESKPFAASNIHGNEVSSVDTQTVTNQSITDPVKSRY 107
           H+  + P     +  N    V     TN++ + P+KS+Y
Sbjct: 66  HSESTTPSPKLPLSSNS-GKVRKIKTTNKT-SSPLKSKY 102

>Ecym_4616 Chr4 complement(1204091..1208824) [4734 bp, 1577 aa] {ON}
           similar to Ashbya gossypii ABL121C
          Length = 1577

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 23/38 (60%), Gaps = 1/38 (2%)

Query: 15  RVRKACVPCRERKRKCNGKSP-CEMCISYGYVCHYMDK 51
           RV +AC  CR +K +C+GK P C  C + G+ C   DK
Sbjct: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDK 161

>Kwal_47.17233 s47 (309658..312504) [2847 bp, 948 aa] {ON} [contig
          211] FULL
          Length = 948

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 27/46 (58%), Gaps = 1/46 (2%)

Query: 11 YKRQRVRKACVPCRERKRKCNGKSP-CEMCISYGYVCHYMDKDRSS 55
          ++RQR   +CVPC +RK KC  ++P C  C+   + C Y   DR S
Sbjct: 26 HRRQRKILSCVPCHKRKIKCTRETPSCSKCLKKNWECSYFLNDRIS 71

>SAKL0D01342g Chr4 (101095..104907) [3813 bp, 1270 aa] {ON} similar
           to uniprot|Q75DZ4 Ashbya gossypii ABL121C ABL121Cp and
           similar to YMR280C uniprot|P39113 Saccharomyces
           cerevisiae YMR280C CAT8 Zinc cluster transcriptional
           activator
          Length = 1270

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 23/38 (60%), Gaps = 1/38 (2%)

Query: 15  RVRKACVPCRERKRKCNGKSP-CEMCISYGYVCHYMDK 51
           RV +AC  CR +K +C+GK P C  C + G+ C   DK
Sbjct: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDK 123

>ZYRO0G22550g Chr7 complement(1856064..1858238) [2175 bp, 724 aa]
          {ON} weakly similar to uniprot|P39961 Saccharomyces
          cerevisiae YER184C Hypothetical ORF
          Length = 724

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 24/38 (63%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMD 50
          + +V++AC  CR RK +C+G  PC  C+S    C+Y D
Sbjct: 6  KAKVKRACQICRRRKIRCDGYLPCSSCVSLKKECNYHD 43

>Suva_13.468 Chr13 complement(809712..812654,812694..814007) [4257
           bp, 1418 aa] {ON} YMR280C (REAL)
          Length = 1418

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 23/38 (60%), Gaps = 1/38 (2%)

Query: 15  RVRKACVPCRERKRKCNGKSP-CEMCISYGYVCHYMDK 51
           R+ +AC  CR +K +C+GK P C  C + G+ C   DK
Sbjct: 64  RIAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDK 101

>Smik_12.157 Chr12 complement(317470..319404) [1935 bp, 644 aa]
          {ON} YLR098C (REAL)
          Length = 644

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 30/52 (57%), Gaps = 1/52 (1%)

Query: 1  MASSVPNIPSYKRQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMDKD 52
          MA++  N  +  R+R + AC  CR R+RKC+ + PC  CI +   C +  +D
Sbjct: 26 MANNEENNDNVPRKR-KLACQSCRRRRRKCDMEKPCSNCIKFQTDCVFAQQD 76

>TDEL0F02330 Chr6 complement(429974..433234) [3261 bp, 1086 aa]
          {ON} Anc_4.113 YGL013C
          Length = 1086

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 21/36 (58%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHY 48
          R +V +AC  CR RK KC G  PC  C++Y   C +
Sbjct: 13 RSKVSRACENCRRRKIKCTGNQPCNNCVTYQCECIF 48

>AER183C Chr5 complement(975879..978518) [2640 bp, 879 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YOL089C
           (HAL9)
          Length = 879

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 22/36 (61%)

Query: 13  RQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHY 48
           R+RV KAC  CR +K +CNG+ PC  C  +   C Y
Sbjct: 74  RKRVSKACDICRAKKIRCNGEEPCVNCEKFNLGCTY 109

 Score = 32.7 bits (73), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 40/89 (44%), Gaps = 9/89 (10%)

Query: 247 VEHVSAWVLRTIYLRATSRPHVAWLASCVTIHLSEAIGLHQDIDKGEFSMTSGVTLRRTA 306
           V ++ A +L ++YL  +  P   +L     I L + +GLHQ          S + ++  A
Sbjct: 379 VGYMQAIILLSVYLENSPVPQTTYLQLSFAIRLGQTLGLHQ--------RESYMHIKDIA 430

Query: 307 GFNEHTKRLFWCAWSINTILSYDYGRSSV 335
             N      +WC +  + +LS   GR S+
Sbjct: 431 ERNRRLNVWWWC-YRYDKVLSVCTGRPSL 458

>SAKL0H24860g Chr8 complement(2162455..2165370) [2916 bp, 971 aa]
          {ON} conserved hypothetical protein
          Length = 971

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 26/46 (56%), Gaps = 1/46 (2%)

Query: 11 YKRQRVRKACVPCRERKRKCNGKSP-CEMCISYGYVCHYMDKDRSS 55
          +KRQR   +CVPC +RK KC+   P C  C+   + C Y   DR S
Sbjct: 26 HKRQRKILSCVPCHQRKIKCSRDQPACSNCLKNNWDCVYFLNDRIS 71

>Skud_5.331 Chr5 complement(543439..543951) [513 bp, 170 aa] {ON}
          YER184C (REAL)
          Length = 170

 Score = 41.6 bits (96), Expect = 0.001,   Method: Composition-based stats.
 Identities = 19/42 (45%), Positives = 24/42 (57%), Gaps = 2/42 (4%)

Query: 12 KRQ--RVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMDK 51
          +RQ  RV KAC  CR +K KC+ K PC  CI     C Y ++
Sbjct: 8  RRQGSRVSKACERCRRKKVKCDSKKPCFGCIGSQSKCRYKNQ 49

>YBR297W Chr2 (800523..801929) [1407 bp, 468 aa] {ON}
          MAL33MAL-activator protein, part of complex locus MAL3;
          nonfunctional in genomic reference strain S288C
          Length = 468

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 32/61 (52%), Gaps = 2/61 (3%)

Query: 16 VRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMDKDRSSSSSFPVQKLDELPHAPESKP 75
          V+ AC  CR R+ KC+GK PC  CI + + C Y    +   S  P+     L + P++K 
Sbjct: 4  VKYACDYCRVRRVKCDGKKPCSRCIEHNFDCTYQQPLKKRGSK-PIGT-RSLKYIPKAKM 61

Query: 76 F 76
          F
Sbjct: 62 F 62

>SAKL0D07898g Chr4 complement(653332..657066) [3735 bp, 1244 aa]
          {ON} similar to uniprot|P12351 Saccharomyces cerevisiae
          YLR256W HAP1
          Length = 1244

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 33/59 (55%), Gaps = 3/59 (5%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSP-CEMCISYG--YVCHYMDKDRSSSSSFPVQKLDEL 67
          KR RV  +C  CR+RK KC+   P C+ C   G  ++CHYM++  +  +   + K  EL
Sbjct: 8  KRNRVPLSCTICRKRKVKCDKTRPHCQQCSKTGVAHLCHYMEQTWAEEAEKELSKESEL 66

>KLLA0E18129g Chr5 (1613115..1615712) [2598 bp, 865 aa] {ON}
          similar to uniprot|P25502 Saccharomyces cerevisiae
          YKL015W PUT3 Positive regulator of PUT (proline
          utilization) genes zinc-finger transcription factor of
          the Zn(2)-Cys(6) binuclear cluster domain type
          Length = 865

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 27/45 (60%), Gaps = 3/45 (6%)

Query: 12 KRQRVRK---ACVPCRERKRKCNGKSPCEMCISYGYVCHYMDKDR 53
          K+++V++   AC  CR R  KC G +PC  C+  G  C Y++ ++
Sbjct: 35 KKKKVKRSSLACTRCRRRHIKCPGGNPCSKCLKAGVACEYVEPNK 79

>Ecym_8404 Chr8 complement(834988..837645) [2658 bp, 885 aa] {ON}
          similar to Ashbya gossypii ACL058W
          Length = 885

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 27/46 (58%), Gaps = 1/46 (2%)

Query: 11 YKRQRVRKACVPCRERKRKCNGKSP-CEMCISYGYVCHYMDKDRSS 55
          +KRQR    C+PC +RK KC+ + P C+ C+   + C Y   DR S
Sbjct: 29 HKRQRRVLNCMPCHKRKVKCSRERPSCDNCLRNSFECVYFVNDRVS 74

>KLTH0C03762g Chr3 (324666..328286) [3621 bp, 1206 aa] {ON} similar
           to uniprot|P39113 Saccharomyces cerevisiae YMR280C CAT8
           Zinc cluster transcriptional activator
          Length = 1206

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 27/47 (57%), Gaps = 3/47 (6%)

Query: 15  RVRKACVPCRERKRKCNGKSP-CEMCISYGYVCHYMDKDRSSSSSFP 60
           RV +AC  CR +K +C+GK P C  C + G+ C   DK   S  +FP
Sbjct: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDK--LSRRAFP 113

>Kpol_1033.15 s1033 complement(32885..34586,34699..34781) [1785
          bp, 594 aa] {ON} complement(32885..34586,34699..34781)
          [1785 nt, 595 aa]
          Length = 594

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 23/38 (60%)

Query: 19 ACVPCRERKRKCNGKSPCEMCISYGYVCHYMDKDRSSS 56
          AC  CR+R+RKCN + PC  CI +G  C  ++ D   S
Sbjct: 28 ACQGCRKRRRKCNFEVPCSNCIKFGSECVSVNLDLRKS 65

>TBLA0E01900 Chr5 (462299..464821) [2523 bp, 840 aa] {ON} Anc_7.56
           YOR337W
          Length = 840

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 33/60 (55%), Gaps = 2/60 (3%)

Query: 8   IPSYKRQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMDKD--RSSSSSFPVQKLD 65
           +PS    + R AC  CR R++KC+ + PC  C+ Y   C+  ++D  R   SS  V+ L+
Sbjct: 82  LPSTTGVKRRLACSSCRRRRKKCDMQYPCGNCVHYKDSCNINEEDMRRQRHSSTYVKSLE 141

>YMR280C Chr13 complement(827028..831329) [4302 bp, 1433 aa] {ON}
           CAT8Zinc cluster transcriptional activator necessary for
           derepression of a variety of genes under
           non-fermentative growth conditions, active after diauxic
           shift, binds carbon source responsive elements
          Length = 1433

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 23/38 (60%), Gaps = 1/38 (2%)

Query: 15  RVRKACVPCRERKRKCNGKSP-CEMCISYGYVCHYMDK 51
           R+ +AC  CR +K +C+GK P C  C + G+ C   DK
Sbjct: 65  RIAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDK 102

>Skud_13.452 Chr13 complement(800289..804587) [4299 bp, 1432 aa]
           {ON} YMR280C (REAL)
          Length = 1432

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 23/38 (60%), Gaps = 1/38 (2%)

Query: 15  RVRKACVPCRERKRKCNGKSP-CEMCISYGYVCHYMDK 51
           R+ +AC  CR +K +C+GK P C  C + G+ C   DK
Sbjct: 64  RIAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDK 101

>CAGL0L03377g Chr12 complement(384929..388558) [3630 bp, 1209 aa]
          {ON} some similarities with uniprot|P46954
          Saccharomyces cerevisiae YJL089w SIP4 interacts with
          SNF1 protein kinase
          Length = 1209

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 22/39 (56%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMDK 51
          ++R  +AC  CR +K KC+G  PC  C   GY C   DK
Sbjct: 22 KKRHSQACDRCRSKKIKCDGLQPCSNCAKIGYNCVTSDK 60

>Smik_13.493 Chr13 complement(810035..814336) [4302 bp, 1433 aa]
           {ON} YMR280C (REAL)
          Length = 1433

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 23/38 (60%), Gaps = 1/38 (2%)

Query: 15  RVRKACVPCRERKRKCNGKSP-CEMCISYGYVCHYMDK 51
           R+ +AC  CR +K +C+GK P C  C + G+ C   DK
Sbjct: 65  RIAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDK 102

>YMR019W Chr13 (312156..315005) [2850 bp, 949 aa] {ON}  STB4Putative
           transcription factor; contains a Zn(II)2Cys6 zinc finger
           domain characteristic of DNA-binding proteins;
           computational analysis suggests a role in regulation of
           expression of genes encoding transporters; binds Sin3p
           in a two-hybrid assay;
          Length = 949

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 23/36 (63%)

Query: 13  RQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHY 48
           R RV+KAC  C++RK KC+G +PC  C  +   C Y
Sbjct: 80  RLRVQKACELCKKRKVKCDGNNPCLNCSKHQKECRY 115

 Score = 35.4 bits (80), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 28/115 (24%), Positives = 50/115 (43%), Gaps = 25/115 (21%)

Query: 225 EMDVVQYAKGILDDPTFSRIPTVEHVSAWVLRTIYLRATSRPHVAWLASCVTIHLSEAIG 284
           E ++ +YA  I++  TF    + E + +W+L T Y R   R    W A      LS+A+ 
Sbjct: 492 EENLFKYAYLIINTLTFE-WESFELIQSWLLITFYFRTCYRQTACWNA------LSQAV- 543

Query: 285 LHQDIDKGEFSMTSGVTLRRTAGFNEHTK-------RLFWCAWSINTILSYDYGR 332
                     +M +G++L        H+          FWC + ++ ++S+  GR
Sbjct: 544 ----------NMCNGMSLYLNKFPEIHSTYDESKAWHCFWCCFIMDKLISFQMGR 588

>ABL121C Chr2 complement(170782..174639) [3858 bp, 1285 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR280C
           (CAT8)
          Length = 1285

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 27/47 (57%), Gaps = 3/47 (6%)

Query: 15  RVRKACVPCRERKRKCNGKSP-CEMCISYGYVCHYMDKDRSSSSSFP 60
           RV +AC  CR +K +C+GK P C  C + G+ C   DK   S  +FP
Sbjct: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDK--LSRRAFP 117

>KNAG0G02130 Chr7 complement(482333..484231) [1899 bp, 632 aa]
          {ON} 
          Length = 632

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 23/39 (58%)

Query: 17 RKACVPCRERKRKCNGKSPCEMCISYGYVCHYMDKDRSS 55
          R AC+ CR +++KCN KSPC  C   G  C +  +D  S
Sbjct: 18 RLACLHCRHKRKKCNMKSPCSNCQRAGMKCIFTHEDLRS 56

>Kwal_YGOB_0.139 s0 complement(61752..63560,63594..65507) [3723
          bp, 1240 aa] {ON} ANNOTATED BY YGOB -
          Length = 1240

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 33/59 (55%), Gaps = 3/59 (5%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSP-CEMCISYG--YVCHYMDKDRSSSSSFPVQKLDEL 67
          KR RV  +C  CR+RK KC+   P C+ C   G  ++CHYM++  +  +   + K  EL
Sbjct: 8  KRNRVPLSCTICRKRKVKCDKTRPHCQQCSKTGVAHLCHYMEQTWAEEAEKELSKDSEL 66

>Kpol_1059.26 s1059 complement(57391..58653) [1263 bp, 420 aa]
          {ON} complement(57391..58653) [1263 nt, 421 aa]
          Length = 420

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 29/47 (61%), Gaps = 2/47 (4%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCI--SYGYVCHYMDKDRSSS 56
          +R++  KACV CR     CNG+ PCE CI     ++C+Y ++  S+S
Sbjct: 7  ERRKSYKACVFCRRSHLVCNGQRPCERCIKRDISHLCNYEERGNSAS 53

>TDEL0H00790 Chr8 complement(132519..135002) [2484 bp, 827 aa]
          {ON} Anc_1.199 YKR064W
          Length = 827

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 32/62 (51%), Gaps = 2/62 (3%)

Query: 9  PSYKRQRVRKACVPCRERKRKCNGKSPCEMCISYG--YVCHYMDKDRSSSSSFPVQKLDE 66
          P  KR R+   C  CR RK KC+ ++PC  C+  G    C Y+ + +   +S  ++   +
Sbjct: 11 PVRKRNRLTVVCSNCRRRKSKCDRQTPCGNCVRLGDKDTCVYIKEAKGDRNSMDLRITKK 70

Query: 67 LP 68
          LP
Sbjct: 71 LP 72

>Kwal_27.10232 s27 (251015..254644) [3630 bp, 1209 aa] {ON} YMR280C
           (CAT8) - Zinc-cluster protein involved in activating
           gluconeogenic genes; related to Gal4p [contig 39] FULL
          Length = 1209

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 23/38 (60%), Gaps = 1/38 (2%)

Query: 15  RVRKACVPCRERKRKCNGKSP-CEMCISYGYVCHYMDK 51
           RV +AC  CR +K +C+GK P C  C + G+ C   DK
Sbjct: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDK 106

>NDAI0D03540 Chr4 complement(838966..842289) [3324 bp, 1107 aa]
          {ON} 
          Length = 1107

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/34 (52%), Positives = 21/34 (61%)

Query: 15 RVRKACVPCRERKRKCNGKSPCEMCISYGYVCHY 48
          +V KAC  CR+RK KC GK PC  C +Y   C Y
Sbjct: 39 KVSKACDNCRKRKIKCTGKMPCPTCEAYQCPCIY 72

>YLR256W Chr12 (646415..650923) [4509 bp, 1502 aa] {ON}  HAP1Zinc
          finger transcription factor involved in the complex
          regulation of gene expression in response to levels of
          heme and oxygen; the S288C sequence differs from other
          strain backgrounds due to a Ty1 insertion in the
          carboxy terminus
          Length = 1502

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 27/43 (62%), Gaps = 3/43 (6%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSP-CEMCISYG--YVCHYMDK 51
          KR R+  +C  CR+RK KC+   P C+ C   G  ++CHYM++
Sbjct: 56 KRNRIPLSCTICRKRKVKCDKLRPHCQQCTKTGVAHLCHYMEQ 98

>KLTH0H11572g Chr8 complement(989095..992808) [3714 bp, 1237 aa]
          {ON} similar to uniprot|P12351 Saccharomyces cerevisiae
          YLR256W HAP1
          Length = 1237

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 33/59 (55%), Gaps = 3/59 (5%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSP-CEMCISYG--YVCHYMDKDRSSSSSFPVQKLDEL 67
          KR RV  +C  CR+RK KC+   P C+ C   G  ++CHYM++  +  +   + K  EL
Sbjct: 8  KRNRVPLSCTICRKRKVKCDKTRPHCQQCSKTGVAHLCHYMEQTWAEEAEKELSKESEL 66

>NDAI0K00390 Chr11 (84641..89128) [4488 bp, 1495 aa] {ON} Anc_8.845
          Length = 1495

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 23/39 (58%), Gaps = 1/39 (2%)

Query: 14  QRVRKACVPCRERKRKCNGKSP-CEMCISYGYVCHYMDK 51
           +R+ +AC  CR +K +C+GK P C  C   G+ C   DK
Sbjct: 102 KRISQACDRCRSKKTRCDGKRPQCSQCAIVGFECKVSDK 140

>KNAG0I01450 Chr9 (277513..281943) [4431 bp, 1476 aa] {ON} 
          Length = 1476

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 26/43 (60%), Gaps = 3/43 (6%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSP-CEMCISYG--YVCHYMDK 51
          KR R+  +C  CR+RK KC+   P C  C   G  ++CHYM++
Sbjct: 44 KRNRIPLSCTICRKRKVKCDKTRPHCNQCTKTGVAHLCHYMEQ 86

>Ecym_3392 Chr3 (741359..743902) [2544 bp, 847 aa] {ON} similar to
           Ashbya gossypii ACL096W
          Length = 847

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/95 (23%), Positives = 43/95 (45%), Gaps = 2/95 (2%)

Query: 12  KRQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMDKDRSSSSSFPVQKLDELPHAP 71
           +++R   AC+ CR+R  +C G +PC  C+S    C Y++  +    S  ++ L +L H  
Sbjct: 49  RKKRAPLACLRCRKRHVRCPGGNPCSKCVSANIACEYLEPSKKLIVS--MKYLQKLQHDL 106

Query: 72  ESKPFAASNIHGNEVSSVDTQTVTNQSITDPVKSR 106
                   N+       +  Q  ++++  D +  R
Sbjct: 107 AKLKKENVNLQAQLNERISRQDASSKAALDGLNQR 141

>Kwal_0.142 s0 complement(63621..65507) [1887 bp, 629 aa] {OFF}
          YLR256W (HAP1) - zinc-finger transcription factor of
          the Zn(2)-Cys(6) binuclear cluster domain type [contig
          78] PARTIAL
          Length = 629

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 33/59 (55%), Gaps = 3/59 (5%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSP-CEMCISYG--YVCHYMDKDRSSSSSFPVQKLDEL 67
          KR RV  +C  CR+RK KC+   P C+ C   G  ++CHYM++  +  +   + K  EL
Sbjct: 8  KRNRVPLSCTICRKRKVKCDKTRPHCQQCSKTGVAHLCHYMEQTWAEEAEKELSKDSEL 66

>TDEL0D00260 Chr4 complement(44685..46628) [1944 bp, 647 aa] {ON} 
          Length = 647

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 21/32 (65%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCISYG 43
          K +RV KAC  C+ RK++C G+ PC+ C   G
Sbjct: 2  KEKRVSKACDVCKHRKKRCTGELPCDYCTRIG 33

>KLLA0F19602g Chr6 complement(1814949..1816760) [1812 bp, 603 aa]
          {ON} similar to uniprot|P43634 Saccharomyces cerevisiae
          YLR098C CHA4 Zinc-finger protein with Zn[2]-Cys[6]
          fungal- type binuclear cluster domain DNA-binding
          transcriptional activator or CHA1 and some similarities
          to YOR337W uniprot|P47988 Saccharomyces cerevisiae
          YOR337W TEA1 Mutants are defective in Ty1
          Enhancer-mediated Activation Ty1 enhancer activator
          Length = 603

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 27/44 (61%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMDKDRSS 55
          ++++   AC  CR ++RKC+ + PC  C+ YG  C  ++ D+ +
Sbjct: 9  RKRKAHLACQNCRIKRRKCDMERPCSNCLKYGIECITVNNDKRT 52

>Ecym_7235 Chr7 (489574..492405) [2832 bp, 943 aa] {ON} similar to
          Saccharomyces cerevisiae YBL005W
          Length = 943

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 21/34 (61%)

Query: 15 RVRKACVPCRERKRKCNGKSPCEMCISYGYVCHY 48
          ++++AC  CR RK KC G  PC  C++Y   C Y
Sbjct: 11 KIKRACDNCRRRKIKCTGTQPCACCVAYQCGCVY 44

>TBLA0C06230 Chr3 (1509702..1512089) [2388 bp, 795 aa] {ON}
          Anc_6.60 YLR266C
          Length = 795

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 37/69 (53%), Gaps = 8/69 (11%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSP-CEMCISYGYVCHYMDK---DRSSSSSFP----VQK 63
          KR+++ KACV CR+RK KC+   P C+ C S    C Y ++   D S +  F     +Q 
Sbjct: 6  KRRKIIKACVFCRKRKLKCDLTKPKCKQCSSRNLNCIYTNQYNFDLSDAELFANQPNIQL 65

Query: 64 LDELPHAPE 72
          L+E+    E
Sbjct: 66 LNEIAKLKE 74

>CAGL0M03025g Chr13 complement(341849..345613) [3765 bp, 1254 aa]
          {ON} similar to uniprot|P39113 Saccharomyces cerevisiae
          YMR280c CAT8 transcription factor involved in
          gluconeogenesis
          Length = 1254

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 29/53 (54%), Gaps = 6/53 (11%)

Query: 9  PSYKRQRVRKACVPCRERKRKCNGKSP-CEMCISYGYVCHYMDKDRSSSSSFP 60
          P+Y   RV +AC  CR +K KC+GK P C  C   G+ C     DR +  SFP
Sbjct: 52 PTY---RVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKI--SDRLNRKSFP 99

>KAFR0G00570 Chr7 complement(148813..151401) [2589 bp, 862 aa] {ON}
           Anc_1.199 YKR064W
          Length = 862

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 43/97 (44%), Gaps = 6/97 (6%)

Query: 12  KRQRVRKACVPCRERKRKCNGKSPCEMCISYG--YVCHYMDKDRSSSSSFPVQKLDELPH 69
           +R+R    C  CR+RK +C+ + PC  C+  G    C Y +K   ++SS  V    ++  
Sbjct: 10  RRKRGTVVCTNCRKRKSRCDRQLPCNTCMRLGNSETCEYENKLNPNTSSIRVSFAPKIER 69

Query: 70  APESKPFAASNIHGNEVSSVDTQTVTNQSITDPVKSR 106
             +   F  S + G+    V      + S+  P  S+
Sbjct: 70  VKKQDKFIPSTLFGSSSKYVK----VSDSVVQPAPSK 102

>NCAS0D04860 Chr4 (933920..936025) [2106 bp, 701 aa] {ON} 
          Length = 701

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/73 (36%), Positives = 37/73 (50%), Gaps = 4/73 (5%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSP-CEMCISYGYV-CHYMDKDRSSSSSFPVQKL-DELP 68
          KR RV K+C  CR RK KC+   P C  C+ +G   C Y D+   S    PV +L + +P
Sbjct: 18 KRNRVPKSCTVCRLRKSKCDRIKPYCSSCVLHGIKECRYDDR-TISDKRVPVSELANAVP 76

Query: 69 HAPESKPFAASNI 81
             +S    A N+
Sbjct: 77 RISDSSDITACNV 89

>Smik_12.327 Chr12 (590984..595495) [4512 bp, 1503 aa] {ON}
          YLR256W (REAL)
          Length = 1503

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 27/43 (62%), Gaps = 3/43 (6%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSP-CEMCISYG--YVCHYMDK 51
          KR R+  +C  CR+RK KC+   P C+ C   G  ++CHYM++
Sbjct: 55 KRNRIPLSCTICRKRKVKCDKFRPHCQQCTKTGVAHLCHYMEQ 97

>Ecym_2732 Chr2 (1410290..1413886) [3597 bp, 1198 aa] {ON} similar
          to Ashbya gossypii AFR117C
          Length = 1198

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 26/43 (60%), Gaps = 3/43 (6%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSP-CEMCISYGYV--CHYMDK 51
          KR R+  +C  CR+RK +C+   P C  C+  G V  CHYM++
Sbjct: 11 KRNRIPLSCTICRKRKVRCDKTKPHCTQCVKTGVVHLCHYMEQ 53

>ZYRO0D02090g Chr4 complement(167354..169882) [2529 bp, 842 aa]
          {ON} similar to uniprot|P36023 Saccharomyces cerevisiae
          YKR064W Hypothetical ORF
          Length = 842

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 27/48 (56%), Gaps = 2/48 (4%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCISYGY--VCHYMDKDRSSSS 57
          +R R    C  C+ RK KC+ ++PC  C+ +G    CHY+   +++ S
Sbjct: 14 RRNRPTVVCTNCKRRKSKCDRQNPCSNCVRFGNKDTCHYVQNPKNTES 61

>Skud_12.335 Chr12 (592952..597391) [4440 bp, 1479 aa] {ON}
          YLR256W (REAL)
          Length = 1479

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 27/43 (62%), Gaps = 3/43 (6%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSP-CEMCISYG--YVCHYMDK 51
          KR R+  +C  CR+RK KC+   P C+ C   G  ++CHYM++
Sbjct: 57 KRNRIPLSCTICRKRKVKCDKFRPHCQQCTKTGVAHLCHYMEQ 99

>CAGL0M05907g Chr13 (622029..624704) [2676 bp, 891 aa] {ON}
          similar to uniprot|P36023 Saccharomyces cerevisiae
          YKR064w
          Length = 891

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 37/78 (47%), Gaps = 13/78 (16%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCISYG--YVCHYMDKDRSSSSSFPVQKLDELPHA 70
          R+R    CV CR+RK KC+ + PC  CI +G    C Y++         P+ K + +P+ 
Sbjct: 11 RRRPMLVCVNCRKRKSKCDRQLPCSKCIQHGDTDTCTYLN-------DVPIGKKNNVPNT 63

Query: 71 P----ESKPFAASNIHGN 84
                S P    N+H N
Sbjct: 64 QVTPNSSSPSIVINLHQN 81

>Skud_7.627 Chr7 (1048240..1049664) [1425 bp, 474 aa] {ON} YBR297W
          (REAL)
          Length = 474

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 39/79 (49%), Gaps = 4/79 (5%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMDKDR----SSSSSFPVQKLDEL 67
          K+   ++AC  CR R+ KC+GK PC  C+ +   C Y+   R     S  S  ++++ E+
Sbjct: 5  KQTCAKQACDCCRVRRVKCDGKGPCSSCLQHNLDCTYLQPFRKRGPKSIRSRSLRRIAEV 64

Query: 68 PHAPESKPFAASNIHGNEV 86
              E+K   A  +   +V
Sbjct: 65 QMTCENKSVMAGPVTSKKV 83

>Smik_2.438 Chr2 (786437..787846) [1410 bp, 469 aa] {ON} YBR297W
          (REAL)
          Length = 469

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 21/33 (63%)

Query: 16 VRKACVPCRERKRKCNGKSPCEMCISYGYVCHY 48
          V+ AC  CR R+ KC+GK PC  CI + + C Y
Sbjct: 4  VKYACDFCRVRRVKCDGKKPCSRCIQHDFECTY 36

>Suva_10.351 Chr10 (613486..614460) [975 bp, 324 aa] {ON} YLR256W
           (REAL)
          Length = 324

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 34/59 (57%), Gaps = 3/59 (5%)

Query: 12  KRQRVRKACVPCRERKRKCNGKSP-CEMCISYG--YVCHYMDKDRSSSSSFPVQKLDEL 67
           KR R+  +C  CR+RK KC+   P C+ C   G  ++CHYM++  +  +   + K +EL
Sbjct: 57  KRNRIPLSCTICRKRKVKCDKFRPHCQQCTKTGVAHLCHYMEQTWAEEAEKELLKDNEL 115

>Suva_16.25 Chr16 complement(31437..31868) [432 bp, 143 aa] {ON}
          YGR288W (REAL)
          Length = 143

 Score = 40.0 bits (92), Expect = 0.003,   Method: Composition-based stats.
 Identities = 16/38 (42%), Positives = 22/38 (57%)

Query: 16 VRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMDKDR 53
          V++AC  CR R+ KC+GK PC  C+     C Y+   R
Sbjct: 37 VKQACDCCRVRRVKCDGKGPCGRCLQRDLNCTYLQPLR 74

>AGR061C Chr7 complement(831052..832890) [1839 bp, 612 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YLR098C
          (CHA4)
          Length = 612

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 26/39 (66%)

Query: 14 QRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMDKD 52
          ++++ AC  CR+R+RKC+ + PC  C  +G  C  +D+D
Sbjct: 8  KKLKLACQTCRKRRRKCDLQVPCVNCQKFGVECLPVDQD 46

>Kwal_47.17565 s47 (457523..459409) [1887 bp, 628 aa] {ON} [contig
          206] FULL
          Length = 628

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 25/50 (50%), Gaps = 1/50 (2%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYM-DKDRSSSSSFP 60
          KR R  K C  C E K KCN +SPC+ C   G   H +    RS  SS P
Sbjct: 5  KRHRSIKTCKYCYEHKLKCNKQSPCDNCTRLGITSHCVYGFKRSGESSVP 54

>NDAI0B02520 Chr2 complement(631209..633341) [2133 bp, 710 aa]
          {ON} Anc_8.283
          Length = 710

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 25/41 (60%), Gaps = 1/41 (2%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMDKD 52
          K QR + AC  CR+ +RKC+  +PC  CI +   C Y +KD
Sbjct: 38 KSQR-KIACQHCRKIRRKCDMINPCSNCIKFDTTCVYAEKD 77

>Smik_13.183 Chr13 (304049..304060,304064..306787) [2736 bp, 911
          aa] {ON} YMR019W (REAL)
          Length = 911

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 21/36 (58%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHY 48
          R RV+KAC  C+ RK KC+G  PC  C  +   C Y
Sbjct: 39 RLRVQKACEICKRRKVKCDGNRPCLNCSKHKKECRY 74

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 27/115 (23%), Positives = 50/115 (43%), Gaps = 25/115 (21%)

Query: 225 EMDVVQYAKGILDDPTFSRIPTVEHVSAWVLRTIYLRATSRPHVAWLASCVTIHLSEAIG 284
           E  + +YA  I++  TF    + E + +W+L   Y R   R    W A      LS+A+ 
Sbjct: 453 EEKMFKYAYSIINTLTF-EWESFELIQSWLLIAFYFRTCYRQTACWNA------LSQAV- 504

Query: 285 LHQDIDKGEFSMTSGVTLRRT------AGFNEHTK-RLFWCAWSINTILSYDYGR 332
                     +M +G++L         + ++E      FWC + ++ ++S+  GR
Sbjct: 505 ----------NMCNGMSLYLNKFPEIHSSYDESKAWHCFWCCFIMDKLISFQMGR 549

>CAGL0K05841g Chr11 (573144..577262) [4119 bp, 1372 aa] {ON} similar
           to uniprot|P12351 Saccharomyces cerevisiae YLR256w HAP1
           transcription factor
          Length = 1372

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 25/42 (59%), Gaps = 3/42 (7%)

Query: 13  RQRVRKACVPCRERKRKCNGKSP-CEMCISYG--YVCHYMDK 51
           R RV  +C  CR RK KC+   P C  C+  G  ++CHYM++
Sbjct: 64  RNRVPLSCTICRRRKVKCDKSRPNCTQCVKTGVAHLCHYMEQ 105

>Ecym_4286 Chr4 (613587..615470) [1884 bp, 627 aa] {ON} similar to
          Ashbya gossypii AGR061C
          Length = 627

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 25/38 (65%)

Query: 15 RVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMDKD 52
          +++ AC  CR+R+RKC+ + PC  C  +G  C  +D+D
Sbjct: 9  KLKLACQSCRKRRRKCDLQMPCLNCQKFGVECLPIDQD 46

>AFL160C Chr6 complement(130842..132788) [1947 bp, 648 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL248C
           (GAL4)
          Length = 648

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 94/388 (24%), Positives = 151/388 (38%), Gaps = 80/388 (20%)

Query: 13  RQRVRKACVPCRERKRKCNGKSP-CEMCISYGYVCHYMDKDRSSSSSFPVQK--LDELPH 69
           R  V +AC  CR RK KC+   P C  C     VC Y  K R S    P+ +  L E+  
Sbjct: 2   RPPVIQACDSCRRRKMKCSKTFPKCAKCREDNRVCLYSPKIRRS----PLTRAHLTEV-- 55

Query: 70  APESKPFAASNIHGNEVSSVDTQTVTNQSITDPVKSRYTIQHSAVAFPRCLGLE------ 123
             E++      +  N    +D  T+        +K R+  Q   + F R + +       
Sbjct: 56  --ETRLGQMEQLLRNAFVDLDADTL--------LKHRHDPQLREILFGRTVDIGALSRTD 105

Query: 124 --LRSANPP-RLHSFAWH--------CGIRPEENPSSHVLLSE-----LITKEEYY---- 163
             + S  PP R   F W+         G   +++P  H L++E     L+ +   Y    
Sbjct: 106 EYMASPLPPLRQAEFQWYERRDLLTGTGFNMKQSP-LHSLVAEAQQEGLMARPSKYERMQ 164

Query: 164 --------RVSKVYFSVVHPIFDVVDPKQLAKNVEEYWAGNISNFEYGAVIAGVVALGSF 215
                   R  + YF   H ++ VVD  +     E+      +    G ++  V+ALG++
Sbjct: 165 LEEQSTTLRYMQAYFEHFHWLYPVVDEHEFYLLYEDPSTAPDACLWTG-LVNVVLALGAW 223

Query: 216 FLGSIGHPREMDVVQYAKGILDDPTFSR-IPTVEHVSAWVLRTI--YLRATSRPHVAWLA 272
             G+   P    V  Y K   +     R + T + V A  L  +  Y   T   + AW+ 
Sbjct: 224 CAGA---PPAAHVFYYDKA--ESHVLGRMLRTGDRVLAIALLLMAHYNYMTHHRNTAWML 278

Query: 273 SCVTIHLSEAIGLHQDIDKGEFSMTSGVTLR-RTAGFNEHTKRLFWCAWSINTILSYDYG 331
             +   L+ ++GLH+D+         G+  + RT       + L+W  +S  T ++ + G
Sbjct: 279 LGLASQLATSLGLHRDL--------QGLPPKQRTLA-----QILWWGIYSTTTQVALELG 325

Query: 332 RSSVALNRI--TCKPVEETEGSYTIHLV 357
           R S  L RI  T  PV +       HL 
Sbjct: 326 RPS-PLPRIGHTDVPVPDMTNPLYSHLA 352

>Kwal_14.915 s14 (110216..112684) [2469 bp, 822 aa] {ON} YKL015W
           (PUT3) - zinc-finger transcription factor of the
           Zn(2)-Cys(6) binuclear cluster domain type [contig 245]
           FULL
          Length = 822

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 77/372 (20%), Positives = 128/372 (34%), Gaps = 112/372 (30%)

Query: 14  QRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMDKDRSSSSSFP-VQKLD----EL- 67
           +R   ACV CR R  KC+G +PC  C +    C Y++ ++    S   +QKL     EL 
Sbjct: 43  KRSGLACVRCRRRHAKCSGDNPCTTCRAANIACEYLEPNKKLVVSMKYLQKLQSDLAELK 102

Query: 68  --------------PHAP--------------------ESKPFAASNIHGNEVSSVDTQT 93
                         P  P                    +S P AASN+  +E    +   
Sbjct: 103 RENVKLQASVKSMNPQEPTKVTPTKRPPDIKFQRNTVDQSSPLAASNVPEDEEIVPNFTE 162

Query: 94  VTNQSITDPVKSRYTIQHSAVAFPRCLGLELRSANPPRLHSFAWHCGIRPEENPSSHVLL 153
              + +      +Y +  S++      G+E++S  P  L +    C              
Sbjct: 163 RRGRLVASRTGQQYFVGSSSMTL---FGMEIQSLIPQNLTNQKQKC-------------- 205

Query: 154 SELITKEEY--YRVSKVYFSVVHPIFDVVDPKQ------LAKNVEEYWAGN--------I 197
                 EE+    +++   SV  P+ +V+  +       LAKN      GN        +
Sbjct: 206 ------EEFQALEITEDSHSVQEPVDEVLQEEGNAYKIVLAKN-----DGNKDISVNFAL 254

Query: 198 SNFEYGAVIAGVVAL---GSFFLGSIGHPREMDVVQYAKGI-LDDPTFSRIPTVEHVSAW 253
            ++ Y  ++         G F+  + G  +E     Y  G  L+D T   I        W
Sbjct: 255 PSYSYAILLVDTFVTYNDGCFYFFNEGVVKEQLKTIYEGGTALEDHTLQTI--------W 306

Query: 254 VLRTIYLRATSRPHVAWLASCVTIHLSEAIGLHQDIDKGEFSMTSGVTLRRTAGFNEHTK 313
             + + + AT   +               +G   +I+  + S   G  L   +GF E   
Sbjct: 307 FCKVLLIFATGEMY---------------LGTANNINGSKLSSKEGAKL-PGSGFFEQAS 350

Query: 314 RLFWCAWSINTI 325
           R+F C +S   I
Sbjct: 351 RIFSCLFSSGRI 362

>Suva_6.285 Chr6 (499581..501941) [2361 bp, 786 aa] {ON} YJL206C
          (REAL)
          Length = 786

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 22/36 (61%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHY 48
          R R  +AC+ CR+RK +C+G+ PC  C +    C Y
Sbjct: 60 RGRAHRACMACRKRKVRCSGQIPCRFCHTNKLECTY 95

>KNAG0C01160 Chr3 complement(226939..229446) [2508 bp, 835 aa]
          {ON} Anc_1.199 YKR064W
          Length = 835

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 25/47 (53%), Gaps = 2/47 (4%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCISYGYV--CHYMDKDRSSS 56
          KR+R    C  CR RK +C+ + PC  C  +G    C Y+D   SS+
Sbjct: 14 KRKRPTVVCTNCRRRKSRCDRERPCNTCTRFGNADSCVYLDSSPSSN 60

>NCAS0C00390 Chr3 (57333..60827) [3495 bp, 1164 aa] {ON} Anc_8.845
          Length = 1164

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 26/47 (55%), Gaps = 3/47 (6%)

Query: 15  RVRKACVPCRERKRKCNGKSP-CEMCISYGYVCHYMDKDRSSSSSFP 60
           R+ +AC  CR +K +C+GK P C  C   G+ C   DK +    SFP
Sbjct: 76  RIAQACDRCRSKKTRCDGKRPQCSQCAIVGFECKISDKLQ--RKSFP 120

>Kwal_14.778 s14 complement(40408..42405) [1998 bp, 665 aa] {ON}
           YKL015W (PUT3) - zinc-finger transcription factor of the
           Zn(2)-Cys(6) binuclear cluster domain type [contig 245]
           FULL
          Length = 665

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 21/88 (23%), Positives = 40/88 (45%), Gaps = 2/88 (2%)

Query: 18  KACVPCRERKRKCNGKSPCEMC--ISYGYVCHYMDKDRSSSSSFPVQKLDELPHAPESKP 75
           KAC  C++RK+KC+   PCE C  I     C Y  + +S  +    + +  L +  ++  
Sbjct: 3   KACTKCKQRKKKCSKTLPCEYCLKIDQPQGCEYRSRVKSKVAKVTERYISSLKNRIQALE 62

Query: 76  FAASNIHGNEVSSVDTQTVTNQSITDPV 103
              + +  N    +D +     + T+P+
Sbjct: 63  VELAKVSDNNGDDIDLKDTPTAAETNPL 90

>KLTH0E14454g Chr5 complement(1282704..1285412) [2709 bp, 902 aa]
          {ON} some similarities with uniprot|Q12180
          Saccharomyces cerevisiae YOL089C HAL9 Putative
          transcription factor containing a zinc finger;
          overexpression increases salt tolerance through
          increased expression of the ENA1(Na+/Li+ extrusion
          pump) gene while gene disruption decreases both salt
          tolerance and ENA1 expression
          Length = 902

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 20/36 (55%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHY 48
          R+RV KAC  CR +K KC+G  PC  C      C Y
Sbjct: 7  RKRVSKACDACRAKKIKCDGCDPCSNCKKVSQECGY 42

>KLLA0D10153g Chr4 (858016..859983) [1968 bp, 655 aa] {ON} some
          similarities with uniprot|P35995 Saccharomyces
          cerevisiae YKL222C Hypothetical ORF
          Length = 655

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 24/37 (64%), Gaps = 1/37 (2%)

Query: 13 RQRVRKACVPCRERKRKCNGKSP-CEMCISYGYVCHY 48
          R +  ++C+ C+ RK+KC+ K+P C  C+  GY C Y
Sbjct: 5  RNKPTRSCLMCQRRKKKCDRKAPSCSACLKKGYECIY 41

>NCAS0E02310 Chr5 (452368..454524) [2157 bp, 718 aa] {ON} Anc_7.56
          Length = 718

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 23/39 (58%)

Query: 14 QRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMDKD 52
          +R R AC  CR R++KC+   PC  CI  G  C+  ++D
Sbjct: 31 KRKRLACSNCRRRRKKCDLNFPCANCIRLGLNCNVNEED 69

>YER184C Chr5 complement(556296..558680) [2385 bp, 794 aa] {ON}
          Putative zinc cluster protein; deletion confers
          sensitivity to Calcufluor white, and prevents growth on
          glycerol or lactate as sole carbon source
          Length = 794

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 25/48 (52%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMDKDRSSSSSF 59
          ++ RV KAC  C  +K KCN K PC  CI     C Y ++ R    +F
Sbjct: 10 QKSRVTKACDRCHRKKIKCNSKKPCFGCIGSQSKCTYRNQFREPIEAF 57

>TPHA0L00350 Chr12 complement(47367..49946) [2580 bp, 859 aa] {ON}
          
          Length = 859

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 30/67 (44%), Gaps = 7/67 (10%)

Query: 1  MASSVPNIPSYKRQRVRKACVPCRERKRKCN-------GKSPCEMCISYGYVCHYMDKDR 53
          M S      S K +R  +AC  CRERK KCN        K PCE C      C +++  R
Sbjct: 1  MGSKSNRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSR 60

Query: 54 SSSSSFP 60
           S S  P
Sbjct: 61 KSRSLSP 67

>KLLA0C14212g Chr3 complement(1229219..1232341) [3123 bp, 1040 aa]
           {ON} weakly similar to uniprot|P25611 Saccharomyces
           cerevisiae YCR106W RDS1 Regulator of drug sensitivity
           transcriptional regulator
          Length = 1040

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 20/37 (54%)

Query: 12  KRQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHY 48
           KR RV   C  CR RK +C+  +PC  C++    C Y
Sbjct: 67  KRNRVSYVCYACRRRKTRCDRGNPCSKCVALSTECVY 103

>TDEL0C01880 Chr3 (332932..334554) [1623 bp, 540 aa] {ON} Anc_7.360
           YDL170W
          Length = 540

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 43/98 (43%), Gaps = 4/98 (4%)

Query: 13  RQRVRKACVPCRERKRKCNGKSP-CEMCISYGYVCHYMDK--DRSSSSSFPVQKLDELPH 69
           R+  R  CV C+ RK++C+   P C  C   G+ C Y+ K  +R   S +  Q   EL  
Sbjct: 5   RKHSRTGCVTCKVRKKRCSEDRPICNDCDRLGFTCVYLPKTSNRQVLSRYKAQVEQELLG 64

Query: 70  APESKPFAASNIH-GNEVSSVDTQTVTNQSITDPVKSR 106
               +      +    E+ S+      +Q + DP+ S+
Sbjct: 65  KKNHRRVDEDEVALDGEIVSLGEDPYLSQPLADPLMSQ 102

>ADR404C Chr4 complement(1432320..1434947) [2628 bp, 875 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YAL051W
          (OAF1) and YOR363C (PIP2); Tandem gene triplication in
          this genome
          Length = 875

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 33/61 (54%), Gaps = 2/61 (3%)

Query: 9  PSYKRQRVRKACVPCRERKRKCNGKSP-CEMCISYGYVCHY-MDKDRSSSSSFPVQKLDE 66
          P+  ++++   C+PCR+ K KC+   P C  C   G  C Y ++K  +   S  +QKL+ 
Sbjct: 13 PNTHKRKLSYVCIPCRKCKTKCDKLKPTCSRCAELGLYCGYDIEKQLTEDPSDKIQKLEG 72

Query: 67 L 67
          L
Sbjct: 73 L 73

>CAGL0A00583g Chr1 (65286..67226) [1941 bp, 646 aa] {ON} weakly
           similar to uniprot|Q06149 Saccharomyces cerevisiae
           YLR266c
          Length = 646

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 67/292 (22%), Positives = 117/292 (40%), Gaps = 37/292 (12%)

Query: 13  RQRVRKACVPCRERKRKCNGKSPCEMCISYGY----VCHYMDKD----RSSSSSFPVQKL 64
           R+RV K+C  C   K KCN +SPC  C   G     V ++ D D    R S   F V K 
Sbjct: 11  RRRVIKSCQYCYAHKLKCNRESPCLTCQQQGTQDQCVYNFQDNDTLTHRKSLEQFKVLKE 70

Query: 65  DE--LPHAPESKPFAASNIHGNEVSSVDTQTVTNQSITDPVKSRYTIQHSAVAFPRCLGL 122
               L  + + K F     +    SS+ T  +   SI D V     +  +    P     
Sbjct: 71  PRYTLRSSTQYKLFKPKTFYPFFSSSL-TDKLVFSSIYDDV----ALTPNFTRNPITRLN 125

Query: 123 ELRSANPPRLHSFAWHCGIRPEENPSSHVLLSELITKEEYYRVSKVYFSVVHPIFDVVDP 182
           +L   N P   S      I P+        L E +++ + ++ S      + P+  + + 
Sbjct: 126 KLDKQNLP--DSIDDVISILPKS-------LEEALSQLDIFQSS---IHAIIPVLSISES 173

Query: 183 KQLAKNVEEYWAGNISNFEYGAVIAGVVALGSFFLGSIGHPREMDV-VQYAKG---ILDD 238
           +Q   N  E  + +  N     V+ G++   S+   + G   + D+   Y  G   +L  
Sbjct: 174 RQAITNFYEDLSSSQINTTDALVLLGILFCSSYSAIASGIVIDTDICTNYYNGYRFLLHH 233

Query: 239 PTFSRIPTVEHVSAWVLRTIYLRATSRPHVAWLA--SCVTIHLSEAIGLHQD 288
             F R PT+E +  + +    +     P++  +   S + I +++ +GLH++
Sbjct: 234 SDFPRYPTIEALQVFTVVNFVI----DPNMLDMTGHSAMLIRVAQQLGLHKN 281

>Suva_11.299 Chr11 (546739..549408) [2670 bp, 889 aa] {ON} YKR064W
          (REAL)
          Length = 889

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 20/36 (55%)

Query: 8  IPSYKRQRVRKACVPCRERKRKCNGKSPCEMCISYG 43
          I + KR R+   C  C++RK KCN   PC  CI  G
Sbjct: 32 IRTKKRHRITLVCTNCKKRKSKCNRTKPCGTCIRLG 67

>KLLA0C18953g Chr3 (1682246..1684357) [2112 bp, 703 aa] {ON} some
          similarities with uniprot|P25502 Saccharomyces
          cerevisiae YKL015W PUT3 Positive regulator of PUT
          (proline utilization) genes zinc-finger transcription
          factor of the Zn(2)-Cys(6) binuclear cluster domain
          type
          Length = 703

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 20/29 (68%)

Query: 15 RVRKACVPCRERKRKCNGKSPCEMCISYG 43
          + ++AC  C+ RK++C+G  PCE C+  G
Sbjct: 13 KSKRACETCKRRKKRCSGGLPCEYCVKIG 41

>Skud_7.638 Chr7 (1060062..1061483) [1422 bp, 473 aa] {ON} YFL052W
          (REAL)
          Length = 473

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 21/33 (63%)

Query: 17 RKACVPCRERKRKCNGKSPCEMCISYGYVCHYM 49
          ++AC  CR R+ KC+GK PC  C+ +   C Y+
Sbjct: 10 KQACDCCRVRRVKCDGKKPCNRCLQHDLKCTYL 42

>SAKL0A02860g Chr1 complement(259388..261625) [2238 bp, 745 aa] {ON}
           similar to uniprot|P04386 Saccharomyces cerevisiae
           YPL248C GAL4 DNA-binding transcription factor required
           for the activation of the GAL genes in response to
           galactose repressed by Gal80p and activated by Gal3p
          Length = 745

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 41/186 (22%), Positives = 80/186 (43%), Gaps = 26/186 (13%)

Query: 157 ITKEEY-----YRVSK---VYFSVVHPIFDVVDPKQLAKNVEEYWAGNISNFEYGAVIAG 208
           I KE Y     Y  SK    YFS  H  +  +  +      ++    +  +  +  ++  
Sbjct: 189 IVKETYSLSAKYVTSKFIDAYFSQYHTTYPFIHKETFMAQYKDQLRPSSMDI-WQILLNT 247

Query: 209 VVALGSFFLGSIGHPREMDVVQY--AKGILDDPTFSRIPTVEHVSAWVLRTIYLRATSRP 266
           V+ALG + +   G   ++D+  Y  AK  L    F    +V  V A  L + Y++  ++P
Sbjct: 248 VLALGCWCIN--GESSDIDIYYYQNAKSYLSSVVF-ETGSVSLVVALTLLSSYVQKRNKP 304

Query: 267 HVAWLASCVTIHLSEAIGLHQDIDKGEFSMTSGVTLRRTAGFNEHTKRLFWCAWSINTIL 326
           +  W    +   ++ ++GLH +  K E ++             E  +R++W  ++++  +
Sbjct: 305 NSGWNYLGLATRMAISLGLHHEFPKMEETLL------------EQRRRVWWGTYTLDCAV 352

Query: 327 SYDYGR 332
           S  YGR
Sbjct: 353 SITYGR 358

 Score = 34.7 bits (78), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 23/37 (62%), Gaps = 1/37 (2%)

Query: 16 VRKACVPCRERKRKCNGKSP-CEMCISYGYVCHYMDK 51
          V++AC  CR+RK +C+ + P C  C+ + + C Y  K
Sbjct: 5  VQQACDSCRKRKLRCSKELPKCSKCLKHNWECCYSPK 41

>TDEL0B07490 Chr2 complement(1314447..1317044) [2598 bp, 865 aa]
           {ON} Anc_2.654 YKL015W
          Length = 865

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 19/35 (54%)

Query: 19  ACVPCRERKRKCNGKSPCEMCISYGYVCHYMDKDR 53
           ACV CR R  KC G  PC  C S    C Y++ ++
Sbjct: 75  ACVRCRRRHVKCPGGQPCAKCASANIACEYLEPNK 109

>KAFR0C03900 Chr3 (787524..789980) [2457 bp, 818 aa] {ON}
          Anc_2.654 YKL015W
          Length = 818

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 24/42 (57%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMDKDR 53
          K++R + AC+ CR+R  KC   +PC  C+     C Y++  R
Sbjct: 26 KQKRQQIACLECRKRHIKCPNGNPCFKCLKNNLKCEYIEPSR 67

>CAGL0F02519g Chr6 (245120..247618) [2499 bp, 832 aa] {ON} weakly
          similar to uniprot|P39529 Saccharomyces cerevisiae
          YJL206c
          Length = 832

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 23/39 (58%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMD 50
          + QR+ +AC  C++RK KC G +PC+ C      C Y +
Sbjct: 28 RTQRLSRACDLCKKRKTKCQGGNPCQSCRKANIQCIYRE 66

>KLLA0C19228g Chr3 (1713787..1715562) [1776 bp, 591 aa] {ON}
          similar to uniprot|P53749 Saccharomyces cerevisiae
          YNR063W Hypothetical ORF
          Length = 591

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 19/30 (63%)

Query: 19 ACVPCRERKRKCNGKSPCEMCISYGYVCHY 48
          AC+ C++RK+KC+G+ PC  C      C Y
Sbjct: 2  ACLECKKRKQKCDGQKPCRRCTKLNVKCIY 31

>TPHA0N00230 Chr14 (39855..43553) [3699 bp, 1232 aa] {ON} Anc_7.17
          YOR363C
          Length = 1232

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 27/59 (45%), Gaps = 12/59 (20%)

Query: 2  ASSVPNIPSY-----------KRQRVRKACVPCRERKRKCNGKSP-CEMCISYGYVCHY 48
          A + P+ P Y           KR R+   C  CR+ K KC+ K P C  CI +G  C Y
Sbjct: 23 AENTPSEPRYTNDEKLHRIRKKRNRISFVCQHCRKSKTKCDKKQPHCARCIKHGIQCVY 81

>Kpol_1016.20 s1016 (51828..55088) [3261 bp, 1086 aa] {ON}
           (51828..55088) [3261 nt, 1087 aa]
          Length = 1086

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 24/43 (55%), Gaps = 1/43 (2%)

Query: 10  SYKRQRVRKACVPCRERKRKCNGKSP-CEMCISYGYVCHYMDK 51
           ++   R+ +AC  CR +K KC+G  P C  C+   ++C   DK
Sbjct: 88  NFLSNRLSQACDRCRLKKIKCDGLKPNCSQCLKVNFICKTSDK 130

>KAFR0C01320 Chr3 (273213..276233) [3021 bp, 1006 aa] {ON} Anc_3.109
           YOL089C
          Length = 1006

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 23/40 (57%), Gaps = 4/40 (10%)

Query: 13  RQRVRKACVPCRERKRKCN----GKSPCEMCISYGYVCHY 48
           ++RV KAC  CR+RK KC      K+ C+ CI Y   C +
Sbjct: 96  KRRVSKACDHCRKRKIKCGPINPAKNKCDNCIKYSSACTF 135

>KNAG0M00120 Chr13 complement(12320..14965) [2646 bp, 881 aa] {ON}
          
          Length = 881

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 1/40 (2%)

Query: 10 SYKRQRVRKACVPCRERKRKCNGKSP-CEMCISYGYVCHY 48
          S K +R    C+PC+ +K +CN   P C  C   G  CHY
Sbjct: 25 SQKSKRTVSVCIPCKSQKLRCNKARPICSRCQRLGKHCHY 64

>TBLA0E03480 Chr5 (865043..868183) [3141 bp, 1046 aa] {ON} Anc_3.109
           YOL089C
          Length = 1046

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 25/47 (53%), Gaps = 5/47 (10%)

Query: 11  YKRQRVRKACVPCRERKRKCNG----KSPCEMCISYGYVCHYMDKDR 53
           YKR RV KAC  CR RK KC+     K+ C  C+    +C + + D 
Sbjct: 155 YKR-RVVKACYNCRRRKIKCDAIDPSKNKCSNCLKLNKICSFSENDE 200

>KLTH0H02684g Chr8 complement(235527..237776) [2250 bp, 749 aa] {ON}
           weakly similar to uniprot|P04386 Saccharomyces
           cerevisiae YPL248C GAL4 DNA-binding transcription factor
           required for the activation of the GAL genes in response
           to galactose repressed by Gal80p and activated by Gal3p
          Length = 749

 Score = 40.0 bits (92), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 44/196 (22%), Positives = 87/196 (44%), Gaps = 31/196 (15%)

Query: 147 PSSHVLLSELITKEEYYRVSKVYFSVVHPIFDVVD--------PKQLAKNVEEYWAGNIS 198
           PSS   LS L +K+      + YF   H  F +VD         K++    E+ W     
Sbjct: 192 PSSSEDLSILSSKQIMDEYVEAYFGQFHAAFPIVDESYFRLCYAKKIIPTSEKAWQ---- 247

Query: 199 NFEYGAVIAGVVALGSFFLGSIGHPREMDVVQY--AKGILDDPTFSRIPTVEHVSAWVLR 256
                 ++  V+ALGS+ +  +G    +D+  Y  AK  L    F    +   +++ VL 
Sbjct: 248 -----TLLYAVLALGSWSV--VGEDSNIDIEYYKSAKYHLCSSVF-ETGSHSLLASLVLL 299

Query: 257 TIYLRATSRPHVAWLASCVTIHLSEAIGLHQDIDKGEFSMTSGVTLRRTAGFNEHTKRLF 316
           + Y +  ++P+ +W    +   ++ ++GLH+++     +  SG+ +RR         R++
Sbjct: 300 SNYTQKRNKPNTSWNYLGLAASMAISLGLHREMRDSARTDNSGLEIRR---------RMW 350

Query: 317 WCAWSINTILSYDYGR 332
           W  +  +  ++  +GR
Sbjct: 351 WVLYGYDCSMAMTFGR 366

 Score = 35.0 bits (79), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 21/42 (50%), Gaps = 1/42 (2%)

Query: 11 YKRQRVRKACVPCRERKRKCNGKSP-CEMCISYGYVCHYMDK 51
          +      +AC  CR +K KC+ + P C  C  + + CHY  K
Sbjct: 2  FSLDEAEQACDWCRRKKLKCSREHPICSNCFKHNWDCHYSPK 43

>Kwal_47.17681 s47 complement(513119..515683) [2565 bp, 854 aa] {ON}
           [contig 206] FULL
          Length = 854

 Score = 40.0 bits (92), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 40/95 (42%), Gaps = 10/95 (10%)

Query: 12  KRQRVRKACVPCRERKRKC--NGKSPCEMCISYGYVCHYMD--KDRSSSSSFPVQKLDEL 67
           ++ R  +AC  C +RK +C  N + PC  C ++G VC   D  K +    S       + 
Sbjct: 11  RKPRTNRACEVCHDRKVRCDANIRVPCTSCQTFGLVCRLRDVKKVKRGRKSASAAGGADG 70

Query: 68  PHAPE------SKPFAASNIHGNEVSSVDTQTVTN 96
            H PE      + P    +   NE      +TV+N
Sbjct: 71  GHRPEDEGETAANPLGGGDTQENEEEQTVKETVSN 105

>YGR288W Chr7 (1070293..1071714) [1422 bp, 473 aa] {ON}
          MAL13MAL-activator protein, part of complex locus MAL1;
          nonfunctional in genomic reference strain S288C
          Length = 473

 Score = 39.7 bits (91), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 23/42 (54%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMDKDR 53
          K+   ++AC  CR R+ KC+GK PC  C+     C Y+   R
Sbjct: 5  KQTCAKQACDCCRIRRVKCDGKRPCSSCLQNSLDCTYLQPSR 46

>Smik_17.27 Chr17 complement(29476..31542) [2067 bp, 688 aa] {ON}
           YKL222C (REAL)
          Length = 688

 Score = 40.0 bits (92), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 69/328 (21%), Positives = 122/328 (37%), Gaps = 61/328 (18%)

Query: 12  KRQRVRKACVPCRERKRKCNGKSP-CEMCISYGYVCHYM-DKDRSSSSSFPVQKLDELP- 68
           +R +  KAC+ CR +K+KC+   P C  C      C Y+ +K   +S S P   LD  P 
Sbjct: 8   RRNKAIKACLNCRRKKQKCDQARPQCYQCRIRKTECVYLGEKADKNSISIPNSILDTTPF 67

Query: 69  ------------HAPESKPFAASN-IHGNE-----VSSVDTQTVTNQSITDPVKSRYTIQ 110
                        + E+ P   +  I   E           +T+ +      +   +T  
Sbjct: 68  DINHVGSKDNSCKSEEANPLVGTKFIFQKEDKWLACGVTSMRTIFHLHCNSKINGYFTTP 127

Query: 111 HSAVAFPRCLGLELRSANPPRLHSFAWHCGIRPEENPSSHVLLSE----LITKEEYYRVS 166
              +   R     +  A       F W     P    +   L+      L + EE     
Sbjct: 128 WKKLKQER----NIWKAKNNYSSQFDWSLLGEPNILRNGESLIDAVCRVLPSYEEVEMHL 183

Query: 167 KVYFS-VVHPIFDVVDPKQLAKNVEEYWA------------------GNISNFEYGAVIA 207
           + YFS  +H  F++VDPK++ ++   Y+                    +  NF    VI 
Sbjct: 184 QKYFSDTMHKTFEIVDPKKIMQDFRSYFIKGFLDESTGYHSISTFVPADTKNFYRVVVIL 243

Query: 208 GVVALGSFFLGSIGHPREMDVV-QYAKGILDDPTFSRIPTVEHVSAWVLRTIYLRATSRP 266
            ++ + SF+   +  P+E+D   +Y      +  F+    +E +   +L+  YL  T+  
Sbjct: 244 EILRI-SFY---VDIPKELDFFSRYLTSSASEKAFN----LEKLQCVMLKACYLDFTAST 295

Query: 267 HVAWLASCVTIHLSEAI----GLHQDID 290
              +    + I ++ +I    GLH DI+
Sbjct: 296 GGDFSRMNMLIQMACSIAINLGLHTDIE 323

>Skud_15.502 Chr15 (894741..897020) [2280 bp, 759 aa] {ON} YOR337W
           (REAL)
          Length = 759

 Score = 40.0 bits (92), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 21/38 (55%)

Query: 15  RVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMDKD 52
           R R AC  CR R++KC+   PC  C     VC+  D+D
Sbjct: 65  RKRLACTNCRNRRKKCDLGFPCGNCSRLELVCNVNDED 102

>YOR337W Chr15 (954344..956623) [2280 bp, 759 aa] {ON}  TEA1Ty1
           enhancer activator required for full levels of Ty
           enhancer-mediated transcription; C6 zinc cluster
           DNA-binding protein
          Length = 759

 Score = 40.0 bits (92), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 21/38 (55%)

Query: 15  RVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMDKD 52
           R R AC  CR R++KC+   PC  C     VC+  D+D
Sbjct: 65  RKRLACTNCRNRRKKCDLGFPCGNCSRLELVCNVNDED 102

>Suva_8.387 Chr8 (696078..698357) [2280 bp, 759 aa] {ON} YOR337W
           (REAL)
          Length = 759

 Score = 40.0 bits (92), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 21/38 (55%)

Query: 15  RVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMDKD 52
           R R AC  CR R++KC+   PC  C     VC+  D+D
Sbjct: 65  RKRLACTNCRNRRKKCDLGFPCGNCSRLELVCNVNDED 102

>KLLA0C17050g Chr3 (1490472..1493339) [2868 bp, 955 aa] {ON}
          conserved hypothetical protein
          Length = 955

 Score = 40.0 bits (92), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 25/46 (54%), Gaps = 1/46 (2%)

Query: 11 YKRQRVRKACVPCRERKRKCNGKSP-CEMCISYGYVCHYMDKDRSS 55
          +KRQR   +CV C +RK KC+   P CE C   G+ C Y    R S
Sbjct: 37 HKRQRQILSCVACHKRKIKCDRAKPVCESCGKNGWECLYFLNARVS 82

>NDAI0F01220 Chr6 complement(295418..298300) [2883 bp, 960 aa] {ON}
           Anc_6.279
          Length = 960

 Score = 40.0 bits (92), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 44/187 (23%), Positives = 81/187 (43%), Gaps = 32/187 (17%)

Query: 156 LITKEEYYRVSKVYFSVVHP--------IFDVVDPKQLAKNVEEYWAGNISNFEYGAVIA 207
           L ++    R    YF+  HP         F ++   Q+A + +E W           +  
Sbjct: 281 LSSRNTTSRFVDSYFTNFHPYCPIIYSDTFLMIYNNQIASDSKEQWQ---------LLFN 331

Query: 208 GVVALGSFFLGSIGHPREMDVVQY--AKGILDDPTFSRIPTVEHVSAWVLRTIYLRATSR 265
            V+A+G++ L   G   ++D   Y  AK  L    F    ++ +V A+ L + Y++   +
Sbjct: 332 TVLAIGAWCLE--GDSTDIDQFYYNNAKSHLTSQVFES-GSISNVIAFHLLSKYIQWREK 388

Query: 266 PHVAWLASCVTIHLSEAIGLHQDIDKGEFSMTSGVTLRRTAGFNEHTKRLFWCAWSINTI 325
           P+ A+     +I L+ ++GLH+D+         G  L +     E  +R++W  ++    
Sbjct: 389 PNTAFNYHGHSIRLALSLGLHKDLPTAP-----GNELIK-----EQRRRIWWVIYTHEFH 438

Query: 326 LSYDYGR 332
           LS  YGR
Sbjct: 439 LSLSYGR 445

 Score = 35.8 bits (81), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 48/104 (46%), Gaps = 15/104 (14%)

Query: 8   IPSYKRQRVRKACVPCRERKRKCNGKSP-CEMCISYGYVCHYMDKDRSSSSSFP------ 60
           IPS   ++  +AC  CR +K KC+ + P C  C+  G+ C Y  K + S  +        
Sbjct: 2   IPS--TEKSEQACDICRIKKLKCSREKPKCAKCMKNGWECCYSPKAKRSPLTRAHLTRVE 59

Query: 61  --VQKLDELPHA----PESKPFAASNIHGNEVSSVDTQTVTNQS 98
             + KL+ L +A     ES P    +++G  V  +D    T+ S
Sbjct: 60  DKLSKLENLFNALFIGKESTPTNTRSMNGYNVDDIDDTEHTDSS 103

>TPHA0C01080 Chr3 (246019..247794) [1776 bp, 591 aa] {ON} Anc_8.283
           YLR098C
          Length = 591

 Score = 39.7 bits (91), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 76/364 (20%), Positives = 143/364 (39%), Gaps = 55/364 (15%)

Query: 19  ACVPCRERKRKCNGKSPCEMCISYGYVCHYMDKD--RSSSSSFPVQKLDELPHAPESKPF 76
           AC  CR+R+RKCN   PC  CI +   C  +++D  ++  ++  V+ L+E     ES   
Sbjct: 16  ACQNCRKRRRKCNFLIPCSNCIKFQTDCVAVNEDLRKTRYTASYVKSLEEKIAYLESN-L 74

Query: 77  AASNIHGNEV-------SSVDTQTVTNQSITD-PVKSRYTI--QHSAVAFPRCLGLELRS 126
             S+     +       SS+   T ++ S+ + P + +  +  +++ V  P      LRS
Sbjct: 75  TESDTKEKTIDDIKLLNSSISLATASSASLLNVPKRDKKEVKNEYNLVENP------LRS 128

Query: 127 ANPPRLHSFAWHCGIRPEENPSSHVLLSELITKEEYYRVSKVYFSVVHP--IFDVVDPKQ 184
           ++   +HS +        E   +   L  L       R    +F  ++P   F +     
Sbjct: 129 SSIYPMHSLSISKPFTSIEFKQTQTNLKNLTRSTAIMRSLSFFFKWLYPAHYFFIHRETF 188

Query: 185 LAK-----NVEEYWAGNISNFEYGAVIAGVVALGSFFLGSIGHPREMDVVQYAKGI---- 235
           L+      N + Y+      F   A+ A +V       G     R  +  Q +K I    
Sbjct: 189 LSSFFGDTNTKSYYCSEELVFAMSALGAKLVKSDDELYG-----RSTEFYQTSKSIVLKK 243

Query: 236 ---LDDPTF------SRIPTVEHVSAWVLRTIYLRATSRPHVAWLASCVTIHLSEAIGLH 286
              L+D +F      S++  ++ +       I         +AW  S +   ++  IGL 
Sbjct: 244 VFQLEDSSFADSTPSSKLAIIQTLLCLAFYDI---GNGENPMAWYLSGLAFRIAHEIGLQ 300

Query: 287 QDIDKGEFSMTSGVTLRRTAGFN-EHTKRLFWCAWSINTILSYDYGRSSVALNRITCKPV 345
            D D       S V     +  + E   R++W  +  + ++S  +GR++    +++   V
Sbjct: 301 LDPDAW-----SNVYENDLSKIDFEVRSRIYWGCYIADHMISILFGRTTTL--KLSNSTV 353

Query: 346 EETE 349
            ET+
Sbjct: 354 PETD 357

>Kwal_26.6805 s26 (71596..74430) [2835 bp, 944 aa] {ON} YAL051W
           (OAF1) - transcription factor [contig 44] FULL
          Length = 944

 Score = 39.7 bits (91), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 43/104 (41%), Gaps = 21/104 (20%)

Query: 10  SYKRQRVRKACVPCRERKRKCNGKSP-CEMCISYGYVCHYMDKDRSSSSSFPVQK----- 63
           S +R R+   C  CR+ K KC+   P C  C+ +G  C Y D DR +    P +      
Sbjct: 19  SGRRNRLSFVCQSCRKGKTKCDRAKPSCSRCLKHGIRCVY-DVDRQTPPKTPNKDATIAR 77

Query: 64  --------------LDELPHAPESKPFAASNIHGNEVSSVDTQT 93
                         +D +    ++KP    ++ G+  S+ D+ T
Sbjct: 78  LKREVEYWQARALAIDTVTQPGQAKPNVQGDVEGSSTSATDSVT 121

>Smik_15.515 Chr15 (903950..906229) [2280 bp, 759 aa] {ON} YOR337W
           (REAL)
          Length = 759

 Score = 39.7 bits (91), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 21/38 (55%)

Query: 15  RVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMDKD 52
           R R AC  CR R++KC+   PC  C     VC+  D+D
Sbjct: 65  RKRLACTNCRNRRKKCDLGFPCGNCSRLELVCNVNDED 102

>KLTH0C10032g Chr3 complement(830334..832934) [2601 bp, 866 aa]
          {ON} weakly similar to uniprot|Q12180 Saccharomyces
          cerevisiae YOL089C HAL9 Putative transcription factor
          containing a zinc finger overexpression increases salt
          tolerance through increased expression of the ENA1 (Na
          /Li extrusion pump) gene while gene disruption
          decreases both salt tolerance and ENA1 expression
          Length = 866

 Score = 39.7 bits (91), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 32/58 (55%), Gaps = 6/58 (10%)

Query: 1  MASSVPN-IPSYK-RQRVRKACVPCRERKRKCNGKSP----CEMCISYGYVCHYMDKD 52
          MA   P+ + ++K R+RV KAC  CR+RK KC   +P    C+ C  +  VC +   D
Sbjct: 1  MAPESPSELSAFKFRKRVPKACDHCRKRKIKCGAVNPITGTCDNCTKFNTVCTFKHHD 58

>TBLA0F01200 Chr6 (295744..299004) [3261 bp, 1086 aa] {ON} Anc_3.109
           YOL089C
          Length = 1086

 Score = 39.7 bits (91), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 29/52 (55%), Gaps = 4/52 (7%)

Query: 11  YKRQRVRKACVPCRERKRKCNGKSP----CEMCISYGYVCHYMDKDRSSSSS 58
           Y ++R  +AC  CR+RK KC+   P    C  C  +  +C + ++ R ++++
Sbjct: 132 YSKKRATRACESCRKRKIKCDPVDPITNKCSNCTKFHMICVFDNRKRKATNA 183

>TBLA0A04280 Chr1 complement(1059254..1061932) [2679 bp, 892 aa]
          {ON} Anc_7.17 YOR363C
          Length = 892

 Score = 39.7 bits (91), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 24/50 (48%), Gaps = 1/50 (2%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSP-CEMCISYGYVCHYMDKDRSSSSSFP 60
          K+ R  K C+ CR RK KC+ + P C  CI    +C Y      S  S P
Sbjct: 7  KKPRPSKVCLTCRRRKVKCDQQHPSCMRCIKSSTLCTYTYSTPVSDDSLP 56

>Skud_14.399 Chr14 (715444..717267) [1824 bp, 607 aa] {ON} YNR063W
          (REAL)
          Length = 607

 Score = 39.7 bits (91), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 18/28 (64%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCI 40
          ++ V  AC  CR RK KC+G  PCE CI
Sbjct: 9  KKTVSLACTVCRTRKLKCDGNKPCERCI 36

>KLLA0E13993g Chr5 complement(1239566..1241602) [2037 bp, 678 aa]
           {ON} some similarities with uniprot|P07272 Saccharomyces
           cerevisiae YLR014C PPR1 Zinc finger transcription factor
           containing a Zn(2)-Cys(6) binuclear cluster domain
           positively regulates transcription of genes involved in
           uracil biosynthesis activity may be modulated by
           interaction with Tup1p
          Length = 678

 Score = 39.7 bits (91), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 34/66 (51%), Gaps = 7/66 (10%)

Query: 12  KRQRVRKACVPCRERKRKCNGKSP-CEMCISYGYVCHYMDKDRSSSSSFPVQKLDELPHA 70
           +R+    AC  C+ R+++C+G  P C  C++ G  C ++DK   +    P   +D L   
Sbjct: 59  RRKNQGVACCFCKRRRKRCDGGFPQCGACVNAGIQCTFVDK--ITGRELPRDYIDRL--- 113

Query: 71  PESKPF 76
            ESK F
Sbjct: 114 -ESKVF 118

 Score = 31.2 bits (69), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 21/85 (24%), Positives = 35/85 (41%), Gaps = 14/85 (16%)

Query: 270 WLASCVTIHLSEAIGLHQDIDKGEFSMTSGVTLRRTAGFNEHT-----KRLFWCAWSINT 324
           WL + V +  + ++ LH+           G     T G  +H       R+FWCA+SI  
Sbjct: 284 WLLAGVAVRTAVSLDLHR---------KPGSPRSMTHGLEQHVLQNLRSRVFWCAYSIER 334

Query: 325 ILSYDYGRSSVALNRITCKPVEETE 349
           ++    GR     +     P+ E+E
Sbjct: 335 LIGMTVGRPFCISDVDIDAPLPESE 359

>Ecym_8327 Chr8 (663876..665114) [1239 bp, 412 aa] {ON} similar to
          Ashbya gossypii ACR107W
          Length = 412

 Score = 39.3 bits (90), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 25/42 (59%), Gaps = 2/42 (4%)

Query: 8  IPSYKRQRVRKACVPCRERKRKCNGKSPCEMCI--SYGYVCH 47
          +P+ +R++V KACV CR     C+ + PC  CI    G++C 
Sbjct: 11 VPAKRRRKVSKACVFCRRSHMICDDQRPCSRCIKRDIGHLCQ 52

>AGL233C Chr7 complement(260414..263032) [2619 bp, 872 aa] {ON}
          Non-syntenic homolog of Saccharomyces cerevisiae
          YKL222C and YOR172W (YRM1)
          Length = 872

 Score = 39.7 bits (91), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 36/67 (53%), Gaps = 12/67 (17%)

Query: 13 RQRVRKACVPCRERKRKCNGKSP-CEMCISYGYV-CHYMDK------DRSSSSSFP---- 60
          R++V K+CV CR+R+ KCN   P C  CI  G   C Y+ +       R   SS P    
Sbjct: 12 RRKVSKSCVFCRKRRVKCNKARPKCSTCIGKGLPECVYLSEFTHDVNSRELFSSTPNVEL 71

Query: 61 VQKLDEL 67
          ++++DEL
Sbjct: 72 LRRIDEL 78

>Kwal_56.22605 s56 (200072..202669) [2598 bp, 865 aa] {ON} YOL089C
          (HAL9) - 1:1 [contig 184] FULL
          Length = 865

 Score = 39.3 bits (90), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 33/67 (49%), Gaps = 8/67 (11%)

Query: 13 RQRVRKACVPCRERKRKCNGKSP----CEMCISYGYVCHYMDKDRSSSSSFPVQKLDELP 68
          R+RV KAC  CR+RK KC   +P    CE C  +   C +   D  S      +K  +L 
Sbjct: 22 RKRVPKACDHCRKRKIKCGPVNPITGTCENCNKFNTSCTFRHHDEISRH----RKFTDLK 77

Query: 69 HAPESKP 75
           A +++P
Sbjct: 78 RASDNEP 84

>ZYRO0G00308g Chr7 (20674..22623) [1950 bp, 649 aa] {ON} similar
          to gnl|GLV|KLLA0C18953g Kluyveromyces lactis
          KLLA0C18953g and some similarites with YKL015W
          uniprot|P25502 Saccharomyces cerevisiae YKL015W PUT3
          Positive regulator of PUT (proline utilization) genes
          zinc- finger transcription factor of the Zn(2)-Cys(6)
          binuclear cluster domain type
          Length = 649

 Score = 39.3 bits (90), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 20/27 (74%)

Query: 14 QRVRKACVPCRERKRKCNGKSPCEMCI 40
          ++ +KAC  C+ RK++C+G  PCE C+
Sbjct: 4  KKSKKACEICKRRKKRCSGGLPCEYCV 30

>TBLA0G00510 Chr7 (104797..107604) [2808 bp, 935 aa] {ON} Anc_6.60
           YLR266C
          Length = 935

 Score = 39.3 bits (90), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 27/43 (62%), Gaps = 2/43 (4%)

Query: 12  KRQRVRKACVPCRERKRKCNGKSP-CEMCISYGYV-CHYMDKD 52
           KR+ + K C+ CRE+K KC+ + P C  CI+  +  C Y+D +
Sbjct: 74  KRKTIIKTCLFCREKKLKCDKRRPLCSSCIARNFTECVYVDAN 116

>Skud_15.64 Chr15 complement(109746..112844) [3099 bp, 1032 aa] {ON}
           YOL089C (REAL)
          Length = 1032

 Score = 39.3 bits (90), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 40/82 (48%), Gaps = 8/82 (9%)

Query: 13  RQRVRKACVPCRERKRKCNGKSP----CEMCISYGYVCHYMDKDRSSSSSFPVQKLDELP 68
           ++RV KAC  CR+RK +C+   P    C  C+ +  VC +  +D         +KL+   
Sbjct: 129 KKRVSKACDHCRKRKIRCDEVDPQTDKCSNCVKFQSVCTFKHRDEILQKK---RKLEIKQ 185

Query: 69  H-APESKPFAASNIHGNEVSSV 89
           H A E  P + +N+     SS+
Sbjct: 186 HLASEKSPQSQNNVSSYASSSL 207

>TBLA0J00370 Chr10 complement(67871..69286) [1416 bp, 471 aa] {ON}
           Anc_8.642 YPL133C
          Length = 471

 Score = 38.9 bits (89), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 47/91 (51%), Gaps = 7/91 (7%)

Query: 10  SYKRQRVRKACVPCRERKRKCNGKSPCEMCISYG--YVCHYMDKDR--SSSSSFPVQKLD 65
           S+K+++  K+C+ CR     C+G++PC+ CI  G  ++C   D+ +   + +   V    
Sbjct: 13  SHKKRKTGKSCIFCRRSHLVCSGQTPCQRCIRRGISHLCTPNDESQITGTVTRNKVHYAS 72

Query: 66  ELPHAPESKPFAASNIHGNEVSSVDTQTVTN 96
           +LP + +      SN   +E S+ DT   +N
Sbjct: 73  KLPTSRKDNKHRTSN---SEHSTSDTNGTSN 100

>KAFR0E02410 Chr5 (489279..491354) [2076 bp, 691 aa] {ON} Anc_7.56
          YOR337W
          Length = 691

 Score = 39.3 bits (90), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 31/54 (57%), Gaps = 2/54 (3%)

Query: 15 RVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMDKD--RSSSSSFPVQKLDE 66
          + R AC  CR+R++KCN   PC+ C+     C+  ++D  R   ++  V+ L+E
Sbjct: 42 KKRLACNNCRKRRKKCNLAYPCDGCVRLKLKCNINEEDLRRKRYTNAYVKSLEE 95

>KAFR0A06690 Chr1 complement(1354262..1357255) [2994 bp, 997 aa]
          {ON} Anc_4.113 YGL013C
          Length = 997

 Score = 39.3 bits (90), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 24/39 (61%)

Query: 10 SYKRQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHY 48
          S +R++V +AC  CR+RK KC+  +PC  C  Y   C +
Sbjct: 13 SKRRRKVNRACDNCRKRKIKCSETTPCTNCQIYQCKCVF 51

>TPHA0I00860 Chr9 complement(188725..190215) [1491 bp, 496 aa]
          {ON} Anc_1.260 YJL103C
          Length = 496

 Score = 38.9 bits (89), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 28/58 (48%)

Query: 1  MASSVPNIPSYKRQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMDKDRSSSSS 58
          M   + +     R+   KAC  C ++  +C+   PC+ CI     CH  D +R S+SS
Sbjct: 1  MTKKLTDFEKKHRRPTVKACQMCHDKHIQCDKGRPCKNCIKRRTECHCKDIERKSTSS 58

>Smik_1.13 Chr1 (31514..34654) [3141 bp, 1046 aa] {ON} YAL051W
          (REAL)
          Length = 1046

 Score = 39.3 bits (90), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 21/38 (55%), Gaps = 1/38 (2%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSP-CEMCISYGYVCHY 48
          KR R+   C  CR+ K KC+ + P C  CI +G  C Y
Sbjct: 58 KRNRISFVCQACRKSKTKCDREKPECSRCIKHGLKCVY 95

>NCAS0B05110 Chr2 complement(951685..953485,953561..953643) [1884
          bp, 627 aa] {ON} Anc_7.56 YOR337W
          Length = 627

 Score = 38.9 bits (89), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 40/77 (51%), Gaps = 11/77 (14%)

Query: 1  MASSVPNIPSYKR----QRVRK-----ACVPCRERKRKCNGKSPCEMCISYGYVCHYMDK 51
          M +  P I + +R    +R+RK     AC  CR+ +RKC+  SPC  C+ +   C Y   
Sbjct: 1  MDNIYPRIIATQRWQNQKRLRKILKKLACQHCRKIRRKCDTGSPCANCMKFETECVYTGH 60

Query: 52 D--RSSSSSFPVQKLDE 66
          D  ++  S+  V+ L+E
Sbjct: 61 DLRKARYSNSYVKALEE 77

>KNAG0E04150 Chr5 complement(823063..826473) [3411 bp, 1136 aa]
          {ON} 
          Length = 1136

 Score = 39.3 bits (90), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 27/55 (49%), Gaps = 2/55 (3%)

Query: 7  NIPSYKRQRVRKACVPCRERKRKCNGKSP-CEMCISYGYVCHYMDKDRSSSSSFP 60
          NI   KR R+   C  CR+ K KC+ + P C  C+  G  C Y D++R      P
Sbjct: 37 NIQLKKRNRISFVCQNCRKSKMKCDREKPECTRCLKQGIKCVY-DEERQPRPRIP 90

>SAKL0H00660g Chr8 complement(78740..81478) [2739 bp, 912 aa] {ON}
          weakly similar to uniprot|P39720 Saccharomyces
          cerevisiae YAL051W OAF1 Oleate-activated transcription
          factor acts alone and as a heterodimer with Pip2p
          activates genes involved in beta-oxidation of fatty
          acids and peroxisome organization and biogenesis
          Length = 912

 Score = 38.9 bits (89), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 20/39 (51%), Gaps = 1/39 (2%)

Query: 11 YKRQRVRKACVPCRERKRKCNGKSP-CEMCISYGYVCHY 48
          +KR R    C  CR+RK KC+   P C  C+  G  C Y
Sbjct: 9  HKRNRFSFVCTACRKRKSKCDKTKPICNKCLEQGTKCVY 47

>YKR064W Chr11 (562547..565138) [2592 bp, 863 aa] {ON}
          OAF3Putative transcriptional repressor with
          Zn(2)-Cys(6) finger; negatively regulates transcription
          in response to oleate levels, based on mutant phenotype
          and localization to oleate-responsive promoters; the
          authentic, non-tagged protein is detected in highly
          purified mitochondria in high-throughput studies
          Length = 863

 Score = 38.9 bits (89), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 24/51 (47%), Gaps = 2/51 (3%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCISYGYV--CHYMDKDRSSSSSFP 60
          KR R+   C  C++RK KC+   PC  C+  G V  C Y+        S P
Sbjct: 11 KRHRITVVCTNCKKRKSKCDRTKPCGTCVRLGDVDSCVYLTDSSGQPESSP 61

>KNAG0M00620 Chr13 (99320..100699) [1380 bp, 459 aa] {ON}
          Anc_6.154 YBR240C
          Length = 459

 Score = 38.9 bits (89), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 1/47 (2%)

Query: 3  SSVPNIPSYKRQRVRKACVPCRERKRKCNGKSP-CEMCISYGYVCHY 48
          SS  ++    R R    C  CR +KR+CN + P C +C+ +G  C Y
Sbjct: 9  SSTTDMKKASRARTFTGCWACRLKKRRCNLEKPICSLCVRHGDHCSY 55

>Smik_15.67 Chr15 complement(113506..116598) [3093 bp, 1030 aa] {ON}
           YOL089C (REAL)
          Length = 1030

 Score = 38.9 bits (89), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 26/106 (24%), Positives = 48/106 (45%), Gaps = 10/106 (9%)

Query: 13  RQRVRKACVPCRERKRKCNG----KSPCEMCISYGYVCHYMDKDRSSSSSFPVQKLDELP 68
           ++RV KAC  CR+RK +C+        C  C+ +   C +  +D        ++K  +L 
Sbjct: 129 KKRVSKACDHCRKRKIRCDEVDQYTKKCSNCVKFESPCTFKHRDE------ILKKKRKLE 182

Query: 69  HAPESKPFAASNIHGNEVSSVDTQTVTNQSITDPVKSRYTIQHSAV 114
               S P  +     N  +SV +  V N+S  +   S  ++++S +
Sbjct: 183 IKQNSAPDKSPQAQNNVPNSVSSSIVGNKSEFESFNSNVSLENSII 228

>NDAI0C03450 Chr3 (789514..791844) [2331 bp, 776 aa] {ON} Anc_5.59
          Length = 776

 Score = 38.9 bits (89), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 44/189 (23%), Positives = 78/189 (41%), Gaps = 30/189 (15%)

Query: 164 RVSKVYFSVVHPIFDVVDP-------------KQLAKNVEEYWAGNISNFEYGAVIAGVV 210
           R    YF   H +F ++D              + L KN++     NI  F+    I  ++
Sbjct: 329 RFIAAYFKHNHRLFPMIDKIAFLNDVSKISDFESLEKNIDTGSEYNILIFK----IYMIM 384

Query: 211 ALGSFFLGSIG--HPREMDVVQYAKGILDDPTFS---RIPTVEHVSAWVLRTIYLRATSR 265
           A+G   L   G  +  E D+ ++    L    FS   ++  +E V   +L  IY     R
Sbjct: 385 AIGCTTLRRAGMLNVEEEDLSEHL-SYLAMKKFSYVIQLQNIETVRCLLLLGIYSFFEPR 443

Query: 266 PHVAWLASCVTIHLSEAIGLHQDIDKGEFSMTSGVTLRRTAGFNEHTKRLFWCAWSINTI 325
              +W  S + + L+ A+GL++ +   +  + S + +       E   R+FW A+    +
Sbjct: 444 GSSSWTISGLIMRLTIALGLNKALTPKKMKLLSAIEM-------EARNRVFWSAYCFERL 496

Query: 326 LSYDYGRSS 334
           +S   GR S
Sbjct: 497 VSTSLGRFS 505

>KLTH0B00352g Chr2 complement(31952..34756) [2805 bp, 934 aa] {ON}
          weakly similar to uniprot|P25611 Saccharomyces
          cerevisiae YCR106W RDS1 Regulator of drug sensitivity
          transcriptional regulator
          Length = 934

 Score = 38.9 bits (89), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 20/39 (51%), Gaps = 1/39 (2%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSP-CEMCISYGYVCHYM 49
          KR R    C  CR RK KC+ K P C  C+  G  C Y+
Sbjct: 11 KRNRPSFVCQECRRRKIKCDKKRPRCSRCVDTGLPCTYL 49

>ZYRO0E00572g Chr5 (35940..38456) [2517 bp, 838 aa] {ON} similar
          to uniprot|P25502 Saccharomyces cerevisiae YKL015W PUT3
          Positive regulator of PUT (proline utilization) genes
          zinc-finger transcription factor of the Zn(2)-Cys(6)
          binuclear cluster domain type
          Length = 838

 Score = 38.9 bits (89), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 1/54 (1%)

Query: 14 QRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMDKDRSSSSSFP-VQKLDE 66
          +R   ACV CR +  KC G  PC  C +    C Y++ ++  + S   +Q+L E
Sbjct: 36 RRSTLACVRCRRKHVKCPGGDPCSKCSAARIACEYLEPNKKLTVSMKYLQQLQE 89

>ZYRO0G15136g Chr7 complement(1218989..1222072) [3084 bp, 1027 aa]
          {ON} weakly similar to uniprot|P46954 Saccharomyces
          cerevisiae YJL089W SIP4 Possibly involved in Snf1p
          regulated transcriptional activation shows homology to
          DNA binding domain of Gal4p has a leucine zipper motif
          and acidic region lexA-Sip4p activates transcription
          Length = 1027

 Score = 38.9 bits (89), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 25/54 (46%), Gaps = 3/54 (5%)

Query: 8  IPSYKRQRVRKACVPCRERKRKCNGKSP-CEMCISYGYVCHYMDKDRSSSSSFP 60
          I   K+ R  +AC  CR +K KC+G  P C  C    + C     DR +   FP
Sbjct: 26 IAKNKKMRQSQACDRCRLKKIKCDGMKPTCSQCTKVNFTCR--TSDRLTRRGFP 77

>NCAS0C04780 Chr3 (974254..976998) [2745 bp, 914 aa] {ON} 
          Length = 914

 Score = 38.9 bits (89), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 46/107 (42%), Gaps = 28/107 (26%)

Query: 3   SSVPNIP--------SYKRQRVRKACVPCRERKRKCNGKSP----CEMCISYGYVCHY-- 48
           S +PN P        +  ++RV KAC  CR+RK KC+   P    C  C+ Y   C +  
Sbjct: 81  SPIPNQPMVHKPTKITSGKKRVSKACDHCRKRKIKCDKVDPSTGKCSNCLKYNANCTFKR 140

Query: 49  -----MDKDRSSSSSFPVQKLDELPHAPESKPFAASNIHGNEVSSVD 90
                ++  R+S         D+   +  SK FA +N+     S ++
Sbjct: 141 GRDNVLNNRRTS---------DDTTSSALSKGFALNNVMSPSFSGIN 178

>SAKL0H22374g Chr8 (1947498..1949420) [1923 bp, 640 aa] {ON}
           conserved hypothetical protein
          Length = 640

 Score = 38.5 bits (88), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 58/297 (19%), Positives = 117/297 (39%), Gaps = 49/297 (16%)

Query: 12  KRQRVRKACVPCRERKRKCNGKSPCEMC--------ISYGYVCHYMDKDRSSSSSFPVQK 63
           KR+RV K C  C   K KC+   PC  C          YG+     ++ R ++      K
Sbjct: 8   KRRRVIKTCKYCYLHKLKCDKNMPCSTCSRLQVVDQCIYGFQESDENEWRGNNEKGIDGK 67

Query: 64  LDELPHAPESKPFAASNIHGNEVSSVDTQTVTNQSITDPVKSRYTIQHSAVAFPR--CLG 121
              +  + E+  F + +          T T+ N+ +T   K  +T Q  +  F R     
Sbjct: 68  TQRIDLSSEATVFKSRSFF-----PFFTNTINNRLLTS--KDGHTAQLDSTVFKRNQLTN 120

Query: 122 LELRSANPPRLHSFAWHCGIRPEENPSSHVLLSELITKEEYYRVSKVYFSVVHPIFDVVD 181
            +  +  P +L +      + P+   S  +LL              VYF+ VHP+  +++
Sbjct: 121 FDKFTVEPLQLENIF---KLLPDTKTSMLLLLD-------------VYFNQVHPVIPLLN 164

Query: 182 PKQLAKNV-------EEYWAGNISNFEYGAVIAGVVALGSFFLGSIGHPREMDVV-QYAK 233
             +++ ++       EE+   +IS      +I  ++   S+   S G    + +  +Y  
Sbjct: 165 QSKISSSIVRIYDDLEEFRPLDISKL---LLIFAILFSVSYSNMSAGKSSSLTLCKKYYS 221

Query: 234 G---ILDDPTFSRIPTVEHVSAWVLRTIYLRATSRPHVAWLASCVTIHLSEAIGLHQ 287
               ++D   F  +P++E +  + +    +        A   S + + +++ +GLH+
Sbjct: 222 AFSVLMDKFRFPTVPSLESLQGFTIVNFVMDPNMVDATA--HSVMLLKIAQQLGLHK 276

>Suva_15.425 Chr15 (750153..752087) [1935 bp, 644 aa] {ON} YLR098C
          (REAL)
          Length = 644

 Score = 38.5 bits (88), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 14/24 (58%), Positives = 17/24 (70%)

Query: 16 VRKACVPCRERKRKCNGKSPCEMC 39
          V  AC  CR+RKRKC+G+ PC  C
Sbjct: 8  VTLACNTCRKRKRKCDGRKPCYYC 31

>Kwal_34.15751 s34 (40148..42034) [1887 bp, 628 aa] {ON} [contig
          274] FULL
          Length = 628

 Score = 38.5 bits (88), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 23/51 (45%), Gaps = 1/51 (1%)

Query: 9  PSYKRQRVRKACVPCRERKRKCNGKSP-CEMCISYGYVCHYMDKDRSSSSS 58
          P  K+ R+   C  CR RK KCN + P C  C+ +   C Y    R    S
Sbjct: 4  PKSKKNRISHVCDACRIRKLKCNKQKPSCSRCVKHDLQCVYTPYRREGDPS 54

>NDAI0C00260 Chr3 (40019..43144) [3126 bp, 1041 aa] {ON} Anc_2.654
          YKL015W
          Length = 1041

 Score = 38.9 bits (89), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 22/49 (44%), Gaps = 5/49 (10%)

Query: 5  VPNIPSYKRQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMDKDR 53
          VP IP     R   AC+ CR R  KC   +PC  C+     C Y +  R
Sbjct: 30 VPPIP-----RKSNACIQCRRRHVKCPNGNPCLRCVKSKLQCEYSEPSR 73

>Smik_16.15 Chr16 complement(14421..15812) [1392 bp, 463 aa] {ON}
          YBR297W (REAL)
          Length = 463

 Score = 38.5 bits (88), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 20/33 (60%)

Query: 17 RKACVPCRERKRKCNGKSPCEMCISYGYVCHYM 49
          ++AC  CR R+ KC+G  PC  C+ +   C Y+
Sbjct: 5  KQACDCCRVRRVKCDGDKPCNRCLQHDLKCTYL 37

>Kwal_56.24670 s56 complement(1099601..1101532) [1932 bp, 643 aa]
          {ON} YDL170W (UGA3) - zinc-finger transcription factor
          of the Zn(2)-Cys(6) binuclear cluster domain type
          [contig 161] FULL
          Length = 643

 Score = 38.5 bits (88), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 22/39 (56%), Gaps = 1/39 (2%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSP-CEMCISYGYVCHYM 49
          KR   +  C+PC+ RK++C+   P C  C   G+ C Y+
Sbjct: 19 KRTHRKTGCIPCKIRKKRCSEHKPTCTDCERLGFTCVYL 57

>NDAI0E03850 Chr5 (846504..848810) [2307 bp, 768 aa] {ON} Anc_7.56
          Length = 768

 Score = 38.5 bits (88), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 27/48 (56%), Gaps = 4/48 (8%)

Query: 14  QRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMDKD----RSSSS 57
           +R R AC  CR+R++KC+   PC  C+     C+  ++D    R SSS
Sbjct: 53  KRKRLACTNCRKRRKKCDLSYPCASCVRLRIDCNVNEEDLRKKRYSSS 100

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.133    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 56,541,350
Number of extensions: 2317449
Number of successful extensions: 8211
Number of sequences better than 10.0: 639
Number of HSP's gapped: 8395
Number of HSP's successfully gapped: 654
Length of query: 546
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 431
Effective length of database: 40,294,809
Effective search space: 17367062679
Effective search space used: 17367062679
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)