Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_15.560na 1ON51651626430.0
YOR378Wna 1ON51551624590.0
Skud_15.545na 1ON51651624040.0
Suva_8.435na 1ON51551323180.0
KLTH0C10560gna 1ON51550719410.0
Kwal_23.6547na 1ON51150318690.0
KLLA0B00352gna 1ON49849917810.0
TDEL0B005508.843ON5375269411e-121
Kpol_541.168.843ON5285299341e-120
YML116W (ATR1)8.843ON5425229171e-117
SAKL0D01386g8.843ON5214758891e-113
Suva_13.278.843ON5535208871e-112
Skud_13.4518.843ON5395298851e-112
NDAI0E002808.843ON5495208821e-112
Skud_13.258.843ON5375168801e-112
NCAS0A02540singletonON5395248781e-111
TBLA0D03280singletonON5805118791e-111
TPHA0C047908.843ON5564918731e-110
NDAI0K004008.843ON5534578711e-110
Smik_13.188.843ON5454998691e-110
Suva_13.4678.843ON5435258681e-110
KNAG0J002608.843ON5504608641e-109
KAFR0B03930singletonON5555168631e-109
Kwal_27.102458.843ON5155198591e-109
CAGL0B02343g8.843ON5375108471e-107
NCAS0C004008.843ON5175138401e-106
TBLA0D032708.843ON5505238401e-105
Smik_13.4928.843ON5435218391e-105
YMR279C8.843ON5405308391e-105
NCAS0B002908.843ON5425208371e-105
KNAG0G034308.843ON5424768331e-104
KNAG0D00130na 1ON5655248311e-104
KLTH0C03806g8.843ON5255238211e-103
KAFR0B039408.843ON5475237973e-99
KAFR0C04860na 1ON5345237762e-96
KAFR0A028408.843ON5204857483e-92
CAGL0M03003g8.843ON5584987452e-91
CAGL0L02519gna 1ON5294767397e-91
TBLA0C01160singletonON6004807125e-86
NCAS0A05720na 1ON5635296205e-73
NDAI0K02730singletonON6045686157e-72
TDEL0G04950singletonON5124974523e-49
SAKL0C06116gsingletonON1851262101e-18
Skud_6.16na 2ON5494432025e-16
Smik_6.24na 2ON5444421865e-14
SAKL0F00440gsingletonON5444391732e-12
Suva_10.11singletonON5404431722e-12
KLLA0C18931gna 3ON5532171581e-10
KLTH0H16214gsingletonON5515261511e-09
Kwal_34.15746na 3ON5184531411e-08
TDEL0D06610singletonON4974101303e-07
SAKL0C02178gsingletonON5651931295e-07
Skud_13.2442.473ON5621941162e-05
KLTH0G13464g8.272ON5932391143e-05
KLLA0F17776gna 4ON5532211143e-05
Suva_13.2652.473ON5611911134e-05
YMR088C (VBA1)2.473ON5621911116e-05
Smik_13.2722.473ON5611911117e-05
ZYRO0A00330gsingletonON5762501117e-05
NDAI0H022002.473ON5711971118e-05
AGR076C8.272ON6862151063e-04
Kwal_26.6697singletonON5772401036e-04
SAKL0H16808g8.272ON6573991036e-04
KNAG0E025602.473ON5782871037e-04
SAKL0E04246gna 4ON5651961027e-04
TDEL0C00120singletonON5693871010.001
TPHA0G031502.473ON6001891010.001
KLTH0C10120gsingletonON6511571000.002
YKR105C (VBA5)singletonON582262980.002
Kwal_56.237548.272ON589235980.002
NCAS0G029902.242ON581237970.004
YNL065W (AQR1)2.242ON586242960.004
Suva_4.553na 5ON562233950.006
Skud_16.503singletonON543247930.011
KLTH0E16720gsingletonON574306930.011
YBR293W (VBA2)na 5ON474301920.012
SAKL0C05588gsingletonON677143920.013
NCAS0A078102.473ON568202920.014
KLTH0C10142gsingletonON573237920.015
SAKL0E08756g2.242ON565152900.023
Smik_2.434na 5ON474372890.026
KLLA0A04631g8.272ON57950890.029
Skud_2.423na 5ON560489890.031
Ecym_73992.473ON563181880.039
Smik_14.2622.242ON561162880.042
ZYRO0C01430g8.272ON59050880.043
Skud_14.2672.242ON562144870.049
Suva_14.2762.242ON562134870.053
Kpol_543.448.272ON64350870.061
KLLA0E09879gsingletonON630316860.065
ZYRO0G21868gna 6ON620306860.073
YPR198W (SGE1)singletonON543247860.075
TDEL0F039908.272ON631398860.079
TBLA0F030408.272ON906185850.091
SAKL0E08778g2.241ON600234840.12
TPHA0F012902.242ON562132840.13
Kwal_23.48242.242ON553237830.14
Smik_11.368singletonON580262830.15
TDEL0A024902.473ON554188830.16
CAGL0J01375g2.473ON564264830.16
CAGL0J09944g2.242ON592240830.18
SAKL0E02992g2.473ON570272820.19
NDAI0D048404.30ON639136810.25
TBLA0G025502.242ON613151810.25
KAFR0J009302.242ON566142810.30
KLTH0G09372g2.242ON551151800.33
Kwal_33.137131.155ON500114790.48
ZYRO0G21890gsingletonON576225790.50
KLLA0D19941gsingletonON611129790.52
SAKL0A08228gsingletonON569141790.53
KLLA0F03311g2.242ON542220780.60
SAKL0A00726gsingletonON598170780.67
Kwal_26.6686singletonON56988770.76
Suva_12.245na 7ON591116770.77
ABL040W2.473ON567205770.79
NDAI0D010202.242ON592143770.83
NCAS0C03460na 8ON630127760.97
Kpol_1039.192.242ON573143761.2
Ecym_42988.272ON67847761.3
KLLA0F10043gna 9ON528100751.3
TPHA0A017508.272ON63630751.4
ZYRO0G03234g2.473ON562281741.7
SAKL0F07700gna 10ON499126741.7
KLLA0F13684g2.473ON571220741.7
Kpol_478.34.30ON580147741.7
SAKL0D04510gna 11ON531147741.7
Kwal_14.722singletonON61159742.0
TPHA0C048308.858ON598209742.0
Skud_18.3singletonON590207732.4
TBLA0A08510singletonON633149732.8
Kwal_55.19582singletonON56777723.3
Kpol_467.242.473ON370203713.4
TBLA0A08520singletonON632110723.6
Kwal_33.150205.180ON59760713.9
KNAG0G035308.858ON584195714.0
KNAG0I019102.242ON598155714.3
KLTH0E04400gna 10ON490221714.3
TDEL0G03260singletonON612127714.5
TBLA0A014201.451ON572127714.7
KLLA0F04950g7.319ON69564714.7
SAKL0C04708g1.155ON517113704.8
Smik_17.11singletonON54451706.2
Smik_16.81na 8ON625138706.5
SAKL0B12716gsingletonON632176697.1
KLTH0B03894g5.180ON60644697.1
SAKL0F16632gsingletonON615149697.2
TBLA0A10540singletonON493182697.6
SAKL0G13376g5.180ON62149697.8
NDAI0D042204.212ON61681689.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_15.560
         (516 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_15.560 Chr15 (995453..997003) [1551 bp, 516 aa] {ON} YOR378...  1022   0.0  
YOR378W Chr15 (1049511..1051058) [1548 bp, 515 aa] {ON} Putative...   951   0.0  
Skud_15.545 Chr15 (988549..990099) [1551 bp, 516 aa] {ON} YOR378...   930   0.0  
Suva_8.435 Chr8 (786917..788464) [1548 bp, 515 aa] {ON} YOR378W ...   897   0.0  
KLTH0C10560g Chr3 (875216..876763) [1548 bp, 515 aa] {ON} simila...   752   0.0  
Kwal_23.6547 s23 (1635677..1637212) [1536 bp, 511 aa] {ON} YOR37...   724   0.0  
KLLA0B00352g Chr2 (22476..23972) [1497 bp, 498 aa] {ON} highly s...   690   0.0  
TDEL0B00550 Chr2 (105483..107096) [1614 bp, 537 aa] {ON} Anc_8.8...   367   e-121
Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}...   364   e-120
YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidr...   357   e-117
SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON} unipro...   347   e-113
Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W (...   346   e-112
Skud_13.451 Chr13 complement(798006..799625) [1620 bp, 539 aa] {...   345   e-112
NDAI0E00280 Chr5 (37676..39325) [1650 bp, 549 aa] {ON} Anc_8.843      344   e-112
Skud_13.25 Chr13 (37872..39485) [1614 bp, 537 aa] {ON} YML116W (...   343   e-112
NCAS0A02540 Chr1 complement(481807..483426) [1620 bp, 539 aa] {O...   342   e-111
TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {O...   343   e-111
TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa] ...   340   e-110
NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON}               340   e-110
Smik_13.18 Chr13 (34422..36059) [1638 bp, 545 aa] {ON} YML116W (...   339   e-110
Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {...   338   e-110
KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.84...   337   e-109
KAFR0B03930 Chr2 complement(816351..818018) [1668 bp, 555 aa] {O...   337   e-109
Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116...   335   e-109
CAGL0B02343g Chr2 complement(222130..223743) [1614 bp, 537 aa] {...   330   e-107
NCAS0C00400 Chr3 (61257..62810) [1554 bp, 517 aa] {ON} Anc_8.843      328   e-106
TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {O...   328   e-105
Smik_13.492 Chr13 complement(807726..809357) [1632 bp, 543 aa] {...   327   e-105
YMR279C Chr13 complement(824729..826351) [1623 bp, 540 aa] {ON} ...   327   e-105
NCAS0B00290 Chr2 (33760..35388) [1629 bp, 542 aa] {ON} Anc_8.843      327   e-105
KNAG0G03430 Chr7 complement(734828..736456) [1629 bp, 542 aa] {O...   325   e-104
KNAG0D00130 Chr4 complement(6264..7961) [1698 bp, 565 aa] {ON}  ...   324   e-104
KLTH0C03806g Chr3 (332195..333772) [1578 bp, 525 aa] {ON} simila...   320   e-103
KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {O...   311   3e-99
KAFR0C04860 Chr3 (964552..966156) [1605 bp, 534 aa] {ON}  YOR378W     303   2e-96
KAFR0A02840 Chr1 complement(588197..589759) [1563 bp, 520 aa] {O...   292   3e-92
CAGL0M03003g Chr13 complement(337942..339618) [1677 bp, 558 aa] ...   291   2e-91
CAGL0L02519g Chr12 complement(297555..299144) [1590 bp, 529 aa] ...   289   7e-91
TBLA0C01160 Chr3 complement(246034..247836) [1803 bp, 600 aa] {O...   278   5e-86
NCAS0A05720 Chr1 (1117491..1119182) [1692 bp, 563 aa] {ON}            243   5e-73
NDAI0K02730 Chr11 complement(612590..614404) [1815 bp, 604 aa] {...   241   7e-72
TDEL0G04950 Chr7 complement(922428..923966) [1539 bp, 512 aa] {O...   178   3e-49
SAKL0C06116g Chr3 complement(571813..572370) [558 bp, 185 aa] {O...    86   1e-18
Skud_6.16 Chr6 (26284..27933) [1650 bp, 549 aa] {ON} YOR378W (REAL)    82   5e-16
Smik_6.24 Chr6 (39520..41154) [1635 bp, 544 aa] {ON} YMR279C (REAL)    76   5e-14
SAKL0F00440g Chr6 complement(36452..38086) [1635 bp, 544 aa] {ON...    71   2e-12
Suva_10.11 Chr10 (18934..20556) [1623 bp, 540 aa] {ON} YOR378W (...    71   2e-12
KLLA0C18931g Chr3 (1680133..1681794) [1662 bp, 553 aa] {ON} unip...    65   1e-10
KLTH0H16214g Chr8 complement(1398230..1399885) [1656 bp, 551 aa]...    63   1e-09
Kwal_34.15746 s34 (37757..39313) [1557 bp, 518 aa] {ON} YGR224W ...    59   1e-08
TDEL0D06610 Chr4 complement(1195341..1196834) [1494 bp, 497 aa] ...    55   3e-07
SAKL0C02178g Chr3 complement(191542..193239) [1698 bp, 565 aa] {...    54   5e-07
Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {...    49   2e-05
KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]...    49   3e-05
KLLA0F17776g Chr6 complement(1627198..1628859) [1662 bp, 553 aa]...    49   3e-05
Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {...    48   4e-05
YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON} ...    47   6e-05
Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {...    47   7e-05
ZYRO0A00330g Chr1 (19597..21327) [1731 bp, 576 aa] {ON} similar ...    47   7e-05
NDAI0H02200 Chr8 complement(536385..538100) [1716 bp, 571 aa] {O...    47   8e-05
AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON} S...    45   3e-04
Kwal_26.6697 s26 complement(26786..28519) [1734 bp, 577 aa] {ON}...    44   6e-04
SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]...    44   6e-04
KNAG0E02560 Chr5 (506517..508253) [1737 bp, 578 aa] {ON} Anc_2.4...    44   7e-04
SAKL0E04246g Chr5 (336416..338113) [1698 bp, 565 aa] {ON} weakly...    44   7e-04
TDEL0C00120 Chr3 complement(7481..9190) [1710 bp, 569 aa] {ON}         44   0.001
TPHA0G03150 Chr7 (670343..672145) [1803 bp, 600 aa] {ON} Anc_2.4...    44   0.001
KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} simila...    43   0.002
YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON} ...    42   0.002
Kwal_56.23754 s56 complement(690851..692620) [1770 bp, 589 aa] {...    42   0.002
NCAS0G02990 Chr7 complement(549460..551205) [1746 bp, 581 aa] {O...    42   0.004
YNL065W Chr14 (503724..505484) [1761 bp, 586 aa] {ON}  AQR1Plasm...    42   0.004
Suva_4.553 Chr4 (959592..961280) [1689 bp, 562 aa] {ON} YBR293W ...    41   0.006
Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198...    40   0.011
KLTH0E16720g Chr5 (1482846..1484570) [1725 bp, 574 aa] {ON} simi...    40   0.011
YBR293W Chr2 (787006..788430) [1425 bp, 474 aa] {ON}  VBA2Permea...    40   0.012
SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} simila...    40   0.013
NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa] ...    40   0.014
KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} simila...    40   0.015
SAKL0E08756g Chr5 complement(714902..716599) [1698 bp, 565 aa] {...    39   0.023
Smik_2.434 Chr2 (773094..774518) [1425 bp, 474 aa] {ON} YBR293W ...    39   0.026
KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {...    39   0.029
Skud_2.423 Chr2 (756345..758027) [1683 bp, 560 aa] {ON} YBR293W ...    39   0.031
Ecym_7399 Chr7 complement(820280..821971) [1692 bp, 563 aa] {ON}...    39   0.039
Smik_14.262 Chr14 (484135..485820) [1686 bp, 561 aa] {ON} YNL065...    39   0.042
ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {...    39   0.043
Skud_14.267 Chr14 (493984..495672) [1689 bp, 562 aa] {ON} YNL065...    38   0.049
Suva_14.276 Chr14 (502686..504374) [1689 bp, 562 aa] {ON} YNL065...    38   0.053
Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON} (96992..9...    38   0.061
KLLA0E09879g Chr5 complement(874102..875994) [1893 bp, 630 aa] {...    38   0.065
ZYRO0G21868g Chr7 complement(1799212..1801074) [1863 bp, 620 aa]...    38   0.073
YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasm...    38   0.075
TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.2...    38   0.079
TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {O...    37   0.091
SAKL0E08778g Chr5 complement(716961..718763) [1803 bp, 600 aa] {...    37   0.12 
TPHA0F01290 Chr6 complement(294550..296238) [1689 bp, 562 aa] {O...    37   0.13 
Kwal_23.4824 s23 (883258..884919) [1662 bp, 553 aa] {ON} YNL065W...    37   0.14 
Smik_11.368 Chr11 complement(649880..651622) [1743 bp, 580 aa] {...    37   0.15 
TDEL0A02490 Chr1 (446429..448093) [1665 bp, 554 aa] {ON} Anc_2.4...    37   0.16 
CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} simil...    37   0.16 
CAGL0J09944g Chr10 (976274..978052) [1779 bp, 592 aa] {ON} simil...    37   0.18 
SAKL0E02992g Chr5 complement(243652..245364) [1713 bp, 570 aa] {...    36   0.19 
NDAI0D04840 Chr4 complement(1145041..1146960) [1920 bp, 639 aa] ...    36   0.25 
TBLA0G02550 Chr7 complement(668523..670364) [1842 bp, 613 aa] {O...    36   0.25 
KAFR0J00930 Chr10 (168674..170374) [1701 bp, 566 aa] {ON} Anc_2....    36   0.30 
KLTH0G09372g Chr7 (780184..781839) [1656 bp, 551 aa] {ON} simila...    35   0.33 
Kwal_33.13713 s33 (361891..363393) [1503 bp, 500 aa] {ON} YCR028...    35   0.48 
ZYRO0G21890g Chr7 complement(1801391..1803121) [1731 bp, 576 aa]...    35   0.50 
KLLA0D19941g Chr4 complement(1698889..1700724) [1836 bp, 611 aa]...    35   0.52 
SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {...    35   0.53 
KLLA0F03311g Chr6 (311639..313267) [1629 bp, 542 aa] {ON} simila...    35   0.60 
SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar ...    35   0.67 
Kwal_26.6686 s26 complement(23884..25593) [1710 bp, 569 aa] {ON}...    34   0.76 
Suva_12.245 Chr12 (391999..393774) [1776 bp, 591 aa] {ON} YAL067...    34   0.77 
ABL040W Chr2 (321534..323237) [1704 bp, 567 aa] {ON} Syntenic ho...    34   0.79 
NDAI0D01020 Chr4 complement(229357..231135) [1779 bp, 592 aa] {O...    34   0.83 
NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {O...    34   0.97 
Kpol_1039.19 s1039 (63222..64943) [1722 bp, 573 aa] {ON} (63222....    34   1.2  
Ecym_4298 Chr4 complement(636605..638641) [2037 bp, 678 aa] {ON}...    34   1.3  
KLLA0F10043g Chr6 complement(928691..930277) [1587 bp, 528 aa] {...    33   1.3  
TPHA0A01750 Chr1 complement(354061..355971) [1911 bp, 636 aa] {O...    33   1.4  
ZYRO0G03234g Chr7 (247798..249486) [1689 bp, 562 aa] {ON} simila...    33   1.7  
SAKL0F07700g Chr6 complement(588619..590118) [1500 bp, 499 aa] {...    33   1.7  
KLLA0F13684g Chr6 complement(1267367..1269082) [1716 bp, 571 aa]...    33   1.7  
Kpol_478.3 s478 (12238..13980) [1743 bp, 580 aa] {ON} (12238..13...    33   1.7  
SAKL0D04510g Chr4 complement(360010..361605) [1596 bp, 531 aa] {...    33   1.7  
Kwal_14.722 s14 (9019..10854) [1836 bp, 611 aa] {ON} YCL073C - H...    33   2.0  
TPHA0C04830 Chr3 (1043390..1045186) [1797 bp, 598 aa] {ON} Anc_8...    33   2.0  
Skud_18.3 Chr18 complement(10782..12554) [1773 bp, 590 aa] {ON} ...    33   2.4  
TBLA0A08510 Chr1 (2095273..2097174) [1902 bp, 633 aa] {ON}             33   2.8  
Kwal_55.19582 s55 (35002..36705) [1704 bp, 567 aa] {ON} YNR072W ...    32   3.3  
Kpol_467.24 s467 (55523..56632) [1110 bp, 370 aa] {ON} (55523..5...    32   3.4  
TBLA0A08520 Chr1 (2101458..2103356) [1899 bp, 632 aa] {ON}             32   3.6  
Kwal_33.15020 s33 (919334..921127) [1794 bp, 597 aa] {ON} YGR138...    32   3.9  
KNAG0G03530 Chr7 (750723..752477) [1755 bp, 584 aa] {ON} Anc_8.8...    32   4.0  
KNAG0I01910 Chr9 complement(373073..374869) [1797 bp, 598 aa] {O...    32   4.3  
KLTH0E04400g Chr5 (397784..399256) [1473 bp, 490 aa] {ON} weakly...    32   4.3  
TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON}               32   4.5  
TBLA0A01420 Chr1 (333707..335425) [1719 bp, 572 aa] {ON} Anc_1.4...    32   4.7  
KLLA0F04950g Chr6 (486258..488345) [2088 bp, 695 aa] {ON} simila...    32   4.7  
SAKL0C04708g Chr3 (455246..456799) [1554 bp, 517 aa] {ON} simila...    32   4.8  
Smik_17.11 Chr17 complement(8582..10216) [1635 bp, 544 aa] {ON} ...    32   6.2  
Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878...    32   6.5  
SAKL0B12716g Chr2 (1101141..1103039) [1899 bp, 632 aa] {ON} simi...    31   7.1  
KLTH0B03894g Chr2 complement(317072..318892) [1821 bp, 606 aa] {...    31   7.1  
SAKL0F16632g Chr6 complement(1375911..1377758) [1848 bp, 615 aa]...    31   7.2  
TBLA0A10540 Chr1 (2603824..2605305) [1482 bp, 493 aa] {ON}             31   7.6  
SAKL0G13376g Chr7 complement(1147643..1149508) [1866 bp, 621 aa]...    31   7.8  
NDAI0D04220 Chr4 complement(987497..989347) [1851 bp, 616 aa] {O...    31   9.3  

>Smik_15.560 Chr15 (995453..997003) [1551 bp, 516 aa] {ON} YOR378W
           (REAL)
          Length = 516

 Score = 1022 bits (2643), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 505/516 (97%), Positives = 505/516 (97%)

Query: 1   MTLSSPVTEENLDMNVETLKKDDEVLSDEFDVQEEKPESLLWESAFVGVLCSAQLMTQAG 60
           MTLSSPVTEENLDMNVETLKKDDEVLSDEFDVQEEKPESLLWESAFVGVLCSAQLMTQAG
Sbjct: 1   MTLSSPVTEENLDMNVETLKKDDEVLSDEFDVQEEKPESLLWESAFVGVLCSAQLMTQAG 60

Query: 61  LGQSLAPLHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFW 120
           LGQSLAPLHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFW
Sbjct: 61  LGQSLAPLHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFW 120

Query: 121 YALWSLLAGFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSLFGA 180
           YALWSLLAGFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSLFGA
Sbjct: 121 YALWSLLAGFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSLFGA 180

Query: 181 SAPGGFVLGAVFSSMLGQLAWWPWAYWLMGIACFLLAVAGYYLIPHTPMPNRDVASFKLL 240
           SAPGGFVLGAVFSSMLGQLAWWPWAYWLMGIACFLLAVAGYYLIPHTPMPNRDVASFKLL
Sbjct: 181 SAPGGFVLGAVFSSMLGQLAWWPWAYWLMGIACFLLAVAGYYLIPHTPMPNRDVASFKLL 240

Query: 241 ERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTVFLIIFAFIESRXXXXX 300
           ERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTVFLIIFAFIESR     
Sbjct: 241 ERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTVFLIIFAFIESRAAFPL 300

Query: 301 XXXXXXSSDTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAISGFCA 360
                 SSDTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAISGFCA
Sbjct: 301 LPFAALSSDTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAISGFCA 360

Query: 361 ALMTGFLLSHTPPSTVMFFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFP 420
           ALMTGFLLSHTPPSTVMFFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFP
Sbjct: 361 ALMTGFLLSHTPPSTVMFFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFP 420

Query: 421 AATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGANVLKGYRCSWY 480
           AATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGANVLKGYRCSWY
Sbjct: 421 AATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGANVLKGYRCSWY 480

Query: 481 LGIGLSGFGIFVAATYAVSTFMKSKKRVSEKQHFIE 516
           LGIGLSGFGIFVAATYAVSTFMKSKKRVSEKQHFIE
Sbjct: 481 LGIGLSGFGIFVAATYAVSTFMKSKKRVSEKQHFIE 516

>YOR378W Chr15 (1049511..1051058) [1548 bp, 515 aa] {ON} Putative
           paralog of ATR1, but not required for boron tolerance;
           member of the DHA2 family of drug:H+ antiporters;
           YOR378W is not an essential gene
          Length = 515

 Score =  951 bits (2459), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 466/516 (90%), Positives = 487/516 (94%), Gaps = 1/516 (0%)

Query: 1   MTLSSPVTEENLDMNVETLKKDDEVLSDEFDVQEEKPESLLWESAFVGVLCSAQLMTQAG 60
           M+ SS VT++NLD N E LKK+D+VLS EFD+Q+E+P+SLLWESAFVGVLCSAQLMTQAG
Sbjct: 1   MSTSSSVTQKNLDTNAEALKKEDKVLS-EFDIQDERPKSLLWESAFVGVLCSAQLMTQAG 59

Query: 61  LGQSLAPLHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFW 120
           LGQSLAPLHIIG+SFGT N GQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFW
Sbjct: 60  LGQSLAPLHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFW 119

Query: 121 YALWSLLAGFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSLFGA 180
           YALWSLLAGFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSLFGA
Sbjct: 120 YALWSLLAGFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSLFGA 179

Query: 181 SAPGGFVLGAVFSSMLGQLAWWPWAYWLMGIACFLLAVAGYYLIPHTPMPNRDVASFKLL 240
           SAPGGF LGAVFSSMLGQLAWWPWAYW+MGIACF+LAVAGY++IPHTPMP+RD +SFKLL
Sbjct: 180 SAPGGFFLGAVFSSMLGQLAWWPWAYWIMGIACFVLAVAGYFVIPHTPMPSRDASSFKLL 239

Query: 241 ERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTVFLIIFAFIESRXXXXX 300
           ERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGT FL+IFA+IESR     
Sbjct: 240 ERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTFFLVIFAYIESRAAFPL 299

Query: 301 XXXXXXSSDTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAISGFCA 360
                 SSDTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAISGFCA
Sbjct: 300 LPFAALSSDTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAISGFCA 359

Query: 361 ALMTGFLLSHTPPSTVMFFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFP 420
           A+ TGFLLSHTPPSTVM FAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFP
Sbjct: 360 AVTTGFLLSHTPPSTVMLFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFP 419

Query: 421 AATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGANVLKGYRCSWY 480
           AATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIES VNDGGA  LKGYRCSWY
Sbjct: 420 AATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESRVNDGGAKPLKGYRCSWY 479

Query: 481 LGIGLSGFGIFVAATYAVSTFMKSKKRVSEKQHFIE 516
           +GIGLSG GIFVAATYA STFMKSKKR+SEKQHFIE
Sbjct: 480 MGIGLSGLGIFVAATYAWSTFMKSKKRISEKQHFIE 515

>Skud_15.545 Chr15 (988549..990099) [1551 bp, 516 aa] {ON} YOR378W
           (REAL)
          Length = 516

 Score =  930 bits (2404), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/516 (87%), Positives = 476/516 (92%)

Query: 1   MTLSSPVTEENLDMNVETLKKDDEVLSDEFDVQEEKPESLLWESAFVGVLCSAQLMTQAG 60
           M++SSPV +++ D N  TLKKDDEV+ DEFD+Q+E P SLLWE+AFVGVLCSAQLMTQAG
Sbjct: 1   MSISSPVMQKDFDTNTGTLKKDDEVVLDEFDIQDETPGSLLWETAFVGVLCSAQLMTQAG 60

Query: 61  LGQSLAPLHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFW 120
           LGQSLAPLHIIG SFGT NPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFW
Sbjct: 61  LGQSLAPLHIIGKSFGTTNPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFW 120

Query: 121 YALWSLLAGFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSLFGA 180
           YALWSLLAGFSVYSN+IFFDCCRAFQGMGPAFLLPNAIAILGRTYK G+RKNMVFSLFGA
Sbjct: 121 YALWSLLAGFSVYSNKIFFDCCRAFQGMGPAFLLPNAIAILGRTYKSGKRKNMVFSLFGA 180

Query: 181 SAPGGFVLGAVFSSMLGQLAWWPWAYWLMGIACFLLAVAGYYLIPHTPMPNRDVASFKLL 240
            APGGFVLGAVFSS+LGQLAWWPWAYW+MGIACF LA+AGY++IPHT MP+R  +SFKLL
Sbjct: 181 CAPGGFVLGAVFSSLLGQLAWWPWAYWIMGIACFFLAIAGYFIIPHTAMPSRHASSFKLL 240

Query: 241 ERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTVFLIIFAFIESRXXXXX 300
           ER+DFAGSVTGV+GLILFNFAWNQGPVVGWQTPYTY LLIVGTVFL IFAFIESR     
Sbjct: 241 ERVDFAGSVTGVIGLILFNFAWNQGPVVGWQTPYTYILLIVGTVFLAIFAFIESRAAFPL 300

Query: 301 XXXXXXSSDTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAISGFCA 360
                 SSDTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVA+SGFCA
Sbjct: 301 LPFAALSSDTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAVSGFCA 360

Query: 361 ALMTGFLLSHTPPSTVMFFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFP 420
           AL TG+LLS TPPSTVM FAMTAFT GTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFP
Sbjct: 361 ALTTGYLLSRTPPSTVMLFAMTAFTAGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFP 420

Query: 421 AATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGANVLKGYRCSWY 480
           AATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGA  LKGYRCSWY
Sbjct: 421 AATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGAKPLKGYRCSWY 480

Query: 481 LGIGLSGFGIFVAATYAVSTFMKSKKRVSEKQHFIE 516
           +GIGLSG GIFVAA YA STF KSKKR SEKQHFIE
Sbjct: 481 MGIGLSGLGIFVAAIYAWSTFKKSKKRTSEKQHFIE 516

>Suva_8.435 Chr8 (786917..788464) [1548 bp, 515 aa] {ON} YOR378W
           (REAL)
          Length = 515

 Score =  897 bits (2318), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/513 (84%), Positives = 468/513 (91%)

Query: 1   MTLSSPVTEENLDMNVETLKKDDEVLSDEFDVQEEKPESLLWESAFVGVLCSAQLMTQAG 60
           M     VT++NL+ + ET K DDEVL ++F++Q+E P SL+WE+AFVGVLCSAQLMTQAG
Sbjct: 1   MPRRPSVTQKNLETSAETTKTDDEVLLNQFELQDETPGSLVWEAAFVGVLCSAQLMTQAG 60

Query: 61  LGQSLAPLHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFW 120
           LGQS+APLHIIGDSFGT NPGQLSWFAS+YSLTVGTFILIAGRLGDIFGH+KFF+LGFFW
Sbjct: 61  LGQSIAPLHIIGDSFGTTNPGQLSWFASSYSLTVGTFILIAGRLGDIFGHRKFFILGFFW 120

Query: 121 YALWSLLAGFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSLFGA 180
           YALWSLLAGFSVYSN+IFFDCCRAFQGMGPAFLLPNAIAILGRTYKPG+RKNMVFSLFGA
Sbjct: 121 YALWSLLAGFSVYSNKIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGKRKNMVFSLFGA 180

Query: 181 SAPGGFVLGAVFSSMLGQLAWWPWAYWLMGIACFLLAVAGYYLIPHTPMPNRDVASFKLL 240
           SAPGGFVLGAVFSSMLGQLAWWPWAYW+MGIACFLLAVAGY++IPH  MP+RD  SF +L
Sbjct: 181 SAPGGFVLGAVFSSMLGQLAWWPWAYWIMGIACFLLAVAGYFVIPHVQMPSRDSPSFNML 240

Query: 241 ERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTVFLIIFAFIESRXXXXX 300
           ER+DFAGSVTGV+GLILFNFAWNQGPVVGW+TPYTY LLIVGTVFL +F FIESR     
Sbjct: 241 ERVDFAGSVTGVIGLILFNFAWNQGPVVGWETPYTYVLLIVGTVFLGVFVFIESRAAYPL 300

Query: 301 XXXXXXSSDTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAISGFCA 360
                 SSD AFVL CIAAGW+SFGIWIFYTWQFME+SR Q+PLLSSAQF+PVAISGFCA
Sbjct: 301 LPFAALSSDAAFVLGCIAAGWSSFGIWIFYTWQFMEESRKQSPLLSSAQFAPVAISGFCA 360

Query: 361 ALMTGFLLSHTPPSTVMFFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFP 420
           A+ TGFLLSHTP STVM FAMTAFTVG ILIATAPVHQTYWAQTFVSIIVMPWGMDMSFP
Sbjct: 361 AVTTGFLLSHTPASTVMLFAMTAFTVGIILIATAPVHQTYWAQTFVSIIVMPWGMDMSFP 420

Query: 421 AATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGANVLKGYRCSWY 480
           AATIMLS+SMPHEHQGLAASLVNTVVNYSISIGLGIAGTIES VNDGGAN LKGYRCSWY
Sbjct: 421 AATIMLSNSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESQVNDGGANALKGYRCSWY 480

Query: 481 LGIGLSGFGIFVAATYAVSTFMKSKKRVSEKQH 513
           +GIGLSG GIFVAA YA STF+KSKK+ SEKQ+
Sbjct: 481 MGIGLSGLGIFVAAVYASSTFLKSKKKASEKQY 513

>KLTH0C10560g Chr3 (875216..876763) [1548 bp, 515 aa] {ON} similar
           to uniprot|Q08902 Saccharomyces cerevisiae YOR378W
           Hypothetical ORF
          Length = 515

 Score =  752 bits (1941), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/507 (72%), Positives = 412/507 (81%), Gaps = 5/507 (0%)

Query: 9   EENLD----MNVETLKKDDEVLSDEFDVQEEKPESLLWESAFVGVLCSAQLMTQAGLGQS 64
           EEN      +  E+     + LS       +KPESLL E+AFVGV+C AQLMTQAGLGQS
Sbjct: 7   EENQKKDDGLTRESTHDQGQELSQPHHNGIQKPESLLGEAAFVGVICGAQLMTQAGLGQS 66

Query: 65  LAPLHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALW 124
           +APLHIIGDSFGT NPGQLSWFA+AYSLTVGTFILIAGRLGD++GHKKFF++GFFWYALW
Sbjct: 67  IAPLHIIGDSFGTRNPGQLSWFAAAYSLTVGTFILIAGRLGDVYGHKKFFIIGFFWYALW 126

Query: 125 SLLAGFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSLFGASAPG 184
           SLLAGFSVYSNQIFFDCCRAFQG+GPA LLPNAIAILGRTY PGRRK M+ SLFGA+AP 
Sbjct: 127 SLLAGFSVYSNQIFFDCCRAFQGIGPALLLPNAIAILGRTYVPGRRKAMILSLFGATAPA 186

Query: 185 GFVLGAVFSSMLGQLAWWPWAYWLMGIACFLLAVAGYYLIPHTPMPNRDVASFKLLERID 244
           GFVLGAVFSS+ GQL WWPWAYW MGI CF LAVAG  +IP  P+P  D  S    +R+D
Sbjct: 187 GFVLGAVFSSIFGQLTWWPWAYWAMGIVCFFLAVAGILVIPRMPLPELDT-SVSTYQRLD 245

Query: 245 FAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTVFLIIFAFIESRXXXXXXXXX 304
             GSVTGV+GL+L NFAWNQGPVVGWQTPYTY+LLIV  VFL +FAFIESR         
Sbjct: 246 IPGSVTGVIGLVLLNFAWNQGPVVGWQTPYTYSLLIVSAVFLCVFAFIESRAPHPLLPLS 305

Query: 305 XXSSDTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAISGFCAALMT 364
             SSD AFVL C+ AGW+SFGIWI+Y W F+E+ RG +PLL+SAQF+PVAISG CAAL T
Sbjct: 306 ALSSDAAFVLGCVGAGWSSFGIWIYYFWLFLEELRGHSPLLTSAQFAPVAISGLCAALTT 365

Query: 365 GFLLSHTPPSTVMFFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFPAATI 424
           GF+++    S VM FAMTAFTVG ILIATAPV Q YWAQ FVSIIVMPWGMDMSFPAATI
Sbjct: 366 GFVITRVRASLVMLFAMTAFTVGGILIATAPVKQVYWAQAFVSIIVMPWGMDMSFPAATI 425

Query: 425 MLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGANVLKGYRCSWYLGIG 484
           MLSDSMPHEHQGLAASLVN VVNYSISIGLG+AGT+E  VN+GGAN+LKGYR +WY+GIG
Sbjct: 426 MLSDSMPHEHQGLAASLVNVVVNYSISIGLGLAGTVEGRVNNGGANLLKGYRGAWYMGIG 485

Query: 485 LSGFGIFVAATYAVSTFMKSKKRVSEK 511
           LSGFGI +A  Y   TF KSKK  SEK
Sbjct: 486 LSGFGILIAFMYEYHTFKKSKKMPSEK 512

>Kwal_23.6547 s23 (1635677..1637212) [1536 bp, 511 aa] {ON} YOR378W
           - Hypothetical ORF [contig 358] FULL
          Length = 511

 Score =  724 bits (1869), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/503 (69%), Positives = 412/503 (81%), Gaps = 2/503 (0%)

Query: 10  ENLDMNVETLKKDDEVLSDEFDVQEEKPESLLWESAFVGVLCSAQLMTQAGLGQSLAPLH 69
           E+L+     LK ++           EKP+SL+ E+ FVG+L  AQLMTQAGL QS+AP+ 
Sbjct: 6   ESLEAQFVELKNEEGESLQLVQSHVEKPQSLMREALFVGILSCAQLMTQAGLAQSIAPVR 65

Query: 70  IIGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAG 129
           IIG+SFG +NPGQLSWF++AYSLTVGTFILIAGRLGD+FGHKK FV+GF WY+LWSLLAG
Sbjct: 66  IIGNSFGISNPGQLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSLLAG 125

Query: 130 FSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSLFGASAPGGFVLG 189
           FSVYSNQIFFDCCRA QG+GPAFLLPN+IAILGRTY PG+RK MVFS+FGA+APGGFVLG
Sbjct: 126 FSVYSNQIFFDCCRALQGIGPAFLLPNSIAILGRTYTPGKRKQMVFSIFGATAPGGFVLG 185

Query: 190 AVFSSMLGQLAWWPWAYWLMGIACFLLAVAGYYLIPHTPMPNRDVASFKLLERIDFAGSV 249
           +VFSS+  QLAWWPWAYW MG AC +L VAG  +IP  P P  D+++  +LERID AG+ 
Sbjct: 186 SVFSSIFSQLAWWPWAYWAMGTACLVLGVAGIIVIPQAPPPKIDISA-GILERIDAAGAT 244

Query: 250 TGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTVFLIIFAFIESRXXXXXXXXXXXSSD 309
           TG++GL L NFAWNQGPVVGWQTPYTYALLIVG VFL++F+ IESR           S+D
Sbjct: 245 TGILGLALVNFAWNQGPVVGWQTPYTYALLIVGFVFLLVFSLIESRARFPLLPFAALSTD 304

Query: 310 TAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAISGFCAALMTGFLLS 369
            A+VL CIAAGW+SFGIWIFY WQF+EDSR Q+PLL+SAQF PVAISG CAAL TG++LS
Sbjct: 305 LAYVLGCIAAGWSSFGIWIFYFWQFLEDSRSQSPLLTSAQFVPVAISGLCAALTTGYILS 364

Query: 370 HTPPSTVMFFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDS 429
           H P   VM  AM AFTVG +L+ATAP++QTYWAQTFVS+I+MPWGMDMSFPAATIM+S++
Sbjct: 365 HVPACAVMLIAMIAFTVGGVLVATAPINQTYWAQTFVSLIIMPWGMDMSFPAATIMISNA 424

Query: 430 MPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGANVLKGYRCSWYLGIGLSGFG 489
           MPHEHQGLAASLVNTVVNYSIS+ LG AGTIE+ VN+ GAN L+GYR +WY+GIGLSG G
Sbjct: 425 MPHEHQGLAASLVNTVVNYSISLALGFAGTIETRVNNKGANRLEGYRGAWYMGIGLSGLG 484

Query: 490 IFVAATYAVSTFMKSK-KRVSEK 511
           + VA  YA ST  K K +++SEK
Sbjct: 485 VLVAIVYAWSTLKKFKEEQLSEK 507

>KLLA0B00352g Chr2 (22476..23972) [1497 bp, 498 aa] {ON} highly
           similar to uniprot|Q08902 Saccharomyces cerevisiae
           YOR378W
          Length = 498

 Score =  690 bits (1781), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/499 (69%), Positives = 401/499 (80%), Gaps = 4/499 (0%)

Query: 14  MNVETLKKDDEVLSDEFDVQEEKP-ESLLWESAFVGVLCSAQLMTQAGLGQSLAPLHIIG 72
           M+ + L   +E   D   +Q  +   SLL E   + VLCSAQLMTQAGL QS+ PL IIG
Sbjct: 1   MSSKKLNSHEE--QDSLLLQNSREWTSLLKEGFAIMVLCSAQLMTQAGLAQSIVPLQIIG 58

Query: 73  DSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSV 132
           DSFG  NPGQLSWFASA+SLTVGTFILIAGRLGD FGHKKFFV+GF WYALWS+LAGFSV
Sbjct: 59  DSFGIKNPGQLSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGFSV 118

Query: 133 YSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSLFGASAPGGFVLGAVF 192
           YSNQIFFDCCRAFQG+GPAF LPNAIAI+ RTY+PGR++NM+FSLFGA AP GFV+GAVF
Sbjct: 119 YSNQIFFDCCRAFQGIGPAFTLPNAIAIIARTYRPGRKQNMIFSLFGACAPSGFVVGAVF 178

Query: 193 SSMLGQLAWWPWAYWLMGIACFLLAVAGYYLIPHTPMPNRDVASFKLLERIDFAGSVTGV 252
           SS+L + AWWPWAYW+MGI CFLL VAGY +IPH P P        L+ERID AGSVTGV
Sbjct: 179 SSLLSEFAWWPWAYWIMGITCFLLGVAGYLVIPHHP-PIHPDEKCSLVERIDVAGSVTGV 237

Query: 253 VGLILFNFAWNQGPVVGWQTPYTYALLIVGTVFLIIFAFIESRXXXXXXXXXXXSSDTAF 312
           VGLILFNFAWNQGPVVGW+T YTYALLIVG+ FL  F FIESR           SSDT F
Sbjct: 238 VGLILFNFAWNQGPVVGWETSYTYALLIVGSAFLAAFGFIESRAKHPLLPVRKLSSDTIF 297

Query: 313 VLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAISGFCAALMTGFLLSHTP 372
           V+ CIAAGW+SFGIW++YTWQ M + R Q PLLSSAQF PVAISG CAA+ T FLL+ T 
Sbjct: 298 VMGCIAAGWSSFGIWVYYTWQLMANLRDQPPLLSSAQFVPVAISGLCAAMSTEFLLTRTS 357

Query: 373 PSTVMFFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPH 432
           PSTVM  AM AFTVG+IL+AT PV QTYWAQTFVSIIVMPWGMDMSFPAATI+LS +MP 
Sbjct: 358 PSTVMIIAMIAFTVGSILVATVPVSQTYWAQTFVSIIVMPWGMDMSFPAATIILSTAMPA 417

Query: 433 EHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGANVLKGYRCSWYLGIGLSGFGIFV 492
            HQGLAASLVNT++NYSISIGLG AGTIES ++DG  ++LKGYR ++Y+GIGL+G G+ V
Sbjct: 418 SHQGLAASLVNTIINYSISIGLGFAGTIESQISDGEDDLLKGYRGAYYMGIGLAGLGLGV 477

Query: 493 AATYAVSTFMKSKKRVSEK 511
           A +YA+  + + K+ +SEK
Sbjct: 478 AISYAIFHYSRLKRSLSEK 496

>TDEL0B00550 Chr2 (105483..107096) [1614 bp, 537 aa] {ON} Anc_8.843
           YMR279C
          Length = 537

 Score =  367 bits (941), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 208/526 (39%), Positives = 313/526 (59%), Gaps = 31/526 (5%)

Query: 9   EENLDMNVETLKKDDEVLSDEFD--VQEEKPESL---------LWESAFVGVLCS-AQLM 56
           E  ++ N   L ++D++L+ E +  V  E+PES           W+     + C   QL+
Sbjct: 20  ENEIERN---LSREDKMLTTEKEAPVFVEEPESPWQDPNYFKGKWDEVLFVLSCMMGQLL 76

Query: 57  TQAGLGQSLAPLHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVL 116
            QAG   +L+ + ++     +++  + SW  +++ L  G+FILI+GRLGDI+G KK  +L
Sbjct: 77  NQAGSTMTLSTMKVLERELDSSS-AKSSWLMASFPLVSGSFILISGRLGDIYGLKKMLLL 135

Query: 117 GFFWYALWSLLAGFSVYS-NQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPG-RRKNMV 174
           G+ W  +WSL+ G S +S N  FF   RAFQG+G +F+LPN + I+G  YKPG RRKN+V
Sbjct: 136 GYIWLTIWSLICGLSSFSHNDTFFITSRAFQGLGISFVLPNLLGIVGNIYKPGTRRKNIV 195

Query: 175 FSLFGASAPGGFVLGAVFSSM--LGQLAWWPWAYWLMGIACFLLAVAGYYLIPHTPMPNR 232
            SL G  AP G   G +F+ +  + + + WPWA++   IA FL  +  Y++IP++   N 
Sbjct: 196 ISLIGMCAPIGATFGGLFAGVVVIRKDSDWPWAFYAYTIAAFLTTIISYFVIPNSIPVN- 254

Query: 233 DVASFKLLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTVFLIIFAFI 292
            V  F +    D+ GS  GV GL+LFNF WNQ  VVGW T Y  ALLIV ++FLI   FI
Sbjct: 255 -VNKFAM----DWIGSALGVSGLVLFNFVWNQSTVVGWATGYIIALLIV-SIFLIALFFI 308

Query: 293 ---ESRXXXXXXXXXXXSSDTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQ 349
              +             S     +L+ + AGW SFGIWIFY +QF+   R  +P+ +   
Sbjct: 309 FEIKYAKVPLLPKEVTESRSIIMILASLMAGWGSFGIWIFYYFQFVLTLRNYSPVWAGGT 368

Query: 350 FSPVAISGFCAALMTGFLLSHTPPSTVMFFAMTAFTVGTILIATAPVHQTYWAQTFVSII 409
           F  V+I G  AAL  GF +    P+ ++FF+M AFT G+I+++  PVH+TY+     +++
Sbjct: 369 FFMVSIVGCIAALTVGFSIKRVGPAVLLFFSMIAFTCGSIILSVTPVHETYFRSCLGAMV 428

Query: 410 VMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGA 469
           ++ +GMD+SFPAA+I+LSD +  ++QG+A SLVNTVVNYS+S+ LGI GTIE  +N  G 
Sbjct: 429 ILSFGMDLSFPAASIILSDELSMQYQGMAGSLVNTVVNYSMSLFLGIGGTIERQINKSGD 488

Query: 470 NVLKGYRCSWYLGIGLSGFGIFVAATYAVST-FMKSKKRVSEKQHF 514
            +L+G+R + Y  IG+   GI ++  + +    M+SK R   +  +
Sbjct: 489 RLLEGFRAALYFAIGVGSLGILISGVFVLQKELMRSKSRKENELEY 534

>Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}
           complement(43396..44982) [1587 nt, 529 aa]
          Length = 528

 Score =  364 bits (934), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 199/529 (37%), Positives = 306/529 (57%), Gaps = 26/529 (4%)

Query: 3   LSSPVTEENLDMNV----ETLKKDDEVLSDEFDVQEEKPESL---------LWESAFVGV 49
           + + + ++N++++     ET++ D    +DE    E K  SL           E AF+  
Sbjct: 1   MDTDLKKKNIEVSSYIAEETIRSDCSDANDESPSMELKNSSLRNPDYFNSTTQEYAFIFS 60

Query: 50  LCSAQLMTQAGLGQSLAPLHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFG 109
              +QL+  AG  Q+L+ ++++     +++  ++ W  +++ L  G+FIL++GRLGDI+G
Sbjct: 61  CMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKV-WLVASFPLVSGSFILVSGRLGDIYG 119

Query: 110 HKKFFVLGFFWYALWSLLAGFSVYSNQ-IFFDCCRAFQGMGPAFLLPNAIAILGRTYKPG 168
            KK  +LG+    +WSL+ G S YS+  IFF   RAFQG+G + +LPN + ++G  YKPG
Sbjct: 120 LKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPG 179

Query: 169 R-RKNMVFSLFGASAPGGFVLGAVFSSMLGQLAW--WPWAYWLMGIACFLLAVAGYYLIP 225
             +KNMV S+ GA +P G  LG +FS ++   +   WPWA++   +A F+     YY IP
Sbjct: 180 TLKKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIP 239

Query: 226 HTPMPNRDVASFKLLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTVF 285
           +    N +  S      +D+ GS TGV+GLILFNF WNQ P  GW + Y   LL++  + 
Sbjct: 240 NNIPTNVNRLS------MDWIGSFTGVLGLILFNFVWNQAPADGWNSAYLIVLLVISVIA 293

Query: 286 LIIFAFIESRXXXXXX--XXXXXSSDTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTP 343
           LI F   E R             +     +L+ +  GW SFGIW FY + F+ + R  +P
Sbjct: 294 LIAFGIYELRYAENPLLPSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSP 353

Query: 344 LLSSAQFSPVAISGFCAALMTGFLLSHTPPSTVMFFAMTAFTVGTILIATAPVHQTYWAQ 403
           L +   +    ISG   A+  GFL+    P+ ++ F+M  F +G I+ +  PVHQTY+  
Sbjct: 354 LWAGGSYFIFVISGTITAISCGFLMKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRN 413

Query: 404 TFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESN 463
              ++I++P GMD+SFPA++I+LSD++P++HQG+A SLVNTV+NYS S+ LGIAGT+E +
Sbjct: 414 ILGTMIILPLGMDLSFPASSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQH 473

Query: 464 VNDGGANVLKGYRCSWYLGIGLSGFGIFVAATYAVSTFMKSKKRVSEKQ 512
            N  G ++L+GYR + Y GI  SG  + +A  Y V T   S K   EK 
Sbjct: 474 CNKNGTDLLRGYRGALYFGIACSGVAVLIAGLYMVETIFDSYKDRKEKD 522

>YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidrug
           efflux pump of the major facilitator superfamily,
           required for resistance to aminotriazole and
           4-nitroquinoline-N-oxide
          Length = 542

 Score =  357 bits (917), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 205/522 (39%), Positives = 308/522 (59%), Gaps = 21/522 (4%)

Query: 6   PVTEENLDMNV-ETL------KKDDEVLSDEFDVQEEKPESLLW-ESAFVGVLCSAQLMT 57
           PV + + D N+ E+L      + +DE++      Q        W E  F+     +QL+ 
Sbjct: 23  PVKKSSRDNNIGESLTATAFTQSEDEMVDSNQKWQNPNYFKYAWQEYLFIFTCMISQLLN 82

Query: 58  QAGLGQSLAPLHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLG 117
           QAG  Q+L+ ++I+ DSFG+    + SW  +++ L  G+FILI+GRLGDI+G KK  ++G
Sbjct: 83  QAGTTQTLSIMNILSDSFGSEGNSK-SWLMASFPLVSGSFILISGRLGDIYGLKKMLLVG 141

Query: 118 FFWYALWSLLAGFSVYS-NQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGR-RKNMVF 175
           +    +WSL+ G + YS +  FF   RAFQG+G AF+LPN + I+G  Y  G  RKN+V 
Sbjct: 142 YVLVIIWSLICGITKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVI 201

Query: 176 SLFGASAPGGFVLGAVFSSMLG--QLAWWPWAYWLMGIACFLLAVAGYYLIPHTPMPNRD 233
           S  GA AP G  LG +F+ ++G      WPWA++   IA F+  V   Y IP T +P  +
Sbjct: 202 SFVGAMAPIGATLGCLFAGLIGTEDPKQWPWAFYAYSIAAFINFVLSIYAIPST-IPT-N 259

Query: 234 VASFKLLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTVFLIIFAFIE 293
           +  F +    D+ GSV GV+GLIL NF WNQ P+ GW   Y   +LI+  +FL++F   E
Sbjct: 260 IHHFSM----DWIGSVLGVIGLILLNFVWNQAPISGWNQAYIIVILIISVIFLVVFIIYE 315

Query: 294 SRXXXXXXXXXXXSSDTAFVLSCIAA--GWASFGIWIFYTWQFMEDSRGQTPLLSSAQFS 351
            R             D   +   +A   GW SFGI+ FY +QF  + R  T L +   + 
Sbjct: 316 IRFAKTPLLPRAVIKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRQYTALWAGGTYF 375

Query: 352 PVAISGFCAALMTGFLLSHTPPSTVMFFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVM 411
              I G  AAL+ GF + +  PS  +FF+M AF VG+I+ +  PVH+TY+     ++I++
Sbjct: 376 MFLIWGIIAALLVGFTIKNVSPSVFLFFSMVAFNVGSIMASVTPVHETYFRTQLGTMIIL 435

Query: 412 PWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGANV 471
            +GMD+SFPA++I+ SD++P E+QG+A SLVNTVVNYS+S+ LG+  T+E+ VN  G ++
Sbjct: 436 SFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETQVNSDGKHL 495

Query: 472 LKGYRCSWYLGIGLSGFGIFVAATYAVSTFMKSKKRVSEKQH 513
           LKGYR + YLGIGL+     ++  Y V +F+K ++  +  ++
Sbjct: 496 LKGYRGAQYLGIGLASLACMISGLYMVESFIKGRRARAAAEY 537

>SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON}
           uniprot|Q875S7 Saccharomyces kluyveri ATR1
          Length = 521

 Score =  347 bits (889), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 182/475 (38%), Positives = 293/475 (61%), Gaps = 12/475 (2%)

Query: 43  ESAFVGVLCSAQLMTQAGLGQSLAPLHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAG 102
           E  F+     +QL+ QAG  Q+L+ ++I+  +F ++   Q +W  +++ L  G+FIL++G
Sbjct: 53  EYLFIFASMMSQLLNQAGTTQTLSLINILSKNFDSSTSQQ-TWLMASFPLVSGSFILVSG 111

Query: 103 RLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNQI-FFDCCRAFQGMGPAFLLPNAIAIL 161
           ++GDI+G KK  ++G+    +WSL+ G + Y++ + FF   RAFQG+G AF+LPN + I+
Sbjct: 112 KIGDIYGLKKTLLVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIV 171

Query: 162 GRTYKPGR-RKNMVFSLFGASAPGGFVLGAVFSSMLGQLA-WWPWAYWLMGIACFLLAVA 219
           G  Y  G  RKNMV SL GA AP G  +G +FS ++G L+  W W ++   I   +    
Sbjct: 172 GNIYVAGTTRKNMVISLIGACAPIGATMGVLFSGLIGTLSERWAWTFYAYTITAAINMGL 231

Query: 220 GYYLIPHTPMPNRDVASFKLLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALL 279
             ++IP+T   N   +S      +D+ GS  G++G+ILFNF WNQGP+VGW T Y   LL
Sbjct: 232 SIWVIPNTIPTNVRGSS------MDWIGSGIGLLGMILFNFVWNQGPIVGWDTAYIIVLL 285

Query: 280 IVGTVFLIIFAFIESRXXXXXXXXXXXSSDTAFVLSCIAA--GWASFGIWIFYTWQFMED 337
           IV    ++ F   E++             +   +++ +A   GW SFGIW FY + F+ +
Sbjct: 286 IVSVAAIVAFFLYETKYANDPLIPRPAMHNHRLLMTLLAVFFGWGSFGIWTFYYFCFVLN 345

Query: 338 SRGQTPLLSSAQFSPVAISGFCAALMTGFLLSHTPPSTVMFFAMTAFTVGTILIATAPVH 397
            R  TPL +   +    I G  AA+  G+ +   PPS ++F +M AF  G I+++  PV 
Sbjct: 346 LREYTPLWAGGSYFMFLIWGIIAAISVGYTIKRIPPSLILFLSMLAFDCGCIMLSVTPVD 405

Query: 398 QTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIA 457
           QTY+      +I++ +GMD+SFPA++I+LSD +P E+QG+A SLV+T++NYS+S+ LGIA
Sbjct: 406 QTYFRMILGMMIILSFGMDLSFPASSIILSDELPMENQGMAGSLVSTMINYSMSMCLGIA 465

Query: 458 GTIESNVNDGGANVLKGYRCSWYLGIGLSGFGIFVAATYAVSTFMKSKKRVSEKQ 512
           GT+E  +N  G ++LKGYR + YLGIGL+  G+F++A + +  +++ ++R  +++
Sbjct: 466 GTVEHQINKNGDDLLKGYRAALYLGIGLASLGVFISALFMLENYLRMRRRNVKEE 520

>Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W
           (REAL)
          Length = 553

 Score =  346 bits (887), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 197/520 (37%), Positives = 295/520 (56%), Gaps = 17/520 (3%)

Query: 4   SSPVTEENLDMNVETL-KKDDEVLSDEFDVQEEKPESLLW-ESAFVGVLCSAQLMTQAGL 61
           SSP   +   +    L   +DEV+  +   Q        W E  F+     +QL+ Q+G 
Sbjct: 38  SSPRNNKEGALTTIVLTNSEDEVMKTKQKWQNPNYFKYPWQEYLFIFTCMISQLLNQSGT 97

Query: 62  GQSLAPLHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWY 121
            Q+L+ ++I+ DSFG+ +    SW  +++ L  G+FILI+GR+GDIFG K   ++G+   
Sbjct: 98  TQTLSIMNILADSFGS-DANSRSWLMASFPLVSGSFILISGRMGDIFGLKNMLLIGYVMI 156

Query: 122 ALWSLLAGFSVYS-NQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGR-RKNMVFSLFG 179
            +WSL+ G + YS +  FF   RAFQG+G AF+LPN + I+G  Y  G  RKN+V S  G
Sbjct: 157 IIWSLICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVLGIIGNVYVGGTFRKNIVISFIG 216

Query: 180 ASAPGGFVLGAVFSSMLGQLA--WWPWAYWLMGIACFLLAVAGYYLIPHTPMPNRDVASF 237
           A AP G  LG  F+ ++G +    WPWA++   I   +  +   Y IP+  +P  +V  F
Sbjct: 217 AMAPIGATLGCFFAGLIGTMNPNQWPWAFYAYTITAVINLILSIYAIPNN-IPT-NVHRF 274

Query: 238 KLLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTVFLIIFAFIESRXX 297
            +    D+ GS  GV+GL+L N  WNQ P+ GW   Y   LLI+  +FL++F   E    
Sbjct: 275 SM----DWIGSGLGVIGLVLLNLVWNQAPISGWNQAYIIVLLIISVLFLVLFGVYEIHFA 330

Query: 298 XXXXXXXXXSSDTAFVLSCIAA--GWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAI 355
                      D   +   ++   GW SFGI+ FY +QF  + R  TPL +   +    I
Sbjct: 331 KSPLLPQAVMKDRHMIQIMLSLFFGWGSFGIFTFYYFQFQLNIRHYTPLWAGGSYFMFLI 390

Query: 356 SGFCAALMTGFLLSHTPPSTVMFFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMPWGM 415
            G  AAL+ GF +    PS  +FFAM AF VG+I+ +  PVH+TY+     ++I++ +GM
Sbjct: 391 WGIIAALLVGFSIKRVSPSVFLFFAMVAFNVGSIMASVTPVHETYFRMQMGTMIILSFGM 450

Query: 416 DMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGANVLKGY 475
           D+SFPA++I+ SD +P E+QG+A SLVNTVVNYS+S+ LG+  T+E  ++  G ++LKGY
Sbjct: 451 DLSFPASSIIFSDYLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVEMQLDPDGKHILKGY 510

Query: 476 RCSWYLGIGLSGFGIFVAATYAVSTFMKSK--KRVSEKQH 513
           R + YLGIGL+     ++  Y V  ++K    K V+E + 
Sbjct: 511 RGAQYLGIGLASLACIISGLYMVECYIKDHRAKAVAEDKR 550

>Skud_13.451 Chr13 complement(798006..799625) [1620 bp, 539 aa] {ON}
           YMR279C (REAL)
          Length = 539

 Score =  345 bits (885), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 199/529 (37%), Positives = 296/529 (55%), Gaps = 29/529 (5%)

Query: 4   SSPVTEENLDMNVET---LKKDDEVL-----SDEFDVQEEKP-------ESLLWESAFVG 48
           SSPV ++ + M  E    +  D+EV      S    +  + P        S   E  F+G
Sbjct: 15  SSPVNDK-ISMKEEDKVIVSTDEEVTTVASSSKSNQISNDSPWQDPTYFSSFGKELMFIG 73

Query: 49  VLCSAQLMTQAGLGQSLAPLHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIF 108
               AQL+ QAG   +L  ++++  SFG+ +  Q +W  +++ L  G+FILI+GRLGDI+
Sbjct: 74  TCMLAQLLNQAGQTHALCIMNVLSKSFGSESNNQ-AWLMASFPLAAGSFILISGRLGDIY 132

Query: 109 GHKKFFVLGFFWYALWSLLAGFSVYSNQ-IFFDCCRAFQGMGPAFLLPNAIAILGRTYKP 167
           G KK  ++G+    +WS+++G S YSN   FF  CRAFQG+G AF+LPN + ++G  YK 
Sbjct: 133 GLKKMLMIGYVIIIVWSIISGLSKYSNNDSFFITCRAFQGVGIAFILPNIMGLVGHVYKV 192

Query: 168 GR-RKNMVFSLFGASAPGGFVLGAVFSSML--GQLAWWPWAYWLMGIACFLLAVAGYYLI 224
           G  RKN+V S+ GA  P G + G VF  ++       WPW ++  GIA F+  +  +Y I
Sbjct: 193 GSLRKNLVISVIGACGPTGALFGGVFGGLIVTEDPNQWPWVFYAFGIATFISMLMAWYSI 252

Query: 225 PHTPMPNRDVASFKLLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTV 284
           P+    N    S      +D+ GSV  V+GLILFNF WN+ P+ GW   Y   LL+V   
Sbjct: 253 PNNVPTNVHGLS------MDWTGSVLAVIGLILFNFVWNEAPIAGWDKAYIIVLLVVSVF 306

Query: 285 FLIIFAFIESRXXXXXXXXXXXSSDTAFVLSCIAA--GWASFGIWIFYTWQFMEDSRGQT 342
           FL+ F   E +           + +   ++  +A   GW SFGIW FY   F  + R  +
Sbjct: 307 FLVAFFVYEIKYAEVPLLPHAVTKNRHMIMILLAVFVGWGSFGIWTFYYVSFQLNLRHYS 366

Query: 343 PLLSSAQFSPVAISGFCAALMTGFLLSHTPPSTVMFFAMTAFTVGTILIATAPVHQTYWA 402
           P+ +   +   AI G  AA    F +    P+ ++ FA+ AF  G+I+ +  PV Q+YW 
Sbjct: 367 PVWTGGTYFVFAIFGTIAAFFVAFSIKRLGPALLLCFALMAFDAGSIMFSVLPVEQSYWK 426

Query: 403 QTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIES 462
             F    V+ +GMD+SFPA++I+LSD +P ++QG+A SLVNTV+NYS S+ LG+  T+E 
Sbjct: 427 LNFAMQAVLCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGMGATVEH 486

Query: 463 NVNDGGANVLKGYRCSWYLGIGLSGFGIFVAATYAVSTFMKSKKRVSEK 511
            +N  G NVL+GYR + YLGIGL+  G+ ++ TY + T    +K+   K
Sbjct: 487 QINKSGKNVLEGYRAAVYLGIGLASLGVLISVTYMLETVWNERKKCQRK 535

>NDAI0E00280 Chr5 (37676..39325) [1650 bp, 549 aa] {ON} Anc_8.843
          Length = 549

 Score =  344 bits (882), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 199/520 (38%), Positives = 308/520 (59%), Gaps = 18/520 (3%)

Query: 4   SSPVTEENLDMNVETL---KKDDEVLSDEFDVQEEKPESLLW-ESAFVGVLCSAQLMTQA 59
           SS   EEN +++ + L   +++D  + D    Q        W E  F+     +QL+ QA
Sbjct: 32  SSITKEENNEVSEDELPSSEQEDNTIGDHSKWQNPDYFQNKWQEYLFIFSCMMSQLLNQA 91

Query: 60  GLGQSLAPLHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFF 119
              Q+L+ ++II DSF  +  G+ +W  +++ L  G+FILI+GR+GDI+G KK  + G+ 
Sbjct: 92  ATPQTLSIMNIITDSF-KSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYL 150

Query: 120 WYALWSLLAGFSVYS-NQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPG-RRKNMVFSL 177
           ++ +WSL++GF+ YS N IFF   RAFQG+G AF+LPN + I+G  YKP  +RKN+V S+
Sbjct: 151 FFIIWSLISGFTDYSHNDIFFIISRAFQGLGIAFILPNVMGIVGNIYKPDTQRKNIVISM 210

Query: 178 FGASAPGGFVLGAVFSSMLG--QLAWWPWAYWLMGIACFLLAVAGYYLIPHTPMPNRDVA 235
            GASAP G  +G++F+ ++G      WPWA++   IA  +      Y IP+    N  + 
Sbjct: 211 IGASAPIGAFMGSLFAGLIGTENPKQWPWAFYAFAIASAINLAISIYSIPNNIPTN--IH 268

Query: 236 SFKLLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTVFLIIFAFIESR 295
            F +    D+ GS+  V+GLIL NF WNQGP+VGWQ  Y   LLI+  + L++F   E +
Sbjct: 269 GFAM----DWIGSIMAVIGLILLNFVWNQGPIVGWQKAYIIVLLIISIIALVLFFTYEIK 324

Query: 296 XXXXXXXXXXXSSDTAFV--LSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPV 353
                      + +   +  L+ +  GW SFGI+ FY + F+ + R  + L +   +   
Sbjct: 325 YAKSPILPVEVTKNRHIIMILAALFLGWGSFGIFSFYYFSFLLNLRHYSALWAGTTYFMF 384

Query: 354 AISGFCAALMTGFLLSHTPPSTVMFFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMPW 413
           AI G  AA++ G  +     S ++FF+M AF +G I+++  PV QTY+     ++I++ +
Sbjct: 385 AIWGTVAAVIVGAFIKRISASVILFFSMIAFNIGLIMLSVTPVDQTYFRMNLGTMIILSF 444

Query: 414 GMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGANVLK 473
           GMDMSFPAA I+LSD +  ++QG+A SL NT+VNYS+S+ LG+  T+E  +N  G  +LK
Sbjct: 445 GMDMSFPAAAIILSDGLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGKEILK 504

Query: 474 GYRCSWYLGIGLSGFGIFVAATYAVSTF-MKSKKRVSEKQ 512
           GYR + YLG+GL+G GI ++  Y       K K+R+S  +
Sbjct: 505 GYRAAEYLGVGLAGLGIVISGIYMAEVLWAKRKERLSSNR 544

>Skud_13.25 Chr13 (37872..39485) [1614 bp, 537 aa] {ON} YML116W
           (REAL)
          Length = 537

 Score =  343 bits (880), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 195/516 (37%), Positives = 294/516 (56%), Gaps = 18/516 (3%)

Query: 2   TLSSPVTEENLDMNVETL----KKDDEVLSDEFDVQEEKPESLLW-ESAFVGVLCSAQLM 56
           ++S+       D N ET+       +E+  D+   Q        W E  F+     +QL+
Sbjct: 23  SVSAVKKSSRHDGNEETVTISTDHGEEMTVDKQRWQNPNYFKNSWHEYLFIFTCMISQLL 82

Query: 57  TQAGLGQSLAPLHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVL 116
            QAG  Q+L+ ++II +SFG+ N    +W  +++ L  G+FILI+GRLGDI+G KK   +
Sbjct: 83  NQAGTTQTLSIMNIIANSFGS-NENSRTWLMASFPLVSGSFILISGRLGDIYGLKKMLTI 141

Query: 117 GFFWYALWSLLAGFSVYS-NQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGR-RKNMV 174
           G+    +WSL+ G + YS +  FF   RAFQG+G AF+LPN + I+G  Y  G  RKN+V
Sbjct: 142 GYVVIIIWSLICGLTKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVSGTFRKNIV 201

Query: 175 FSLFGASAPGGFVLGAVFSSMLGQL--AWWPWAYWLMGIACFLLAVAGYYLIPHTPMPNR 232
            SL GA AP G  LG +F+ ++G      WPWA++   I   +      Y IP+  +P  
Sbjct: 202 ISLVGAMAPVGATLGCLFAGLIGTKNPKQWPWAFYAYTITSIINLALSVYSIPNN-IPT- 259

Query: 233 DVASFKLLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTVFLIIFAFI 292
           ++  F +    D+ GS  GV+GL+L NF WNQ P+ GW   Y   LL++  VFL++F   
Sbjct: 260 NIQHFSM----DWIGSALGVIGLVLMNFVWNQAPISGWDQAYIIVLLVISVVFLVVFIIY 315

Query: 293 ESRXXXXXXXXXXXSSDTAFVLSCIAA--GWASFGIWIFYTWQFMEDSRGQTPLLSSAQF 350
           E+R             D   +   +A   GW SFGI+ FY +QF  + R  + + +   +
Sbjct: 316 ENRFAKSPLLPRAVLKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRHYSAVWAGGTY 375

Query: 351 SPVAISGFCAALMTGFLLSHTPPSTVMFFAMTAFTVGTILIATAPVHQTYWAQTFVSIIV 410
               I G  AAL+ G  +    PS  +F +M AF +G+I+ +  PVH+TY+     ++I+
Sbjct: 376 FMFLIWGIIAALLVGIYIKKVSPSVFLFLSMMAFNIGSIMASVTPVHETYFRTQLGTMII 435

Query: 411 MPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGAN 470
           + +GMD SFPA++I+ SD++P E+QG+A SLVNTVVNYS+S+ LG+  T+E++V+  G +
Sbjct: 436 LSFGMDFSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETHVDPDGKH 495

Query: 471 VLKGYRCSWYLGIGLSGFGIFVAATYAVSTFMKSKK 506
           VLKGYR + YLGIGL+     ++  Y V   +K  K
Sbjct: 496 VLKGYRGAQYLGIGLASLACIISGLYMVERIIKDHK 531

>NCAS0A02540 Chr1 complement(481807..483426) [1620 bp, 539 aa] {ON} 
          Length = 539

 Score =  342 bits (878), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 193/524 (36%), Positives = 307/524 (58%), Gaps = 23/524 (4%)

Query: 2   TLSSPVTEENLDMNVETLKKD--DEVLSDEFDVQEEKPESLLWESAFVGVLCS-AQLMTQ 58
           T+S P  ++N+  N + +  +  D VL D+   Q     S  ++  F    C  A L+ Q
Sbjct: 18  TVSFPNEDKNISHNEKEVYSNSTDSVLDDDSPWQNPNYFSSKYKEYFFIFTCMVANLLNQ 77

Query: 59  AGLGQSLAPLHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGF 118
           AG  Q L+ +++I +SF  ++ G+ +W  +++ L  G+FILI+GR+GDI+G KK  + G+
Sbjct: 78  AGQTQVLSTMNVISESF-HSDSGKQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGY 136

Query: 119 FWYALWSLLAGFSVYS-NQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGR-RKNMVFS 176
            +  +WSLL GF+ ++ N  FF  CRAFQG+G +F+LPN + ++G  YK G  RKN+V S
Sbjct: 137 IFMIIWSLLCGFADFTHNDTFFIVCRAFQGLGISFILPNVMGLIGNIYKVGTLRKNIVIS 196

Query: 177 LFGASAPGGFVLGAVFSSML--GQLAWWPW---AYWLMGIACFLLAVAGYYLIPHTPMPN 231
           + G +AP G  +GA++  ++       WPW   AY L G+   ++A+   Y +P+    N
Sbjct: 197 MIGLTAPTGACMGALWGGLIVTENAKQWPWIFYAYALTGLVNLIMAL---YSVPNCIPTN 253

Query: 232 RDVASFKLLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTVFLIIFAF 291
             V +F +    D+ GS+ GVVGLILFNF WNQGPV GW   Y   LLI+  +FL+ F  
Sbjct: 254 --VHNFAM----DWIGSIIGVVGLILFNFVWNQGPVAGWDKAYIIVLLIISVLFLVAFVV 307

Query: 292 IESRXXXXXXXXXXXSSDTAF--VLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQ 349
            E +           + +     +LS +  GW +FGIW FY + F  + R  +P+     
Sbjct: 308 YELKYPISPLLPVEVTKNGQILTILSILFLGWGAFGIWTFYYFAFQLNLRDYSPVWVGGT 367

Query: 350 FSPVAISGFCAALMTGFLLSHTPPSTVMFFAMTAFTVGTILIATAPVHQTYWAQTFVSII 409
           +    I G  AAL+  F +    P+ ++FF+   FT+G+++++  P+HQ YW       I
Sbjct: 368 YFMFIIWGTIAALIVAFTIKKVGPAILLFFSALGFTMGSLMLSVTPIHQMYWRMNLGMQI 427

Query: 410 VMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGA 469
           ++ +GMD+SFPA++I+LSD +P ++QG+A SLVNTV+NY+ S+ LG+  T+E  +N  G 
Sbjct: 428 ILCFGMDLSFPASSIILSDHLPMQYQGMAGSLVNTVINYATSLCLGMGTTVERQINKSGE 487

Query: 470 NVLKGYRCSWYLGIGLSGFGIFVA-ATYAVSTFMKSKKRVSEKQ 512
           ++LKGYR + YL +GL G G  +A      + +MK + R+++ +
Sbjct: 488 DLLKGYRSALYLAVGLGGLGSCIAFINLCYTLWMKRRDRLADLK 531

>TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {ON} 
          Length = 580

 Score =  343 bits (879), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 185/511 (36%), Positives = 300/511 (58%), Gaps = 22/511 (4%)

Query: 13  DMNVETLKKDDEVLSDEFDVQEEKPESLLWESAFVGVLCSAQLMTQAGLGQSLAPLHIIG 72
           D+N E L+ +++VLS ++  +    E L   S  V     +Q M+QAGL Q+L+ ++I+ 
Sbjct: 74  DINSENLQSENKVLSPKY-FKNRTHEYLFIISCMV-----SQFMSQAGLTQALSIMNILA 127

Query: 73  DSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSV 132
           +    A   + +W  ++++L++G+FIL++GRLGDI+G KK  + G+    +WSL+ GFS 
Sbjct: 128 EEL-NAEKSRQAWLMASFTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWSLICGFSS 186

Query: 133 YS-NQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGR-RKNMVFSLFGASAPGGFVLGA 190
           YS N  FF   RAFQG+G AF+LPN++ ++G  Y+PG  +KNM+    GA +P G  LG 
Sbjct: 187 YSHNDAFFITSRAFQGLGLAFVLPNSLGLIGVIYEPGSMKKNMIIGTLGAMSPIGATLGG 246

Query: 191 VFSSMLGQL--AWWPWAYWLMGIACFLLAVAGYYLIPHTPMPNRDVASFKLLERIDFAGS 248
           +F+ ++G      WPW+++  GI  F   +  +Y IP+    N     + L   +D+ G+
Sbjct: 247 LFAGIIGTKDPKQWPWSFYSFGIVSFCNMILSWYSIPN----NIPTNIYNL--SMDWIGA 300

Query: 249 VTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTVFLIIFAFIESRXXXXXXXXXXXSS 308
           + G+ GL++ NF +NQ P+VGWQ+ Y   LL++    L+IF   E +           SS
Sbjct: 301 ILGIFGLLILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISS 360

Query: 309 DTAFVLSCIA--AGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAISGFCAALMTGF 366
           +   ++   A   GW +FG W FY + F+ + RG T   +   +    +SG   A + GF
Sbjct: 361 NRGMLMILFALFCGWGAFGTWTFYYFSFVLNVRGYTAAWAGGSYFIFIVSGCAIATLCGF 420

Query: 367 LLSHTPPSTVMFFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFPAATIML 426
           ++   PPS +++ +M  F  G +++   P+HQ+Y+      + V+P G+D+SFPAA+I+L
Sbjct: 421 MMKKVPPSVILYISMIGFMGGCVMLTVTPIHQSYFQNILGIMFVLPIGIDLSFPAASIIL 480

Query: 427 SDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGANVLKGYRCSWYLGIGLS 486
           SD++P ++QG+A SLV T+ NYS SI LG+AG++E+  ND G N+LKGYR +      L+
Sbjct: 481 SDALPIQYQGMAGSLVYTITNYSTSICLGMAGSVEAYHNDNGQNILKGYRNAMIFADALA 540

Query: 487 GFGIFVAATYAV---STFMKSKKRVSEKQHF 514
           G GI V+  Y V    T  ++ K  ++ +H 
Sbjct: 541 GLGIIVSGIYMVINLITIRENSKSTNKPKHL 571

>TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa]
           {ON} Anc_8.843 YMR279C
          Length = 556

 Score =  340 bits (873), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 183/491 (37%), Positives = 283/491 (57%), Gaps = 16/491 (3%)

Query: 35  EKPE---SLLWESAFVGVLCSAQLMTQAGLGQSLAPLHIIGDSFGTANPGQLSWFASAYS 91
           +KP+   S L E AF+      QL+ QAG  QS++ ++II + FG+    Q +W  +++ 
Sbjct: 66  QKPQYFSSKLHEWAFIFTCLMGQLLNQAGTTQSMSIMNIIAEDFGSETSKQ-AWLFASFP 124

Query: 92  LTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSN-QIFFDCCRAFQGMGP 150
           L  G+FIL+ GR GDI+G KK  +LG+    +WS++ G + Y++   FF   +AFQG+G 
Sbjct: 125 LVSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLGV 184

Query: 151 AFLLPNAIAILGRTYKPGR-RKNMVFSLFGASAPGGFVLGAVFSSML--GQLAWWPWAYW 207
           +F+LPN I ++G  Y+PG  +KN+  S  GA AP G   G +FS ++       WPW ++
Sbjct: 185 SFILPNIIGLVGTIYEPGSMKKNITISFIGAMAPLGATFGGLFSGIVVVKDDKNWPWTFY 244

Query: 208 LMGIACFLLAVAGYYLIPHTPMPNRDVASFKLLERIDFAGSVTGVVGLILFNFAWNQGPV 267
              I  FL+ V  Y+ +P     N +        ++D+ GS  GVVGL+LF+F WNQ P+
Sbjct: 245 AFAIVSFLVGVTCYFFVPDNVPTNTNNL------KMDWIGSAVGVVGLLLFSFVWNQAPM 298

Query: 268 VGWQTPYTYALLIVGTVFLIIFAFIESRXXXXXXXXXXXSSDTAFVLSCIA--AGWASFG 325
            GW   Y   LL++  + +I F   E             + +   ++  +A   GW +FG
Sbjct: 299 DGWDKAYIIVLLVISVILIIAFFIYEINYAEVPLLPKAITGNRHIIMILLAIFMGWGTFG 358

Query: 326 IWIFYTWQFMEDSRGQTPLLSSAQFSPVAISGFCAALMTGFLLSHTPPSTVMFFAMTAFT 385
           IW FY + F  + R  +P+ +   +    +SGF  A   GFL+    PS ++  ++T FT
Sbjct: 359 IWSFYYFSFSLNLRHFSPVWTGGAYFAFILSGFTIASCVGFLIKIIRPSIILVISITGFT 418

Query: 386 VGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTV 445
           +G ++ A  P  QTYW  TF  ++++P GMD+SFPA++I+LSD +P E+QG+A SLVNT+
Sbjct: 419 MGNLIFAVTPADQTYWRNTFGMMLLLPLGMDLSFPASSIILSDQLPPEYQGMAGSLVNTM 478

Query: 446 VNYSISIGLGIAGTIESNVNDGGANVLKGYRCSWYLGIGLSGFGIFVAATYAVSTFMKSK 505
           VNYS S  LG+A T+E  +N  G ++LKGYR ++Y G+G+   GI +A+ Y   TF    
Sbjct: 479 VNYSQSFCLGVATTVEKQINSSGDDLLKGYRAAFYTGVGIGTLGISIASLYMFETFWTDY 538

Query: 506 KRVSEKQHFIE 516
           K  ++  + IE
Sbjct: 539 KEKTKLANDIE 549

>NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON} 
          Length = 553

 Score =  340 bits (871), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 187/457 (40%), Positives = 275/457 (60%), Gaps = 13/457 (2%)

Query: 43  ESAFVGVLCSAQLMTQAGLGQSLAPLHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAG 102
           E  FV     A L+ QAG  Q L+ +++I DSF ++  GQ +W  +++ L  G+FILI+G
Sbjct: 75  EYIFVATCMIANLLNQAGQSQVLSAMNVISDSFHSSTGGQ-TWLMASFPLVSGSFILISG 133

Query: 103 RLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSN-QIFFDCCRAFQGMGPAFLLPNAIAIL 161
           RLGDI+G K+  + GF +  +WSL+ GF+ Y++   FF   RAFQG+G +F+LPN + ++
Sbjct: 134 RLGDIYGLKRMMIGGFIFMIIWSLICGFTNYAHSDTFFIVARAFQGLGISFILPNVMGLV 193

Query: 162 GRTYKPGR-RKNMVFSLFGASAPGGFVLGAVFSSML--GQLAWWPWAYWLMGIACFLLAV 218
           G  YK G  RKN+V SL G  AP G   GA++  ++       WPW ++   +A  +  V
Sbjct: 194 GNIYKVGTLRKNVVISLIGIMAPTGSCFGALWGGLIVTENPKQWPWIFYAYAVAAAVCLV 253

Query: 219 AGYYLIPHTPMPNRDVASFKLLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYAL 278
            GYY +P   +P  +V  F +    D+ GSV GV+GLILFNF WNQGP+VGW+  Y   L
Sbjct: 254 MGYYTVPDN-IPT-NVNGFTM----DWIGSVLGVIGLILFNFVWNQGPIVGWEKAYIIVL 307

Query: 279 LIVGTVFLIIFAFIESRXXXXXXXXXXXSSDTAF--VLSCIAAGWASFGIWIFYTWQFME 336
           LIV  +FLI F   E +           + +     +L+ +  GW SFGIW FY + F  
Sbjct: 308 LIVSVIFLIAFFVYEIKYAKVPLLPKAVTQNGHILTILTVLFLGWGSFGIWTFYYFAFQL 367

Query: 337 DSRGQTPLLSSAQFSPVAISGFCAALMTGFLLSHTPPSTVMFFAMTAFTVGTILIATAPV 396
           + R  +P+ S   F    I G  AA      +    P+ ++FF+   FT G+I+++  PV
Sbjct: 368 NLREYSPVWSGGTFFVFIIFGTVAATTVALTIKKVGPAILLFFSAIGFTCGSIIMSVTPV 427

Query: 397 HQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGI 456
           HQTYW  TF   I++ +GMD+ FPA++I+LSD +P ++QG+A SLVNT+VNYS S+ LG+
Sbjct: 428 HQTYWRNTFGMQIILVFGMDLPFPASSIILSDYLPMQYQGMAVSLVNTIVNYSTSLCLGM 487

Query: 457 AGTIESNVNDGGANVLKGYRCSWYLGIGLSGFGIFVA 493
             T+E  +N  G ++LKGYR + Y G+G++G G  +A
Sbjct: 488 GTTVERQINKSGDDLLKGYRAALYFGVGIAGLGACIA 524

>Smik_13.18 Chr13 (34422..36059) [1638 bp, 545 aa] {ON} YML116W
           (REAL)
          Length = 545

 Score =  339 bits (869), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 195/499 (39%), Positives = 291/499 (58%), Gaps = 14/499 (2%)

Query: 22  DDEVLSDEFDVQEEKPESLLW-ESAFVGVLCSAQLMTQAGLGQSLAPLHIIGDSFGTANP 80
           +DE++      Q  K     W E  F+     +QL+ QAG  Q+L+ ++I+ DSFG+   
Sbjct: 49  EDEMVECNQKWQNPKYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGN 108

Query: 81  GQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYS-NQIFF 139
            + SW  +++ L  G+FILI+GRLGDI+G KK  ++G+    +WSL+ G + YS +  FF
Sbjct: 109 SK-SWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFF 167

Query: 140 DCCRAFQGMGPAFLLPNAIAILGRTYKPGR-RKNMVFSLFGASAPGGFVLGAVFSSMLG- 197
             CRAFQG+G AF+LPN + I+G  Y  G  RKN+V S  GA AP G  LG +F+ ++G 
Sbjct: 168 IICRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGT 227

Query: 198 -QLAWWPWAYWLMGIACFLLAVAGYYLIPHTPMPNRDVASFKLLERIDFAGSVTGVVGLI 256
                WPWA++   IA  +      Y IP+    N  +  F +    D+ GSV GV+GLI
Sbjct: 228 ENPNQWPWAFYAFSIASLINFGLSIYAIPNNIPTN--IHHFSM----DWIGSVLGVIGLI 281

Query: 257 LFNFAWNQGPVVGWQTPYTYALLIVGTVFLIIFAFIESRXXXXXXXXXXXSSDTAFVLSC 316
           L NF WNQ P+ GW   Y   +LI+  +FL +F   E               D   +   
Sbjct: 282 LLNFVWNQAPISGWSQAYIIVILIISVIFLAVFIIYEMWFAKSPLLPHAVIKDYHMIQIM 341

Query: 317 IAA--GWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAISGFCAALMTGFLLSHTPPS 374
           +A   GW SFGI+ FY +QF  + R  T L +   +    I G  AAL+ GF + +  PS
Sbjct: 342 LALFFGWGSFGIFTFYYFQFQLNIRHYTALWAGGTYFMFLIWGIIAALLVGFTIKNVSPS 401

Query: 375 TVMFFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEH 434
             +FF+M AF VG+I+ +  PVH+TY+     ++I++ +GMD+SFPA++I+ SD++P E+
Sbjct: 402 VYLFFSMVAFNVGSIMASVTPVHETYFRTQLGTMIILSFGMDLSFPASSIIFSDNLPMEY 461

Query: 435 QGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGANVLKGYRCSWYLGIGLSGFGIFVAA 494
           QG+A SLVNTVVNYS+S+ LG+  T+E+ ++  G ++LKGYR + YLGIGL+     ++ 
Sbjct: 462 QGMAGSLVNTVVNYSMSLCLGMGATVETQLDPDGKHLLKGYRGAQYLGIGLASLACMISG 521

Query: 495 TYAVSTFMKSKKRVSEKQH 513
            Y V +F+   K  +  ++
Sbjct: 522 LYMVESFINDHKAKAATEN 540

>Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {ON}
           YMR279C (REAL)
          Length = 543

 Score =  338 bits (868), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 195/525 (37%), Positives = 291/525 (55%), Gaps = 16/525 (3%)

Query: 1   MTLSSPVTEENLDMNVETLKKDDEVLSDEFDVQEEKP---ESLLWESAFVGVLCSAQLMT 57
           M     V   + D +V T+   ++      D   + P    S   E  F+     AQL+ 
Sbjct: 24  MKAEDKVVVSSEDEDVTTVASSNKSTQVSNDSPWQDPTYFSSFGRELMFIVTCMLAQLLN 83

Query: 58  QAGLGQSLAPLHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLG 117
           QAG   +L  ++++  SF + +  Q +W  +++ L  G+FILI+GRLGDI+G KK  ++G
Sbjct: 84  QAGQTHALTIMNVLSKSFNSESDKQ-AWLMASFPLVAGSFILISGRLGDIYGLKKMLMIG 142

Query: 118 FFWYALWSLLAGFSVYSNQ-IFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGR-RKNMVF 175
           +    +WSL+ G S YSN   FF  CRAFQG+G AF+LPN + ++G  YK G  RKN+V 
Sbjct: 143 YVTIIVWSLICGLSKYSNNDAFFITCRAFQGLGIAFILPNVMGLVGHVYKVGSTRKNLVI 202

Query: 176 SLFGASAPGGFVLGAVFSSML--GQLAWWPWAYWLMGIACFLLAVAGYYLIPHTPMPNRD 233
           S  GA AP G + G +F  ++       WPW ++   IA FL  +  +Y IP+    N  
Sbjct: 203 SFIGACAPAGGMFGGLFGGLIVNEDSEQWPWVFYAFAIAFFLNMILAWYSIPNNIPTN-- 260

Query: 234 VASFKLLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTVFLIIFAFIE 293
           V  F +    D+ GSV  V+GLILFNF WNQ P  GW T Y  ALLI+   FL+ F   E
Sbjct: 261 VHGFSM----DWTGSVLAVIGLILFNFVWNQAPTAGWGTAYIIALLIISVFFLVAFFVYE 316

Query: 294 SRXXXXXXXXXXXSSDTAFVLSCIAA--GWASFGIWIFYTWQFMEDSRGQTPLLSSAQFS 351
            +           + +   ++  +A   GW SFGIW FY   F  + R  +P+ +   + 
Sbjct: 317 VKYAKVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYMSFQLNLRHYSPVWTGGTYF 376

Query: 352 PVAISGFCAALMTGFLLSHTPPSTVMFFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVM 411
              I G  AA M    +    P+ ++ FA+ AF VG+I+ +  PV Q++W   F    ++
Sbjct: 377 VFVIFGTIAAFMVALSIKRVGPAFLLCFALVAFDVGSIMFSVLPVKQSFWKLNFGMQAIL 436

Query: 412 PWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGANV 471
            +GMD+SFPA++I+LSD +P E+QG+A SLVNTV+NYS S+ LG+  T+E  +N  G ++
Sbjct: 437 CFGMDLSFPASSIILSDGLPMEYQGMAGSLVNTVINYSASLCLGMGATVEHQINKNGKDL 496

Query: 472 LKGYRCSWYLGIGLSGFGIFVAATYAVSTFMKSKKRVSEKQHFIE 516
           LKGYR + YLG+GL+  G+ ++ TY + TF  +++   +     E
Sbjct: 497 LKGYRGAIYLGVGLASLGVLISFTYMLETFWNNRRDRQKDSVITE 541

>KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.843
           YMR279C
          Length = 550

 Score =  337 bits (864), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 188/460 (40%), Positives = 265/460 (57%), Gaps = 13/460 (2%)

Query: 43  ESAFVGVLCSAQLMTQAGLGQSLAPLHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAG 102
           E AF+     AQL+ QAG  Q+ AP++I+ D+F ++   Q +W  +++ L  G+FIL++G
Sbjct: 74  EYAFISTCMLAQLLNQAGQAQATAPMNILADAFNSSAKKQ-TWLMASFPLVSGSFILVSG 132

Query: 103 RLGDIFGHKKFFVLGFFWYALWSLLAGFSVYS-NQIFFDCCRAFQGMGPAFLLPNAIAIL 161
           R+GDI+G KK  + G+    +WSL+ GF+ Y+ N  FF  CRAFQG+G AF+LPN + ++
Sbjct: 133 RIGDIYGLKKTLIGGYLVVLIWSLICGFANYTHNDAFFILCRAFQGLGIAFILPNVMGLI 192

Query: 162 GRTYKPGR-RKNMVFSLFGASAPGGFVLGAVFSSMLGQL--AWWPWAYWLMGIACFLLAV 218
           G  YK    RKN V S  G  AP G  LG V+S ++       WPW ++   I   +  V
Sbjct: 193 GNIYKANTLRKNFVISFVGMCAPIGAALGGVWSGLIAHENPKQWPWIFYAYAIVVAINMV 252

Query: 219 AGYYLIPHTPMPNRDVASFKLLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYAL 278
              Y IP T   N  +  F +    D+ GS  GVVG+ILFNF WNQGP+ GW   Y  AL
Sbjct: 253 MAIYSIPSTVPTN--IHGFGM----DWTGSAIGVVGMILFNFVWNQGPIDGWNKGYIIAL 306

Query: 279 LIVGTVFLIIFAFIESRXXXXXXX--XXXXSSDTAFVLSCIAAGWASFGIWIFYTWQFME 336
           LIV    LI F   E +             +     +L  +  GW SFGIW FY + F  
Sbjct: 307 LIVSVFLLIAFFIYEIKFAKSPLLPPEVIKNRHIGMILLAVFMGWGSFGIWTFYYYAFQL 366

Query: 337 DSRGQTPLLSSAQFSPVAISGFCAALMTGFLLSHTPPSTVMFFAMTAFTVGTILIATAPV 396
           + R  + + +   F    I G  AA +    +    PS ++ F+MT FTVG I+++  PV
Sbjct: 367 NLRHYSAVWAGGTFFMFVIWGTIAAFLVALTIKRVGPSVLLCFSMTGFTVGCIMLSVTPV 426

Query: 397 HQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGI 456
           HQ+YW       I++ +GMD+SFPA++I+LSD +P ++QG+A SLVNT+VNYS S+ LG+
Sbjct: 427 HQSYWKMNLGMQIILSFGMDLSFPASSIILSDFLPSQYQGMAGSLVNTMVNYSTSLCLGV 486

Query: 457 AGTIESNVNDGGANVLKGYRCSWYLGIGLSGFGIFVAATY 496
             T E+ VN  G + LKGYR + Y+GIGL   G+ VA  Y
Sbjct: 487 GSTAEAQVNKNGTDKLKGYRAALYVGIGLGACGMLVAFCY 526

>KAFR0B03930 Chr2 complement(816351..818018) [1668 bp, 555 aa] {ON} 
          Length = 555

 Score =  337 bits (863), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 200/516 (38%), Positives = 299/516 (57%), Gaps = 18/516 (3%)

Query: 4   SSPVTEENLDMNV-ETLKKDDEVLSDEFDVQEEKPE--SLLWESAFVGVLCS-AQLMTQA 59
           S+ V+E+   ++V E    D E  SD  +   + P   S  W+     + C  + L+ QA
Sbjct: 39  STSVSEKTSAISVFEGTSPDAEKFSDN-NTPWQNPSYFSSRWKEYLFILTCMLSNLLNQA 97

Query: 60  GLGQSLAPLHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFF 119
           G  Q+ + +++IG +F  A+    +W  +++ L  G+FIL++GR+GDI+G K+  + G  
Sbjct: 98  GQTQATSTMNVIGSAF-NADSSSKTWLMASFPLVSGSFILVSGRIGDIYGLKRTMIGGLI 156

Query: 120 WYALWSLLAGFSVYSNQI-FFDCCRAFQGMGPAFLLPNAIAILGRTYKPGR-RKNMVFSL 177
              +WSL+ GF+ YS+ + FF  CRAFQG+G AF+LPN + ++G  YK G  RKN+V S 
Sbjct: 157 VMIIWSLICGFANYSSSVTFFIICRAFQGLGIAFVLPNVMGLVGNIYKVGSLRKNIVISC 216

Query: 178 FGASAPGGFVLGAVFSSMLGQLA--WWPWAYWLMGIACFLLAVAGYYLIPHTPMPNRDVA 235
            G  AP G   GA ++ ++   A   WPW ++    A  L  V   Y IP T   N  V 
Sbjct: 217 IGMCAPTGAAFGAFWAGLIATKAEKQWPWIFYAYAFAGILNLVLAIYSIPDTVPVN--VH 274

Query: 236 SFKLLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTVFLIIFAFIESR 295
            F +    D+ GSV GV+GLILFNF WN+ P+VGW+  Y   LLI   + +++F   E +
Sbjct: 275 GFSM----DWTGSVVGVIGLILFNFVWNEAPIVGWEKAYIIVLLIFSLLIIVVFFIYEIK 330

Query: 296 XXXXXX--XXXXXSSDTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPV 353
                        + +   +LS +  GW SFGIW FY + F+ + RG TPL + A     
Sbjct: 331 FAKSPLLPQAVTHNHNIIMILSAMFMGWGSFGIWTFYYYAFLLNLRGYTPLEAGASHCMF 390

Query: 354 AISGFCAALMTGFLLSHTPPSTVMFFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMPW 413
            + G  AA    F +    PS ++F +M AFTVG+I+++  PVHQTYW  TF   I++ +
Sbjct: 391 ILWGTIAAFTVAFTIKRVGPSVLLFCSMVAFTVGSIMLSITPVHQTYWKMTFGMQIILAF 450

Query: 414 GMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGANVLK 473
           GMD+SFPA++I+LSD++P E+QG+A SLVNT+VNYS S+ LG+  T E  VN  G ++LK
Sbjct: 451 GMDLSFPASSIILSDALPMEYQGMAGSLVNTIVNYSTSLCLGMGTTAEIQVNKNGTDLLK 510

Query: 474 GYRCSWYLGIGLSGFGIFVAATYAVSTFMKSKKRVS 509
           GYR + Y+GIGL   G+ +AA +   +  + + R +
Sbjct: 511 GYRAALYVGIGLGVVGVIIAALFLFESLRQKRGRTA 546

>Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116W
           (ATR1) - predicted protein is very hydrophobic, has many
           membrane-spanning regions, several potential
           glycosylation sites, potential ATP-binding site [contig
           38] FULL
          Length = 515

 Score =  335 bits (859), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 198/519 (38%), Positives = 300/519 (57%), Gaps = 27/519 (5%)

Query: 7   VTEENLDMNVETLKKDDEVLSDEFDVQEEK--PESLL---------WESAFVGVLCS--A 53
           + E + + N E L+       +E D Q E   P+S L         W+  ++ VL S  +
Sbjct: 3   MKENDDEENWEKLQSSSAA-GEERDGQTEAIGPKSRLQNPDYFDKPWKE-YIFVLSSMLS 60

Query: 54  QLMTQAGLGQSLAPLHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKF 113
           QL+ QA   Q+  PL  +      A   Q  W  +++ L  G+FIL++G++GDI+G KK 
Sbjct: 61  QLLNQAATTQT-NPLFDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKT 119

Query: 114 FVLGFFWYALWSLLAGFSVYSNQI-FFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRR-K 171
            + G+    +WSL+ G S Y++ + FF   R+FQG+G AF+LPN + I+G  YKP    K
Sbjct: 120 LLGGYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAK 179

Query: 172 NMVFSLFGASAPGGFVLGAVFSSMLG-QLAWWPWAYWLMGIACFLLAVAGYYLIPHTPMP 230
           N+VFSL GA AP G  LG VFS ++G +   W W ++   I   L  +   ++IP+  +P
Sbjct: 180 NLVFSLIGACAPIGATLGCVFSGLIGARTDLWGWTFYAYAITAALNGLVALWIIPNN-IP 238

Query: 231 NRDVASFKLLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTVFLIIFA 290
             +V  +K+    D+ GS  GV GLILFNF WNQ P+ GW + Y   LLIV  V LI F 
Sbjct: 239 T-NVNEYKM----DWIGSAIGVFGLILFNFVWNQAPIAGWGSAYIIVLLIVAVVALIAFI 293

Query: 291 FIESRXXXXXXX--XXXXSSDTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSA 348
             E R             +     +LS +  GW SFGIW FY   FM + R  +PL +  
Sbjct: 294 TYEIRFAKQPLLPHSVLFNRKLMMILSSLFFGWGSFGIWTFYYMSFMLNLRHYSPLWAGG 353

Query: 349 QFSPVAISGFCAALMTGFLLSHTPPSTVMFFAMTAFTVGTILIATAPVHQTYWAQTFVSI 408
            +   AI G  A+L+ G+ +  T P+ ++F +M AF  G I++A  PVHQTY+  T   +
Sbjct: 354 TYFMFAIWGIVASLLVGYTIHKTGPAVILFLSMVAFDCGCIMLAVTPVHQTYFRMTLGIM 413

Query: 409 IVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGG 468
           I++ +GMD+SFPAA+I+LSD +P ++QG+A SLV+T+++YS+S+ LGI+GT E  VN  G
Sbjct: 414 IILSFGMDLSFPAASIILSDQLPSQYQGMAGSLVSTMISYSMSLCLGISGTAEHQVNKNG 473

Query: 469 ANVLKGYRCSWYLGIGLSGFGIFVAATYAVSTFMKSKKR 507
            ++LKGY+ + Y+GIGL+  G+ ++  + +  +  S+++
Sbjct: 474 IDLLKGYQAALYVGIGLASLGVVISGAFMIEDWWTSRRK 512

>CAGL0B02343g Chr2 complement(222130..223743) [1614 bp, 537 aa] {ON}
           similar to uniprot|P13090 Saccharomyces cerevisiae
           YML116w ATR1 Aminotriazole resistance protein or
           uniprot|Q03263 Saccharomyces cerevisiae YMR279c
          Length = 537

 Score =  330 bits (847), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 199/510 (39%), Positives = 295/510 (57%), Gaps = 26/510 (5%)

Query: 20  KKDDEVLSDE--FDVQE-------EKPE---SLLWESAFVGVLCSAQLMTQAGLGQSLAP 67
           K+D+  + DE   D Q        + PE   S L E  F+     +QL+ QAG  Q+   
Sbjct: 27  KQDNNDIVDEKQCDTQAIDGNQKWQNPEYFDSTLKEYLFLCSCFVSQLLNQAGAIQTQPI 86

Query: 68  LHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLL 127
           ++I+ DS  + N G+ +W  +A+ L  G+FILI+GR+GDI+G KK  ++G+ +  +WSL+
Sbjct: 87  MNIVADSLDSQN-GKQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLI 145

Query: 128 AGFSVYSN-QIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPG-RRKNMVFSLFGASAPGG 185
            G + Y++   FF   RAFQG+G + +LPN + I+G  Y  G +RKNMV SL G  AP G
Sbjct: 146 CGLTKYAHSDSFFIVSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCMAPIG 205

Query: 186 FVLGAVFSSMLG--QLAWWPWAYWLMGIACFLLAVAGYYLIPHTPMPNRDVASFKLLERI 243
             LGAVFS ++G      WPWA++   I   +  V   +LIP+T   N          ++
Sbjct: 206 ATLGAVFSGLIGTEDANQWPWAFYSYAITAAINFVLSIWLIPNTIPTNVHG------HKM 259

Query: 244 DFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTVFLIIFAFIESRXXX---XX 300
           D+ GS  GVVGLI+ NF WNQ P+ GW + Y   LLI+  + LI F   E          
Sbjct: 260 DWIGSGLGVVGLIMLNFVWNQAPIDGWDSAYLIVLLIISVLLLIAFFIYELHFVNGNPLL 319

Query: 301 XXXXXXSSDTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAISGFCA 360
                 S  T  VL  +  GW SFGI+ FY + F  + R  TPL +   +    I G  A
Sbjct: 320 PKEVLKSPKTIIVLFALFFGWGSFGIFSFYYFTFQLNLRHYTPLWAGGTYFMFLIWGIVA 379

Query: 361 ALMTGFLLSHTPPSTVMFFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFP 420
           AL+ GF +    PS ++F +M AF  G+I+++  P+HQTY+      +I++ +GMD+SFP
Sbjct: 380 ALVVGFTIKKVYPSIILFLSMVAFNCGSIIMSVTPIHQTYFRNHLGMMIILSFGMDLSFP 439

Query: 421 AATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGANVLKGYRCSWY 480
           A++I+LSD +P ++QG+A SLVNT+VNYS+S  LG+AG +E +VN+ G +VLKGYR ++Y
Sbjct: 440 ASSILLSDKLPLQYQGMAGSLVNTMVNYSMSFCLGVAGVVEQHVNNHGKDVLKGYRGAFY 499

Query: 481 LGIGLSGFGIFVAATYAVSTFMKSKKRVSE 510
           LGIGL+     ++    +S  ++ +K   +
Sbjct: 500 LGIGLASMACIISGALMLSEIIQGRKNEKD 529

>NCAS0C00400 Chr3 (61257..62810) [1554 bp, 517 aa] {ON} Anc_8.843
          Length = 517

 Score =  328 bits (840), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 192/513 (37%), Positives = 299/513 (58%), Gaps = 19/513 (3%)

Query: 10  ENLDMNVETLKKD----DEVLSDEFDVQEEKP-ESLLWESAFVGVLCSAQLMTQAGLGQS 64
           EN +  V + +K     D +L +    Q E+  +S L E  F+     A L+ QAG  Q 
Sbjct: 2   ENKEPIVSSSQKKTLSCDSLLENSTPWQNEQYFQSHLKEYFFIFTCMFANLLNQAGQTQV 61

Query: 65  LAPLHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALW 124
           L+ +++I +SF  ++ G  +W  +++ L  G+FILI+GR+GDI+G KK  + G+ +  +W
Sbjct: 62  LSTMNVISESF-HSDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIW 120

Query: 125 SLLAGFSVYSN-QIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGR-RKNMVFSLFGASA 182
           +LL GF+ Y++   FF  CRAFQG+G +F+LPN + ++G  YK G  RKN+V SL G +A
Sbjct: 121 TLLCGFADYTHSDTFFIVCRAFQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIGITA 180

Query: 183 PGGFVLGAVFSSMLGQLA--WWPWAYWLMGIACFLLAVAGYYLIPHTPMPNRDVASFKLL 240
           P G  +GA++  ++   +   WPW ++   +A F+  +   Y +P     N  V +F + 
Sbjct: 181 PTGACMGALWGGLIATESSRQWPWIFYAYALAAFVNLIMAIYSVPENVPTN--VHNFAM- 237

Query: 241 ERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTVFLIIFAFIESRXXXXX 300
              D+ G++ GVVGLILFNF WNQGPV GW  PY   LLI+  +FL+ F   E +     
Sbjct: 238 ---DWMGAIIGVVGLILFNFVWNQGPVNGWAKPYIIVLLIISIIFLVAFIIYELKFPISP 294

Query: 301 XXXXXXSSDTAF--VLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAISGF 358
                 + +     +L  +  GW SFGIW FY + F  + R  +PL + A      I G 
Sbjct: 295 LLPREVTKNGQILTILGILFLGWGSFGIWTFYYYAFQLNLRNYSPLWAGATHFMFIIWGS 354

Query: 359 CAALMTGFLLSHTPPSTVMFFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMPWGMDMS 418
            AA + GF ++   P+ ++FF+   FT+G+++++  P+HQTYW       I++ +GMD+S
Sbjct: 355 IAAFIVGFTINRVGPAVLLFFSALGFTMGSLMLSVTPIHQTYWRMNVGMQIILSFGMDLS 414

Query: 419 FPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGANVLKGYRCS 478
           FPA++I+LSD +P ++QG+A SLVNT++NYS S+ LG+  T+E  +N  G  +L+GYR +
Sbjct: 415 FPASSIILSDHLPMQYQGMAGSLVNTIINYSTSLCLGMGTTVERQINKTGEELLRGYRSA 474

Query: 479 WYLGIGLSGFGIFVA-ATYAVSTFMKSKKRVSE 510
            YL +GL G G  VA        + K K R+ +
Sbjct: 475 LYLAVGLGGLGACVAFLNLCYDLWRKRKSRLDD 507

>TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {ON}
           Anc_8.843 YMR279C
          Length = 550

 Score =  328 bits (840), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 191/523 (36%), Positives = 297/523 (56%), Gaps = 22/523 (4%)

Query: 2   TLSSPVTEENLDMNVETLKKDDEVLSDEFDVQEEKPESLLWESAFVGVLCSAQLMTQAGL 61
           +L+S +T+    ++ +T   D+       D  + K +    E  F+      QL++QAGL
Sbjct: 40  SLNSSLTQV---LSTDTADNDESSSYQNPDYFKNKYQ----EFGFIFSGMIGQLLSQAGL 92

Query: 62  GQSLAPLHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWY 121
            Q+L+ ++++     + +  Q +W  S++ L +G+FIL++GRLGDI+G KK  + G+   
Sbjct: 93  TQTLSIMNVLAKELDSTSSRQ-AWLMSSFPLALGSFILVSGRLGDIYGLKKILLGGYIIT 151

Query: 122 ALWSLLAGFSVYS-NQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGR-RKNMVFSLFG 179
            +WS++ G S Y+ N  FF   RAFQG+G AF LPN I ++G  Y+PG  RKNM+ S+ G
Sbjct: 152 TVWSIICGLSSYAHNDAFFITARAFQGLGLAFALPNMIGLIGTIYRPGCFRKNMIISIIG 211

Query: 180 ASAPGGFVLGAVFSSMLGQL--AWWPWAYWLMGIACFLLAVAGYYLIPHTPMPNRDVASF 237
           A +P G  LG +F+ +  +   + WPW+++  G+  F+  +  +Y IP++   N  +   
Sbjct: 212 AMSPTGATLGGLFAGLTVKYDKSNWPWSFYAFGLISFVNLIISWYCIPNSIPTN--IHGL 269

Query: 238 KLLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTVFLIIFAFIESRXX 297
           K+    D+ GSV GV GLI+ NF +NQ P+VGWQ+ Y   LL++    L+IF   E +  
Sbjct: 270 KM----DWLGSVLGVFGLIILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYA 325

Query: 298 XXXXXXXXXSSDTAF--VLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAI 355
                    SS+     +L  +  GW SFGIW FY + F  + R  +PL + + +    I
Sbjct: 326 KTPLIPKAISSNRGMLMILFSLFCGWGSFGIWTFYYFSFELNLRHYSPLWAGSSYFIFVI 385

Query: 356 SGFCAALMTGFLLSHTPPSTVMFFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMPWGM 415
           SG   A++ G  +    PS +   +M  F  G I+ A  PV+QT++      + ++P GM
Sbjct: 386 SGSTVAIVCGLTIKKIKPSVLFCCSMMGFLGGNIIFAATPVNQTFFRNMLGCMFLLPLGM 445

Query: 416 DMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGANVLKGY 475
           D SFPA++I+LSDS+P ++QG+A SLVNTV+NYS SI LG+AGT+E   N  G ++L GY
Sbjct: 446 DFSFPASSIILSDSLPMQYQGMAGSLVNTVINYSTSICLGMAGTVEMKHNSHGKDLLNGY 505

Query: 476 RCSWYLGIGLSGFGIFVAATYAVSTFMKSKKRVSE--KQHFIE 516
           R + Y  IGL+G  + V+  Y +    K +    E  KQ  IE
Sbjct: 506 RAAIYFAIGLAGLAVCVSGGYMIECLWKDRVLSLEENKQTDIE 548

>Smik_13.492 Chr13 complement(807726..809357) [1632 bp, 543 aa] {ON}
           YMR279C (REAL)
          Length = 543

 Score =  327 bits (839), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 193/521 (37%), Positives = 286/521 (54%), Gaps = 16/521 (3%)

Query: 1   MTLSSPVTEENLDMNVETLKKDDEVLSDEFDVQEEKP---ESLLWESAFVGVLCSAQLMT 57
           M +   V     D  V T+   +E      D   + P    S   E  F+     AQL+ 
Sbjct: 24  MKVDDKVVISTEDEEVTTVTSSNESNQVTNDSPWQDPIYFSSFGKELMFIATCMLAQLLN 83

Query: 58  QAGLGQSLAPLHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLG 117
           QAG   +L  ++++  SF + +  Q +W  +++ L  G+FILI+GRLGDI+G KK  ++G
Sbjct: 84  QAGQTHALCIMNVLSKSFNSESNNQ-AWLMASFPLAAGSFILISGRLGDIYGLKKMLLIG 142

Query: 118 FFWYALWSLLAGFSVYSN-QIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGR-RKNMVF 175
           +    +WS+++G S YSN   FF  CRAFQG+G AF+LPN + ++G  YK G  RKN+V 
Sbjct: 143 YVIIIIWSIISGLSKYSNSDAFFITCRAFQGLGIAFILPNIMGLVGHVYKVGSLRKNLVI 202

Query: 176 SLFGASAPGGFVLGAVFSSML--GQLAWWPWAYWLMGIACFLLAVAGYYLIPHTPMPNRD 233
           S+ GA AP G + G VF  ++       WPW ++   IA F+  +  +Y IP+    N  
Sbjct: 203 SVIGACAPAGGMFGGVFGGLIVTEDPEQWPWVFYAFSIATFISLLMAWYSIPNNVPTNVH 262

Query: 234 VASFKLLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTVFLIIFAFIE 293
             S      +D+ GS   V+GLILFNF WNQ P+ GW   Y   LLI+   FLI F   E
Sbjct: 263 GLS------MDWTGSTLAVLGLILFNFVWNQAPIAGWGEAYIIVLLILSVFFLIAFFVYE 316

Query: 294 SRXXXXXXXXXXXSSDTAFVLSCIAA--GWASFGIWIFYTWQFMEDSRGQTPLLSSAQFS 351
            +           + +   ++  +A   GW SFGIW FY   F  + R  +P+ +   + 
Sbjct: 317 IKYAEVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYVSFQLNLRHYSPVWTGGTYF 376

Query: 352 PVAISGFCAALMTGFLLSHTPPSTVMFFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVM 411
              I G  AA    F +    P+ ++ FA+ AF  G+I+ +  PV Q+YW   F    ++
Sbjct: 377 VFVIFGSIAAFFVAFSIKRLGPAILLCFALMAFDAGSIMFSVLPVEQSYWKLNFAMQAIL 436

Query: 412 PWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGANV 471
            +GMD+SFPA++I+LSD +P ++QG+A SLVNTV+NYS S+ LG+  T+E  +N  G N+
Sbjct: 437 CFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGMGVTVERQINKSGQNL 496

Query: 472 LKGYRCSWYLGIGLSGFGIFVAATYAVSTFMKSKKRVSEKQ 512
           LKGYR + YLGIGL+  G+ ++ TY +  F    K   +K+
Sbjct: 497 LKGYRAAIYLGIGLASLGLLISVTYMLENFWNKHKESEKKR 537

>YMR279C Chr13 complement(824729..826351) [1623 bp, 540 aa] {ON}
           Putative boron transporter involved in boron efflux and
           resistance; overexpression mutant but not null mutant
           displays boron tolerance phenotype; identified as a
           heat-induced gene in a high-throughout screen; YMR279C
           is not an essential gene; paralog of the efflux pump
           ATR1
          Length = 540

 Score =  327 bits (839), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 190/530 (35%), Positives = 291/530 (54%), Gaps = 33/530 (6%)

Query: 8   TEENLDMNVETLKKDDEVLSDEFD-------------VQEEKP-------ESLLWESAFV 47
           T+  +D  +    KD  V+S E +             V  + P        S   E  F+
Sbjct: 14  TDSEIDEKITVKAKDKVVVSTEDEEVTTIVSSTKSTQVTNDSPWQDPTYFSSFGKELMFI 73

Query: 48  GVLCSAQLMTQAGLGQSLAPLHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDI 107
                AQL+ QAG   +L  ++++  SF +    Q +W  +++ L  G+FILI+GRLGDI
Sbjct: 74  ATCMLAQLLNQAGQTHALCIMNVLSKSFNSEANNQ-AWLMASFPLAAGSFILISGRLGDI 132

Query: 108 FGHKKFFVLGFFWYALWSLLAGFSVYSN-QIFFDCCRAFQGMGPAFLLPNAIAILGRTYK 166
           +G KK  ++G+    +WS+++G S YSN   FF   RAFQG+G AF+LPN + ++G  YK
Sbjct: 133 YGLKKMLIVGYVIVIVWSIISGLSKYSNSDAFFITSRAFQGVGIAFILPNIMGLVGHVYK 192

Query: 167 PGR-RKNMVFSLFGASAPGGFVLGAVFSSML--GQLAWWPWAYWLMGIACFLLAVAGYYL 223
            G  RKN+V S  GA AP G + G +F  ++       WPW ++  GIA FL  +  +Y 
Sbjct: 193 VGSFRKNIVISFIGACAPTGGMFGGLFGGLIVTEDPNQWPWVFYAFGIATFLSLLMAWYS 252

Query: 224 IPHTPMPNRDVASFKLLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGT 283
           IP+    N    S      +D+ GS   ++GLILFNF WNQ P+VGW  PY   LLI+  
Sbjct: 253 IPNNVPTNIHGLS------MDWTGSALAIIGLILFNFVWNQAPIVGWDKPYIIVLLIISV 306

Query: 284 VFLIIFAFIESRXXXXXXXXXXXSSDTAFVLSCIAA--GWASFGIWIFYTWQFMEDSRGQ 341
           +FL+ F   ES+           + +   ++  +A   GW SFGIW FY   F  + R  
Sbjct: 307 IFLVAFFVYESKYAEVPLLPRAMTKNRHMIMILLAVFLGWGSFGIWTFYYVSFQLNLRHY 366

Query: 342 TPLLSSAQFSPVAISGFCAALMTGFLLSHTPPSTVMFFAMTAFTVGTILIATAPVHQTYW 401
           +P+ +   +    I G  AA    F +    P+ ++ F++ AF  G+I+ +  PV Q+YW
Sbjct: 367 SPVWTGGTYFVFVIFGSMAAFFVAFSIKRLGPALLLCFSLMAFDAGSIMFSVLPVEQSYW 426

Query: 402 AQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIE 461
              F    ++ +GMD+SFPA++I+LSD +P ++QG+A SLVNTV+NYS S+ LG+ GT+E
Sbjct: 427 KLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGMGGTVE 486

Query: 462 SNVNDGGANVLKGYRCSWYLGIGLSGFGIFVAATYAVSTFMKSKKRVSEK 511
             +N  G ++LKGYR + YLG+GL+  G+ ++ TY +       ++  ++
Sbjct: 487 HQINKSGNDLLKGYRAAVYLGVGLASLGVVISVTYMLENLWNRHRKSEDR 536

>NCAS0B00290 Chr2 (33760..35388) [1629 bp, 542 aa] {ON} Anc_8.843
          Length = 542

 Score =  327 bits (837), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 198/520 (38%), Positives = 309/520 (59%), Gaps = 24/520 (4%)

Query: 4   SSPVTEENLDM---NVETLKKDDEVLSDEFDVQEEKPESLLW------ESAFVGVLCSAQ 54
           +S +TEE   +   ++E ++KD    ++   ++  K ++  +      E  F+     +Q
Sbjct: 20  ASSITEETSIIKHGDIEEIEKDVISQTETPQLEHSKWQNPDYFQNQWQEYLFIFSCMMSQ 79

Query: 55  LMTQAGLGQSLAPLHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFF 114
           L+ QA   Q+L+ ++II DSF +   G+ +W  +++ L  G+FILI+GR+GDI+G KK  
Sbjct: 80  LLNQAATPQTLSIMNIITDSFNSEG-GKETWLIASFPLVSGSFILISGRIGDIYGLKKTL 138

Query: 115 VLGFFWYALWSLLAGFSVYSN-QIFFDCCRAFQGMGPAFLLPNAIAILGRTYKP-GRRKN 172
           V G+ ++ +WS+++G + YS+   FF   RAFQG+  AF+LPN + I+G  YKP   RKN
Sbjct: 139 VGGYIFFIIWSIISGLTKYSHSDTFFIVSRAFQGLSIAFILPNVMGIVGNIYKPDSNRKN 198

Query: 173 MVFSLFGASAPGGFVLGAVFSSMLG--QLAWWPWAYWLMGIA-CFLLAVAGYYLIPHTPM 229
           +V S+ GASAP G   G++F+ ++G      WPWA++   IA  F LA++  Y IP++  
Sbjct: 199 IVISMIGASAPIGAFFGSLFAGLIGTEDPDQWPWAFYAFAIASAFNLAIS-IYSIPNSVP 257

Query: 230 PNRDVASFKLLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTVFLIIF 289
            N  V  F +    D+ GSV  V+GLIL NF WNQGP+VGWQT Y  ALL+V   FL +F
Sbjct: 258 TN--VHGFAM----DWIGSVLAVIGLILLNFVWNQGPIVGWQTAYIIALLVVSVFFLALF 311

Query: 290 AFIESRXXXXXXXXXXXSSDTAFV--LSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSS 347
              E +           + +   +  L+ +  GW SFGI+ FY + F+ + R  + L + 
Sbjct: 312 FTYEVKYAESPLLPVEVTKNRHIIMILAALFLGWGSFGIFSFYYFSFLLNLRHYSALWAG 371

Query: 348 AQFSPVAISGFCAALMTGFLLSHTPPSTVMFFAMTAFTVGTILIATAPVHQTYWAQTFVS 407
             +   AI G  AA++ G  +     + ++F +M AF +G I+++  PV QTY+     +
Sbjct: 372 TTYFMFAIWGTVAAVIVGAFIKKISAAFILFMSMVAFNIGIIMLSVTPVDQTYFRMNLGT 431

Query: 408 IIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDG 467
           +I++ +GMDMSFPAA I+LSD +  ++QG+A SL NT+VNYS+S+ LG+  T+E  +N  
Sbjct: 432 MIILSFGMDMSFPAAAIILSDGLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKS 491

Query: 468 GANVLKGYRCSWYLGIGLSGFGIFVAATYAVSTFMKSKKR 507
           G ++LKGYR + YLGIGL+G GI + A Y        +K+
Sbjct: 492 GNDLLKGYRGAEYLGIGLAGLGIIITAIYLGEILWGKRKQ 531

>KNAG0G03430 Chr7 complement(734828..736456) [1629 bp, 542 aa] {ON}
           Anc_8.843 YMR279C
          Length = 542

 Score =  325 bits (833), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 185/476 (38%), Positives = 279/476 (58%), Gaps = 15/476 (3%)

Query: 43  ESAFVGVLCSAQLMTQAGLGQSLAPLHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAG 102
           E  FVG    +QL+ QA + Q+L+ ++I+  SF  +N    +W  +++ L  G+FILI+G
Sbjct: 68  EYIFVGTCMMSQLLNQACIPQTLSLMNILTKSF-HSNAKNQTWLMASFPLVSGSFILISG 126

Query: 103 RLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSN-QIFFDCCRAFQGMGPAFLLPNAIAIL 161
           R+GDI+G K   V G  ++ +W+L++GF+ Y++   FF   R+FQG+G AF+LPN +  +
Sbjct: 127 RVGDIYGLKWSLVGGNIFFIIWALISGFTNYTHSDTFFIVSRSFQGLGVAFILPNVMGCV 186

Query: 162 GRTYKPGR-RKNMVFSLFGASAPGGFVLGAVFSSMLGQLA--WWPWAYWLMGIACFLLAV 218
           G  YKP   RKN+V SL GA AP G  +GA F+ ++G      WPW+++ M IA  L  +
Sbjct: 187 GNIYKPNTFRKNIVISLIGACAPVGAFMGAFFAGLIGTKNPDDWPWSFYAMAIASTLTLL 246

Query: 219 AGYYLIP-HTPMPNRDVASFKLLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYA 277
              Y IP H P    +V  F +    D+ GS   VVGLIL NF WNQGP+ GW   Y   
Sbjct: 247 GALYSIPNHIP---TNVHGFSM----DWIGSGLAVVGLILLNFVWNQGPIDGWGKAYIIV 299

Query: 278 LLIVGTVFLIIFAFIESRXXXXXXXXXXXSSDTAFVLSCIAA--GWASFGIWIFYTWQFM 335
           LLIV    L +F   E             + +   V+  +A   GW SFGI+ FY + F+
Sbjct: 300 LLIVSVFVLTLFFIYEVHYAASPLLPRVITQNRHMVMILMALFLGWGSFGIFSFYYFAFL 359

Query: 336 EDSRGQTPLLSSAQFSPVAISGFCAALMTGFLLSHTPPSTVMFFAMTAFTVGTILIATAP 395
            + R  + + +   +   AI G  A+++ G  +     S ++FF+M AF VG I+++  P
Sbjct: 360 LNLRHYSTVWAGGTYFMFAIWGVVASVVVGLSIRKISASIILFFSMIAFDVGIIMLSVTP 419

Query: 396 VHQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLG 455
           V QTY+     ++I++ +GMDMSFPAA I+LSDS+P+++QG+A SL NT+VNYS+S+ LG
Sbjct: 420 VKQTYFRMNLGTMIILSFGMDMSFPAAAIILSDSLPNQYQGMAGSLANTMVNYSMSLCLG 479

Query: 456 IAGTIESNVNDGGANVLKGYRCSWYLGIGLSGFGIFVAATYAVSTFMKSKKRVSEK 511
           +  T+ES +N  G ++LKGYR + YLGIG++   + ++  Y        +K   E 
Sbjct: 480 MGSTVESQINQNGKDLLKGYRAAEYLGIGIASLAVILSLIYMCERLWIDRKERMES 535

>KNAG0D00130 Chr4 complement(6264..7961) [1698 bp, 565 aa] {ON}
           YOR378W
          Length = 565

 Score =  324 bits (831), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 195/524 (37%), Positives = 297/524 (56%), Gaps = 19/524 (3%)

Query: 4   SSPVTEENLDMNVETLKKDDEVLSDEFDVQEEKPE-----SLLWESAFVGVLCSAQLMTQ 58
            S  T  + D NV  + K      +E D      E     SLL E  FV ++ S+Q++  
Sbjct: 35  DSSKTRRDSDDNVSDINKSAPA-PEEHDPPCTGEEATLNMSLLHEIIFVLLVSSSQVLGL 93

Query: 59  AGLGQSLAPLHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGF 118
           AG  Q +  + +I + F   +P    W    Y+ T G+F+LIAG++GD+ GHK  F++G+
Sbjct: 94  AGAVQGIPQMDVIVEWFKLTHPSDSGWCNGGYATTYGSFVLIAGKMGDMNGHKSMFLIGY 153

Query: 119 FWYALWSLLAGFSVYS-NQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSL 177
            W ALWSLL GFS Y  +  FF  CRA QG+G AF   +A++ILG++Y P +RKN +FS 
Sbjct: 154 AWLALWSLLTGFSRYCPSSHFFFFCRAAQGIGAAFTFTSALSILGKSYPPCKRKNFIFSF 213

Query: 178 FGASAPGGFVLGAVFSSMLGQLAWWPWAYWLMGIACFLLAVAGYYLIPHTPMPNRDVASF 237
           FGA    G VLG VFS++  QLA W WAYW M IAC ++ +   + IP   +   + ++ 
Sbjct: 214 FGACGSFGVVLGMVFSALFTQLAHWSWAYWSMAIACVVIIILSIFFIPGDVVEKHETSN- 272

Query: 238 KLLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTVFLIIFAFIESRXX 297
             +   D+ G+   V GL+LF+ AWNQ P  G+   Y Y LLIV  V L +  ++E++  
Sbjct: 273 --VFYFDYLGAFLFVTGLVLFSVAWNQAPTYGFGRTYVYVLLIVSVVILALAMYVETKVD 330

Query: 298 XXXXXXXXXSSDTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAISG 357
                    S++T  VL  I   +ASF +W  YT++F   ++G T LL++A+ +P+A+SG
Sbjct: 331 DPLLPWTHISANTLKVLLAIFFAYASFTMWAAYTFRFNLMAKGDTLLLAAAKMTPMAVSG 390

Query: 358 FCAALMTGFLLS-HTPPSTVMFFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMPWGMD 416
             AAL +  LL+ H      M  ++ AF V  IL+AT    QTYW + FV+ IV+ +G+D
Sbjct: 391 VFAALFSALLLNIHVQVQIRMLISLLAFLVPPILMATMGAGQTYWGEVFVTTIVISFGLD 450

Query: 417 MSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTI------ESNVNDGGAN 470
           +SFP+AT++LS+ +P + +GL ASLV  V+NY+ ++G   A ++      +   + G A 
Sbjct: 451 ISFPSATLLLSNRIPDKFKGLGASLVGAVLNYATALGPPTAASVLRYQCPDCMAHKGNA- 509

Query: 471 VLKGYRCSWYLGIGLSGFGIFVAATYAVSTFMK-SKKRVSEKQH 513
             K      Y+GIG +G G  VA    ++ + K + K+  +++H
Sbjct: 510 FTKTINIIGYVGIGTAGLGTLVAIFGVITEYPKVAGKKGEDRKH 553

>KLTH0C03806g Chr3 (332195..333772) [1578 bp, 525 aa] {ON} similar
           to uniprot|P13090 Saccharomyces cerevisiae YML116W ATR1
           Multidrug efflux pump of the major facilitator
           superfamily required for resistance to aminotriazole and
           4-nitroquinoline-N-oxide
          Length = 525

 Score =  320 bits (821), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 188/523 (35%), Positives = 297/523 (56%), Gaps = 18/523 (3%)

Query: 5   SPVTEENLDMN-----VETLKKDDEVLSDEFDVQEEKPESLLW-ESAFVGVLCSAQLMTQ 58
           +PV+++    +     V+  +  D +L+    +Q        W E  FV     +QL+ Q
Sbjct: 6   TPVSKQRTGSDISRKVVDNHEDSDMLLASRSRLQNPDYFDKQWKEYLFVISSMLSQLLNQ 65

Query: 59  AGLGQSLAPLHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGF 118
           A   Q+     ++ +    A   Q +W  +++ L  G+FIL++G++GDI+G KK  + G+
Sbjct: 66  AAALQANPLFDLLSEDL-KAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGY 124

Query: 119 FWYALWSLLAGFSVYSNQI-FFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRR-KNMVFS 176
               +WSL+ G S Y++ + FF   R+FQG+G AF+LPN   I+G  YKP  + KNMVFS
Sbjct: 125 AVVVIWSLICGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFS 184

Query: 177 LFGASAPGGFVLGAVFSSMLG-QLAWWPWAYWLMGIACFLLAVAGYYLIPHTPMPNRDVA 235
           + GA AP G  LG +FS ++G +   W W ++   I   L  +  +Y+IP     N  V 
Sbjct: 185 MIGACAPIGATLGCLFSGLIGTESEAWAWTFYAYTIVAALNGLIAWYVIPDNIPTN--VH 242

Query: 236 SFKLLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTVFLIIFAFIESR 295
            FK+    D+ GS  GV GLI+FNF WNQ P  GW + Y   LL++  + L+IF   E+R
Sbjct: 243 KFKM----DWLGSFLGVCGLIMFNFVWNQAPTDGWDSAYIIVLLVISVILLLIFIIFEAR 298

Query: 296 XXXXXX--XXXXXSSDTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPV 353
                        +     +L+ +  GW SFGIW +Y   F+ + R  TPL +   +   
Sbjct: 299 FAKEPLLPRAVLFNRKLMMILASLFLGWGSFGIWTYYYMAFVLNLRHYTPLWAGGSYFMF 358

Query: 354 AISGFCAALMTGFLLSHTPPSTVMFFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMPW 413
           AI G  AA + G  +  T P+ ++  ++ AF VG I+++  PV QTY+  +  +++++ +
Sbjct: 359 AIFGTIAAFLVGHTIHKTGPAIILLASVIAFDVGCIMLSVTPVDQTYFRMSLGTMVILSF 418

Query: 414 GMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGANVLK 473
           GMD+SFPA++I+LSD +P ++QG+A SLVNT++NYS+S+ LG++GT E  VN  G ++LK
Sbjct: 419 GMDLSFPASSIILSDQLPSQYQGMAGSLVNTMINYSMSLCLGVSGTAERQVNKDGTDLLK 478

Query: 474 GYRCSWYLGIGLSGFGIFVAATYAVSTFMKSKKRVSEKQHFIE 516
           GYR + Y+GIGL+  GIFV+  YA+  +   ++  S +    E
Sbjct: 479 GYRAALYVGIGLASVGIFVSGAYAIEDWWTRRRERSVRIKLDE 521

>KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {ON}
           Anc_8.843 YMR279C
          Length = 547

 Score =  311 bits (797), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 180/523 (34%), Positives = 283/523 (54%), Gaps = 26/523 (4%)

Query: 9   EENLDMNVETLKKD------DEVLSDEFDVQEEKP---ESLLWESAFVGVLCSAQLMTQA 59
           + +LD+  +++KKD      D+V S   + + + P   +S   E  F+G    A L+ QA
Sbjct: 30  QTSLDVLSDSVKKDQISITDDDVSSISNNSKWQDPTYFKSSWQEYTFIGTCMLANLLNQA 89

Query: 60  GLGQSLAPLHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFF 119
           G  Q+L+ ++++ DS  +    + +W  ++++L  G+FIL++GR+GDI+G K  F+ G  
Sbjct: 90  GQTQTLSTMNVLADSLNSDGAAK-TWLMASFTLASGSFILVSGRIGDIYGLKATFIGGNI 148

Query: 120 WYALWSLLAGFSVYSNQI-FFDCCRAFQGMGPAFLLPNAIAILGRTYKPGR-RKNMVFSL 177
            + +WS+L G S Y+  + FF  CRAFQG+G AF+LPN + ++G  Y  G  RKN+V S 
Sbjct: 149 IFCIWSILCGVSKYTENVTFFIICRAFQGLGVAFVLPNVMGLVGNIYNVGSMRKNIVISF 208

Query: 178 FGASAPGGFVLGAVFSSML--GQLAWWPWAYWLMGIACFLLAVAGYYLIP-HTPMPNRDV 234
            G  AP G   G ++  ++       WPW ++   IA F+  + G Y IP H P    ++
Sbjct: 209 IGCMAPVGQTFGGMWGGLIVDSNKDQWPWIFFATAIAVFINLIMGIYSIPNHVPTNIYNL 268

Query: 235 ASFKLLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTVFLIIFAFIES 294
                  ++D+ GS+ GV+GLIL NF WNQ P+ GW   Y   +LIV   FL+ F   E 
Sbjct: 269 -------KMDWIGSLLGVIGLILMNFVWNQAPISGWSKAYIIVILIVAVFFLVAFFIYEL 321

Query: 295 RXXXXXXXXXXXSSDTAFVLSCIAA--GWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSP 352
           +           + +   V   I+   GW +FGIW FY + F  + R  +PL + +    
Sbjct: 322 KKAESPLLPPEVTKNRHIVTIIISLFLGWGAFGIWTFYYYAFNLNLRHFSPLWAGSTHFV 381

Query: 353 VAISGFCAALMTGFLLSHTPPSTVMFFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMP 412
             I G   A+   F ++   PS +   +   FT G I+ +     QTYW  +    I++ 
Sbjct: 382 FIIFGSLTAITVAFTINKVGPSVLFCLSSIGFTCGNIIFSVTSPDQTYWRNSLGMQIILA 441

Query: 413 WGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGANVL 472
            GMD+SFP ++I+LSD +P ++QG++ SLVNT+ NY+ S+ LG+  T E   N+GG +VL
Sbjct: 442 LGMDLSFPGSSIILSDLLPMQYQGMSGSLVNTITNYATSLCLGMGTTAEVQYNNGGKDVL 501

Query: 473 KGYRCSWYLGIGLSGFGIFVAATYAVSTF--MKSKKRVSEKQH 513
           KGYR + Y+ IGL   G   + +Y          K+R +EK+ 
Sbjct: 502 KGYRAALYVAIGLGALGFAFSFSYMAEDLWIRYRKRRQNEKKE 544

>KAFR0C04860 Chr3 (964552..966156) [1605 bp, 534 aa] {ON}  YOR378W
          Length = 534

 Score =  303 bits (776), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 181/523 (34%), Positives = 290/523 (55%), Gaps = 21/523 (4%)

Query: 4   SSPVTEENLDMNVETLKKDDEVLSDEFDVQEEKPESLLWESAFVGVLCSA-QLMTQAGLG 62
           SS +        V+ +   +E+LS      +E P ++ ++   + +L S+ Q ++  G  
Sbjct: 12  SSKLQPHEPTSPVKVVPSHNEILSKT----DEHPLNMQFKEIIIVLLISSGQFISLLGAV 67

Query: 63  QSLAPLHIIGDSFGTANPGQ---LSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFF 119
           Q +  +  I  +F +  P Q   L W  +AY+ T  TF++IAG+LGDI GHK  F+ G+ 
Sbjct: 68  QGIPQMASIASTF-SLRPDQNLELGWCNAAYATTATTFVIIAGKLGDINGHKNMFIFGYA 126

Query: 120 WYALWSLLAGFSVYS--NQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSL 177
           W  LWSLL GFS Y+  N +FF  CR  QG+G AFL P  +A+LG+ Y P +RKN VFS 
Sbjct: 127 WLTLWSLLTGFSKYAKANAVFFYFCRGAQGIGSAFLTPTGLALLGKHYPPCKRKNYVFSF 186

Query: 178 FGASAPGGFVLGAVFSSMLGQLAWWPWAYWLMGIACFLLAVAGYYLIPHTPMPNRDVASF 237
           +GA  P G V G+VFS++  QL  W W YW M + C ++ +  Y  IP    P R+ ++F
Sbjct: 187 YGACGPFGIVAGSVFSALFTQLTTWAWTYWSMAVTCLIITILSYIFIPKDNTPKRERSAF 246

Query: 238 KLLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTVFLIIFAFIESRXX 297
                 D+ G   G+ G+ILF+  WNQ P+  ++ PY Y+LLIV  VF+ +   I+SR  
Sbjct: 247 ---YSFDYVGGFCGITGMILFSVVWNQAPLSHFKAPYVYSLLIVSVVFMTMALIIDSRVK 303

Query: 298 XXXXXXXXXSSDTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAISG 357
                     S+    L  +  G+  F IW+FY+W+F   ++  + LL++A+F P+ ISG
Sbjct: 304 DPLIPWKSMCSNVIKALIVVFFGFLGFTIWLFYSWRFYLVAKNDSLLLAAAKFIPLGISG 363

Query: 358 FCAALMTGFLLSHTPPSTV-MFFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMPWGMD 416
             AA  +  LL+   P  + +  A+ AF +  ILI+T  + +TYW   FV+ +++  G+D
Sbjct: 364 IFAACFSVLLLNKKVPVQLRLLTAVCAFLICAILISTMTLQETYWGNAFVATVIIAIGLD 423

Query: 417 MSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTI-----ESNVNDGGANV 471
           ++FP+AT++LS+ + +E QGLAA+L  T +NY  ++G G+A  I     +  +       
Sbjct: 424 VAFPSATLLLSNGVLNEQQGLAAALAATALNYGTALGPGVATLIITYQCDDCLARSDGRF 483

Query: 472 LKGYRCSWYLGIGLSGFGIFVAATYAVSTFMKSK-KRVSEKQH 513
           +     + Y+ IG +G  + VA   +++ + K +   + EK+ 
Sbjct: 484 VHAVHIAGYVAIGTAGIAVVVAIFGSITEYYKERMDDLREKKR 526

>KAFR0A02840 Chr1 complement(588197..589759) [1563 bp, 520 aa] {ON}
           Anc_8.843 YMR279C
          Length = 520

 Score =  292 bits (748), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 178/485 (36%), Positives = 271/485 (55%), Gaps = 22/485 (4%)

Query: 9   EENLDMNVETLKKDDEVLSDEFDVQEEKP-------ESLLWESAFVGVLCSAQLMTQAGL 61
           +E++  ++   K  +E    E  V+E+         ++   E  FVG   + QL+ QA  
Sbjct: 10  KEHIQSDISIDKSSNE--KCEVIVREKSKWQDPGYFKNSFQEYLFVGSCMTTQLLNQATT 67

Query: 62  GQSLAPLHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWY 121
            Q+L+ ++++ DSF ++   Q +W  +++ L  G+FILI+GR+GDI+G KK  + G+ + 
Sbjct: 68  PQTLSIMNVLSDSFNSSRSNQ-TWLVASFPLVAGSFILISGRIGDIYGLKKTLIGGYIFL 126

Query: 122 ALWSLLAGFSVYS-NQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGR-RKNMVFSLFG 179
            +WSL+ GF+ YS +  F    RAFQG+G AF LPN +  +G  Y  G  RKNMV SL  
Sbjct: 127 IIWSLICGFTYYSKSDTFLIIARAFQGLGIAFTLPNVVGTIGNIYHVGSLRKNMVISLIA 186

Query: 180 ASAPGGFVLGAVFSSML--GQLAWWPWAYWLMGIACFLLAVAGYYLIPHTPMPNRDVASF 237
           ASAP G  +G  F+ ++     + WPW+++   IAC    +   Y IP   +P  +V  F
Sbjct: 187 ASAPVGAAIGGAFAGLIVTESPSQWPWSFYAFAIACSFNLLISIYSIPSN-IPT-NVNGF 244

Query: 238 KLLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTVFLIIFAFIESRXX 297
           K+    D+ GS   V GLILFNFAWNQGP+VGW   Y   LLI+  +F++ F   E    
Sbjct: 245 KM----DWIGSALIVTGLILFNFAWNQGPIVGWDIAYIIVLLIISVIFILAFLTYEINFA 300

Query: 298 XXXXXXXXXSSDTAFVLSCIAA--GWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAI 355
                    +     +++      GW S+GIW FY + F+ + R  +P+ +   +    I
Sbjct: 301 PSPLIAREITHSRNMIITIFTLFLGWGSYGIWSFYYFSFVLNLRHYSPVWAGGSYFIFGI 360

Query: 356 SGFCAALMTGFLLSHTPPSTVMFFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMPWGM 415
            G  A+   G  +       ++ F+M  F VGT L++ APV Q+Y+  T   + ++  G+
Sbjct: 361 FGVLASAFVGISIKKITAPVILLFSMVLFCVGTTLLSVAPVDQSYFKLTLAGMAILGVGL 420

Query: 416 DMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGANVLKGY 475
           D SFPAATI+LSD +P E+QG+A SL  T+VNYS+S+ LG+  T+E  +N  G +VLKGY
Sbjct: 421 DTSFPAATIILSDGLPMEYQGMAGSLALTMVNYSMSLCLGMGNTVERQINKDGQDVLKGY 480

Query: 476 RCSWY 480
           R + Y
Sbjct: 481 RSAEY 485

>CAGL0M03003g Chr13 complement(337942..339618) [1677 bp, 558 aa]
           {ON} similar to uniprot|Q03263 Saccharomyces cerevisiae
           YMR279c or uniprot|P13090 Saccharomyces cerevisiae
           YML116w ATR1
          Length = 558

 Score =  291 bits (745), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 188/498 (37%), Positives = 282/498 (56%), Gaps = 15/498 (3%)

Query: 22  DDEVLSDEFDVQEEKPESLLWESAFVGVLCSAQLMTQAGLGQSLAPLHIIGDSFGTANPG 81
           DD   +D      E  E+   E  F+     AQL+ QAG  QSL+ ++++ D F  +N  
Sbjct: 64  DDCHENDSPFQNPEYFETGFKEVMFIISCMVAQLLNQAGQTQSLSTMNVLADYF-KSNSS 122

Query: 82  QLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSN-QIFFD 140
           +  W  +++ L  G+FILI+GRLGDI+G KK   +G+    LWS++ G + Y+N   FF 
Sbjct: 123 KQPWLMASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIICGLAKYTNSDAFFI 182

Query: 141 CCRAFQGMGPAFLLPNAIAILGRTYKPGR-RKNMVFSLFGASAPGGFVLGAVFSSML--G 197
            CR+FQG+G AF+LPN + ++G  YK G  RKN+V S  G  AP G  LGA+F  ++   
Sbjct: 183 VCRSFQGLGIAFILPNIMGLVGNIYKVGTLRKNIVISCIGCMAPAGAALGALFGGLIVTE 242

Query: 198 QLAWWPWAYWLMGIACFLLAVAGYYLIPHTPMPNRDVASFKLLERIDFAGSVTGVVGLIL 257
               WPW ++  GIA F+  +   Y IP+    N +  +      +D+ GS+ GV GL+L
Sbjct: 243 DAEQWPWVFYAFGIASFVNMLLALYSIPNNVPTNLNNLN------MDWIGSLLGVSGLLL 296

Query: 258 FNFAWNQGPVVGWQTPYTYALLIVGTVFLIIFAFIESRXXXXXXX--XXXXSSDTAFVLS 315
            N  WNQ P+VGW   Y   LLI+  + L+IF   E +             +     +L+
Sbjct: 297 LNIVWNQAPIVGWGEAYIIVLLIISIILLLIFVVYEIKYATSPLLPPSVLENKKILMILA 356

Query: 316 CIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAISGFCAALMTGFLLSHTPPST 375
            +  GW SFGIW +Y + F  + R  TPL +        I G  AA +    +    P+ 
Sbjct: 357 ALFFGWGSFGIWTYYYYAFQLNLRKYTPLWAGGTHFMFVIWGTVAAFVVALTIKKVGPAV 416

Query: 376 VMFFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQ 435
           ++ F+M AF  G+I+++  PVHQTYW       I++ +GMD+SFPA++I+LSD +P ++Q
Sbjct: 417 LLCFSMVAFDCGSIMLSVTPVHQTYWRMNVGMQIILSFGMDLSFPASSIILSDFLPMQYQ 476

Query: 436 GLAASLVNTVVNYSISIGLGIAGTIESNVNDGGANVLKGYRCSWYLGIGLSGFGIFVAAT 495
           G+A SLVNTVVNYS S+ LG+  T+E   N  GA++LKGYR + YL IGL+  G+ V+  
Sbjct: 477 GMAGSLVNTVVNYSTSLCLGMGNTVEQQYNAHGADLLKGYRSALYLAIGLASAGVCVSLV 536

Query: 496 YAVSTFM--KSKKRVSEK 511
           + V+  +  + +KR+  +
Sbjct: 537 FLVTDIIAKRHRKRIESE 554

>CAGL0L02519g Chr12 complement(297555..299144) [1590 bp, 529 aa]
           {ON} similar to uniprot|Q08902 Saccharomyces cerevisiae
           YOR378w
          Length = 529

 Score =  289 bits (739), Expect = 7e-91,   Method: Compositional matrix adjust.
 Identities = 176/476 (36%), Positives = 262/476 (55%), Gaps = 12/476 (2%)

Query: 29  EFDVQEEKPESLLWESAFVGVLCSAQLMTQAGLGQSLAPLHIIGDSFGT--ANPGQLSWF 86
           E D     P++ + E   V +L S+QL+T  G  Q +     + + +    A  G + W 
Sbjct: 24  EVDTSIRLPKTWIREIFLVIILISSQLVTLIGAVQGVPIAAYLRERYRIEPAKGGLVGWA 83

Query: 87  ASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYS--NQIFFDCCRA 144
            ++Y L     +LIAG+LGD+ GHK+  V G+ W  +WSL+ GFS Y   NQ F+   RA
Sbjct: 84  NASYMLGSAVMVLIAGKLGDLNGHKRMVVFGWIWLTIWSLITGFSYYDRGNQAFYYTARA 143

Query: 145 FQGMGPAFLLPNAIAILGRTY-KPGRRKNMVFSLFGASAPGGFVLGAVFSSMLGQLAWWP 203
            QG+G  F++PN++AI+GRTY +PG +K ++FS+FG     GFV+G  FSS+  QL  W 
Sbjct: 144 LQGIGSGFIVPNSLAIMGRTYFEPGLKKTIIFSIFGMMTSTGFVIGTTFSSLFAQLTKWA 203

Query: 204 WAYWLMGIACFLLAVAGYYLIPHTPMPNRDVASFKLLERIDFAGSVTGVVGLILFNFAWN 263
           W YW +   C L  V     IP   + ++   S  L +R D+ G++TGV GL+LF+ A+ 
Sbjct: 204 WNYWALACVCVLYTVGAILFIPPDNIVHKP-NSKPLYKRFDYLGAITGVSGLVLFDVAFT 262

Query: 264 QGPVVGWQTPYTYALLIVGTVFLIIFAFIESRXXXXXXXXXXXSSDTAFVLSCIAAGWAS 323
           Q   +GW  P+TY  LI+G + ++I  F++ R            +D   +L C+  G+ S
Sbjct: 263 QASALGWSPPHTYITLIIGVILILIAMFVDWRVDDPLVPLQHLRADVVVILICVYFGFLS 322

Query: 324 FGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAISGFCAALMTGFLLS-HTPPSTVMFFAMT 382
           F IW  + WQF E     +PL  +A+  P+AI    AA+ T   L  +    T+M  +M 
Sbjct: 323 FVIWANWFWQFYELVHNDSPLRIAAKLVPLAIGSIPAAIFTVTCLQLNIKAPTMMVISMV 382

Query: 383 AFTVGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLV 442
            F V  IL+AT   + TYWAQ FVS I+ P+ +D++ P AT++ SDS+  E QG+AASL+
Sbjct: 383 CFLVPNILMATVTPNTTYWAQPFVSSIIAPFAVDITVPTATLLFSDSVRKESQGIAASLI 442

Query: 443 NTVVNYSISIGLGIAGTIESNVNDGGANVLKG-----YRCSWYLGIGLSGFGIFVA 493
            TV++Y+ISIG      +   V   G +   G        ++  GI LSG G+  A
Sbjct: 443 ITVISYAISIGPSYTAMVMWYVAPLGNDSTPGGFTHSLHSNFICGIVLSGIGLVTA 498

>TBLA0C01160 Chr3 complement(246034..247836) [1803 bp, 600 aa] {ON} 
          Length = 600

 Score =  278 bits (712), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 165/480 (34%), Positives = 262/480 (54%), Gaps = 13/480 (2%)

Query: 43  ESAFVGVLCSAQLMTQAGLGQSLAPLHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAG 102
           E  FV V    Q ++Q GL Q L+ ++I+ +   T    Q  W  +A+ L +G  ILI+G
Sbjct: 122 EFGFVLVGVIGQFLSQVGLTQVLSTMNILAEELHTTKMRQ-PWLMAAFPLGLGCTILISG 180

Query: 103 RLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSN-QIFFDCCRAFQGMGPAFLLPNAIAIL 161
           RLGDIFG KK  +LG+    +W+L+ GFS Y++    F   R FQG+G A  LPN   ++
Sbjct: 181 RLGDIFGLKKVLLLGYIITTIWTLICGFSSYAHSDDLFIVSRTFQGLGLACALPNMFELI 240

Query: 162 GRTYKPGR-RKNMVFSLFGASAPGGFVLGAVFS--SMLGQLAWWPWAYWLMGIACFLLAV 218
           G  YKP   +KNM+F + GA +P G  LG +F+  S+   +  WPW+++   I  FL  +
Sbjct: 241 GIIYKPHCFKKNMIFCIIGAMSPIGATLGGIFAGLSVKYNIKNWPWSFYSFAIVAFLNGI 300

Query: 219 AGYYLIPHTPMPNRDVASFKLLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYAL 278
             ++ IP+      D+       ++D+ GS  G+ GL++ NF +NQ P+ GW + Y   L
Sbjct: 301 IAWFCIPN------DIEKNPQGLKMDWIGSALGLFGLVVLNFVFNQTPIDGWSSAYLIVL 354

Query: 279 LIVGTVFLIIFAFIESRXXXXXXXXXXXSSDTAFVLSCIA--AGWASFGIWIFYTWQFME 336
           L+V  V LI+F   E              S+   +L  +    GW  F IW FY + F  
Sbjct: 355 LVVSVVALILFVIYELTMANFPLIPKGIHSNYRLILILLTLFCGWGGFAIWTFYYFAFQL 414

Query: 337 DSRGQTPLLSSAQFSPVAISGFCAALMTGFLLSHTPPSTVMFFAMTAFTVGTILIATAPV 396
           + R  +PL +S+    + ISG    ++    +    P  ++FF+M  F  G IL A  P+
Sbjct: 415 NLRHYSPLWASSSNFVLIISGTIYTIICCLAVQRMKPPILLFFSMLGFLGGNILFAVTPI 474

Query: 397 HQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGI 456
           HQT++   F S+ + P GM  SFP+A++M ++++P  ++ +A SLVN  +NY+ SI +G+
Sbjct: 475 HQTFFRNMFGSMFLFPLGMVFSFPSASMMTAETLPTHYKSMAGSLVNVAINYATSICVGM 534

Query: 457 AGTIESNVNDGGANVLKGYRCSWYLGIGLSGFGIFVAATYAVSTFMKSKKRVSEKQHFIE 516
           AG+   N N+ G ++L G+R + YL IGLSGF +F++  Y + +    + +  ++   I 
Sbjct: 535 AGSANVNHNNHGQDLLHGFRAASYLAIGLSGFSVFLSGLYMIGSIWTDRNQKMKENKLIN 594

>NCAS0A05720 Chr1 (1117491..1119182) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  243 bits (620), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 172/529 (32%), Positives = 273/529 (51%), Gaps = 26/529 (4%)

Query: 2   TLSSPVTEENLDMNVETLKKDDEVLSDEFDVQEEKPESLLWESAFVGVLCSAQLMTQAGL 61
           +L S  T+E    N++  +  D++ S    +      S L E  F+ ++ S+Q ++ A  
Sbjct: 35  SLHSQRTKEQCS-NLQPAQAQDQLES----MNPPPGPSRLRECMFIVIIASSQFISLAAA 89

Query: 62  GQSLAPLHIIGDSFGTANPGQLS--WFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFF 119
            Q++  +  I   F       L   W  +A+++T GTFI+ AG+L D+ G K  F+ G+ 
Sbjct: 90  SQAILQMDAITAWFQLPADRSLEAGWANAAFAITCGTFIIPAGKLCDLIGSKTVFIFGYA 149

Query: 120 WYALWSLLAGFSVYSNQ---IFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFS 176
           WY LWSLL G S Y+ +    FF   R  QG+G A L P+++A+LG+ Y P  +KN+VFS
Sbjct: 150 WYTLWSLLVGISRYAPKGQATFFFFGRGCQGIGAAALFPSSLALLGKYYPPSCKKNIVFS 209

Query: 177 LFGASAPGGFVLGAVFSSMLGQLAWWPWAYWLMGI-ACFLLAVAGYYLIPHTPMPNRDVA 235
           L+G   P G V+G VFS++  QLA W W YW M I + F   ++ +Y+ P   + + +  
Sbjct: 210 LYGFCVPLGVVVGGVFSAIFTQLAHWSWNYWSMAIVSAFFTLISCFYIPPDEIIKSEEQK 269

Query: 236 SFKL---LERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTVFLIIFAFI 292
             +    L + D+ G+   V  L+LF   WNQ     +++   Y  LIV  V  +    +
Sbjct: 270 KKRAWFHLPKFDYLGTFLYVASLLLFAVCWNQATGFKFKSVQVYVTLIVSLVCFVAMVIV 329

Query: 293 ESRXXXXXXXXXXXSSDTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSP 352
           E                T   L  +   + SF IW+FY W++    R  T LL +A+F P
Sbjct: 330 EFYVDDPIIPARKIHPQTIKALLVVFFSYLSFTIWLFYLWKYFTVVRNDTVLLGAAKFVP 389

Query: 353 VAISGFCAALMTGFLLSHTPPSTVMFFA-MTAFTVGTILIATAPVHQTYWAQTFVSIIVM 411
           ++I+GF AAL +  L+S   P  +   A   +F +  IL  T    ++YWA+ F++II++
Sbjct: 390 LSIAGFIAALFSILLISTAVPVQIRLLAGACSFLLAHILFITLSRTESYWARPFLTIIII 449

Query: 412 PWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTI-----ESNVND 466
             G+D+SFP+AT++LS+ +P E +G++A+LV T +NY   IG  IA TI     +  +  
Sbjct: 450 SIGLDISFPSATLLLSNGVPQELRGISAALVGTALNYGTGIGPPIAQTIIGYQCDKCMAS 509

Query: 467 GGAN-VLKGYRCSWYLGIGLSGFGIFV-----AATYAVSTFMKSKKRVS 509
           G  +  +K    +  +GIG SG  + V        Y+  T   SK+ V 
Sbjct: 510 GDMDQFVKAIHIAAAVGIGASGIAVVVGLYGTVTEYSWETHSYSKRCVE 558

>NDAI0K02730 Chr11 complement(612590..614404) [1815 bp, 604 aa] {ON}
           
          Length = 604

 Score =  241 bits (615), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 162/568 (28%), Positives = 269/568 (47%), Gaps = 67/568 (11%)

Query: 7   VTEENLDMNVETLKKDDEVLSDEFDVQEEKPESLLWESAFVGVLCSAQLMTQAGLGQSLA 66
           VTE   D     +     +   +    +    S L +  F+ ++CS+Q +T A   Q++ 
Sbjct: 38  VTETVQDQQSHKVTHSSLIRLQKL---QSPTNSYLNDIIFIFLICSSQFITLASASQAIL 94

Query: 67  PLHIIGDSFGTANPG--QLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALW 124
            +  +   F        QL W  +++++T G FI++AG+L DI   +  F+ G+ W++LW
Sbjct: 95  QMDSLSVWFKIPPTSTLQLGWVNASFAMTCGAFIILAGKLCDILNPRIIFISGYVWFSLW 154

Query: 125 SLLAGFSVY--SNQIFFDCCRAFQGMGPAFLLPNAIAILGRTY----------------- 165
           +L+ GF+ Y   N IF   CR  QG+G A L P+A+ +L + Y                 
Sbjct: 155 TLITGFASYVPKNMIFLYICRGCQGIGGALLFPSALILLNQYYTVPEPSPSQSQSKSPTT 214

Query: 166 ---KPGR---------------------------RKNMVFSLFGASAPGGFVLGAVFSSM 195
               P                              K++ FSL+GA AP G V+G +FS++
Sbjct: 215 SAPSPSHDIEKNLSSDDDNDGDSSIADDSDIICTSKSIAFSLYGACAPLGIVIGGIFSAI 274

Query: 196 LGQLAWWPWAYWLMGIACFLLAVAGYYLIPHTPMP----NRDVASFKLLERIDFAGSVTG 251
             QLA WPW YW M I   LL++  Y+ +   P+P    + +  S K  +  DF G + G
Sbjct: 275 FTQLATWPWNYWSMSIVTTLLSILSYFYVV-VPIPVEKLDSNPNSLKNWKNFDFLGVILG 333

Query: 252 VVGLILFNFAWNQGPVVGWQTPYTYALLIVGTVFLIIFAFIESRXXXXXXXXXXXSSDTA 311
           +  LILF  +W+Q  +  ++T + Y  L+   V  I     E                T 
Sbjct: 334 ISALILFGVSWDQATMYKFKTIHVYLTLLFSLVSFIAMIIWEYYFNNPIIPIRQIHPGTI 393

Query: 312 FVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAISGFCAALMTGFLLSHT 371
             L  +   + SF  W+FYTW+   + +  +P+L S +F P++++G  +A  +  L+   
Sbjct: 394 KALLVVFFSYISFTQWLFYTWKLFTEVKDNSPILGSVKFIPLSVAGIISATFSILLIVKR 453

Query: 372 PPSTVMFFA-MTAFTVGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSM 430
            P  +   A  ++F +  IL+ T  +  +YW   F SII +  G+D+SFP+AT++L++ +
Sbjct: 454 VPVQIRLLAGASSFLLSHILLLTCKLDSSYWTYQFFSIISISIGLDISFPSATLLLTNGI 513

Query: 431 PHEHQGLAASLVNTVVNYSISIGLGIAGTI-----ESNVND--GGANVLKGYRCSWYLGI 483
           P E QG+ A+LV +V+NY  +IG  IA TI     ES ++D       LKG   +  +G+
Sbjct: 514 PPEIQGICAALVGSVLNYGTAIGPPIAQTIIQYQCESCMSDPHDKKAFLKGIHIAGAVGV 573

Query: 484 GLSGFGIFVAATYAVSTFMKSKKRVSEK 511
           G SG  + +     ++ +    K  S+K
Sbjct: 574 GCSGIAVLIGIYGTITEYSWKTKGFSKK 601

>TDEL0G04950 Chr7 complement(922428..923966) [1539 bp, 512 aa] {ON} 
          Length = 512

 Score =  178 bits (452), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 143/497 (28%), Positives = 239/497 (48%), Gaps = 25/497 (5%)

Query: 5   SPVTEENLDMNVETLKKDDEVLSDEFDVQEEKPESLLWESAFVGVLCSAQLMTQAGLGQS 64
           S  TE ++  N E+ K+  +  S    ++      L  E AFV     AQ   QAG    
Sbjct: 15  SECTERSISCNQESSKEAYDRCSW---LKSSNFHFLCKEYAFVFTGVMAQAFNQAGGTMI 71

Query: 65  LAPLHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALW 124
           L  ++++ DSF         +  ++Y +  G+F+LI GRLG++ G+K+  + G+    L 
Sbjct: 72  LPLVNVLSDSF------HGKFLLNSYPMVCGSFMLIGGRLGEVHGYKETLLGGYIILILS 125

Query: 125 SLLAGFSVYS-NQIFFDCCRAFQGMGPAFLLPNAIAILGRTYK---PGRRKNMVFSLFGA 180
           SLL G S YS + IF+  CRAFQG+G A +LPN  A     Y+      RK ++ ++ G 
Sbjct: 126 SLLGGLSRYSKSSIFYVICRAFQGVGMALILPNFSAAYDYRYQSQAKAHRKTILSTIIGC 185

Query: 181 SAPGGFVLGAVFSSML--GQLAWWPWAYWLMGIACFLLAVAGYYLIPHTPMPNRDVASFK 238
            A  G  LG   S +      + W WAY+   IA  L     YY +P     N    +  
Sbjct: 186 GASTGAFLGTFLSGICVTRSESNWSWAYYTYTIAATLTLALSYYSVP----DNITKKNKP 241

Query: 239 LLERIDFAGSVTGVVGLILFNFAWNQGPVV--GWQTPYTYALLIVGTVFLIIFAFIESRX 296
            L  + +  + +   GL++ N A N   V    W       ++ V  + L +   ++   
Sbjct: 242 CLNGLGWFSNRS--CGLLMLNVACNLAAVASSNWSHIIVLLVVFVCLLLLFLVFELKFSE 299

Query: 297 XXXXXXXXXXSSDTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAIS 356
                     ++  + VL+ I  GW ++GIW  Y ++F+ + R  +PL + + +  + I 
Sbjct: 300 DPVFSKELFTNASVSLVLASIFFGWGTYGIWSGYFFRFLLNLRNYSPLAAGSTYLTLVIG 359

Query: 357 GFCAALMTGFLLSHTPPSTVMFFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMPWGMD 416
           G+ A +    L+  T P   + F+   FT   I+++  P+HQ+Y+  T  S+I +  G+D
Sbjct: 360 GYVAEIGISMLVKRTGPKLFLLFSSLGFTCSIIILSVTPIHQSYFRSTLGSMIFLALGLD 419

Query: 417 MSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGANVLKGYR 476
            SFP++ I+L + +P ++  + A L N + NY+IS   GI  +   +++     ++K YR
Sbjct: 420 FSFPSSAIILQNELPSKYHEMTAVLTNGIFNYAISFWPGICNSALRSLSS--IELIKYYR 477

Query: 477 CSWYLGIGLSGFGIFVA 493
             +Y  IGLS  G+F A
Sbjct: 478 YVYYFAIGLSAIGLFAA 494

>SAKL0C06116g Chr3 complement(571813..572370) [558 bp, 185 aa] {ON}
           some similarities with uniprot|P13090 Saccharomyces
           cerevisiae YML116W ATR1 Multidrug efflux pump of the
           major facilitator superfamily required for resistance to
           aminotriazole and 4-nitroquinoline-N-oxide
          Length = 185

 Score = 85.5 bits (210), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 46/126 (36%), Positives = 74/126 (58%), Gaps = 3/126 (2%)

Query: 53  AQLMTQAGLGQSLAPLHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKK 112
           +QL+ Q G  Q+L  ++++   F ++   Q    AS   L  G+FIL++G++GDI+G K 
Sbjct: 3   SQLLNQVGTTQTLPLINVLSRGFESSTAEQTRLVAS-IPLVSGSFILVSGKVGDIYGLKN 61

Query: 113 FFVLGFFWYALWSLLAGFSVYSNQI-FFDCCRAFQGMGPAFLLPNAIAILGRTYKPGR-R 170
             + G+    +WS + G + Y+  + FF   RAFQG+G AF+LPN +  +   Y  G  R
Sbjct: 62  TLLFGYATVIVWSFICGLTRYAGSVQFFVIARAFQGLGLAFVLPNVMGTVSNVYIAGSIR 121

Query: 171 KNMVFS 176
           KNMV++
Sbjct: 122 KNMVYA 127

 Score = 30.8 bits (68), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 19/25 (76%)

Query: 448 YSISIGLGIAGTIESNVNDGGANVL 472
           YS+ + LGIAGT+E  V+ GGA+ L
Sbjct: 159 YSMPMCLGIAGTVEHRVHKGGADRL 183

>Skud_6.16 Chr6 (26284..27933) [1650 bp, 549 aa] {ON} YOR378W (REAL)
          Length = 549

 Score = 82.4 bits (202), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 103/443 (23%), Positives = 183/443 (41%), Gaps = 45/443 (10%)

Query: 84  SWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNQIFFDCCR 143
           SW  ++Y++T   FI   GRLGDI G+   F +    +A+ SLL   +V  N   F   R
Sbjct: 67  SWSLTSYAVTFAGFIACMGRLGDIIGNSVLFTISCSCFAVLSLLC--AVMPNFPAFAVFR 124

Query: 144 AFQGMGPAFLLPNA---IAILGRTYKPGRRKNMVFSLFGASAPGGFVLGAVF-SSMLGQL 199
           A QG+  A L+P A   I IL    K  +  ++V   F ++   G ++G  F ++ +G  
Sbjct: 125 AIQGICAAGLVPCAYALIPILAPKEKVQKYFSIVSCGFSSTIGLGLIIGGAFATTKIGYR 184

Query: 200 AWWPWAYWLMGIACFLLAVAGYYLIPHTPMPNRDVASFKLLERIDFAGSVTGVVGLILFN 259
             +   + +M +   +     Y +      P +D AS   ++ +DF GS+  V G IL  
Sbjct: 185 GIFYLTFAVMTLISIIAFFFTYGVEKLNKKPQKDQASTS-VKSLDFIGSLIFVAGSILIV 243

Query: 260 FAWNQGPVVGWQTPYTYALLIVGTVFLIIF----------------------AFIESRXX 297
               +G    W  P TY  L++G +    F                       + E    
Sbjct: 244 VGLTEGG-ESWNRPVTYVTLVIGIILFFGFFVWNCTYTKIVRGFKYCGIDTSKYFEKVQL 302

Query: 298 XXXXXXXXXSSDTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAISG 357
                     +    VL+  A   A     ++   Q+ + +   +PLL+  +  P+ I  
Sbjct: 303 LIPIDVLFMKNFIPIVLA-FALNNACLFSCLYIIDQYSQYAERNSPLLAGVKLVPLIICM 361

Query: 358 FCAALMTGFLLSHTPPST---VMFFAMTAFTVGTILIATAPVHQT-YWAQTFVSIIVMPW 413
                +  F  +   P     + FF   A ++  ILI    V +  +W   F +  ++ +
Sbjct: 362 VIGNALCAFESTKLRPRVGVAIGFFLALAGSI--ILIQLHLVKEDLFWKIFFSAQALVGF 419

Query: 414 GMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVND--GGANV 471
           G+ + +P A  +     P E +G+A+ +  T     I I   +  ++  N+N+  G +N 
Sbjct: 420 GVAIFYPYALQIAVGGAPDESRGIASGVAQTFGQLGIEITFSVMASVLGNINEMKGKSNA 479

Query: 472 LKGYR-----CSWY-LGIGLSGF 488
           ++ +R     CS++ + +G  GF
Sbjct: 480 IQKFRTGFQNCSYFTVAVGALGF 502

>Smik_6.24 Chr6 (39520..41154) [1635 bp, 544 aa] {ON} YMR279C (REAL)
          Length = 544

 Score = 76.3 bits (186), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 95/442 (21%), Positives = 182/442 (41%), Gaps = 43/442 (9%)

Query: 84  SWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNQIFFDCCR 143
           SW  ++Y++T   FI   GRLGDI G+   F +    +A+ SLL   +V  N   F   R
Sbjct: 67  SWSLTSYAVTFAGFIACMGRLGDIVGNSVLFTISCSCFAILSLLC--AVMPNFPAFAVFR 124

Query: 144 AFQGMGPAFLLPNA---IAILGRTYKPGRRKNMVFSLFGASAPGGFVLGAVFSSMLGQLA 200
           A QG+  A L+P A   I IL    K  +  ++V   F ++   G ++G  F++   ++ 
Sbjct: 125 AIQGICAAGLVPCAYALIPILAPKEKVQKYFSIVSCGFSSTIGLGLIIGGAFAAT--KIG 182

Query: 201 WWPWAYWLMGIACFLLAVAGY--YLIPHTPMPNRDVASFKLLERIDFAGSVTGVVGLILF 258
           +    Y    +   +  +A +  Y + +     + + +   ++ +DF GS+  V G IL 
Sbjct: 183 YRGIFYLTFAVMSLISVIAFFFTYNVENFDKKPQKIQAQTSVKSLDFIGSLIFVAGSILI 242

Query: 259 NFAWNQGPVVGWQTPYTYALLIVGTVFL----------------IIFAFIESRXXXXXXX 302
                +G    W  P TY  LI+G +                  I F  I++        
Sbjct: 243 VVGLTEGGE-SWNRPVTYVTLIIGILLFFGFFVWNCTYAKIVRGIRFVGIDTSKYFEKVQ 301

Query: 303 XXXXSSDTAFVLSCI------AAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAIS 356
                 D  F+ + I      A   A     ++   Q+ + +   +PLL+  +  P+ I 
Sbjct: 302 LLI-PVDVLFMKNFIPIVLAFALNNACLFSCLYIIDQYSQYAEKDSPLLAGVKLVPLIIC 360

Query: 357 GFCAALMTGFLLSHTPPSTVMFFAMTAFTVGTILIATAPV--HQTYWAQTFVSIIVMPWG 414
                 +  F  +   P   +    +    G+I++    +     +W   F S  ++ +G
Sbjct: 361 MVVGNALCAFESTKLKPRVGVALGFSLALAGSIILIQLHLIKDNVFWKIFFSSQALVGFG 420

Query: 415 MDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVND--GGANVL 472
           + + +P A  +     P + +G+A+ +  T     I I   +  ++  ++N+  G  + +
Sbjct: 421 VAIFYPYALQIAVGGAPDQSKGIASGVAQTFGQLGIEITFSVMASVLGDINEMKGKEDAI 480

Query: 473 KGYR-----CSWY-LGIGLSGF 488
           + +R     CS++ + +G  GF
Sbjct: 481 QNFRTGFQNCSYFTVAVGALGF 502

>SAKL0F00440g Chr6 complement(36452..38086) [1635 bp, 544 aa] {ON}
           conserved hypothetical protein
          Length = 544

 Score = 71.2 bits (173), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 95/439 (21%), Positives = 182/439 (41%), Gaps = 50/439 (11%)

Query: 84  SWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNQIFFDCCR 143
           SW  +AY++T   FI   GR+GDI G+   FV   F +++ SL+   +V +N   F   R
Sbjct: 63  SWALTAYAITFAGFIAFLGRVGDIIGNSVLFVSSCFLFSILSLIC--AVVNNFGTFAVFR 120

Query: 144 AFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSL----FGASAPGGFVLGAVFSSMLGQL 199
           A QG+  A ++P+  A++  T          F++    F  S   GF++G  F+  L ++
Sbjct: 121 ALQGIAAAGIVPSGYALI-PTLSDEHEVQSFFAIVSCGFSTSFGIGFIIGGAFT--LTRI 177

Query: 200 AWWPWAYWLMGIACFLLAVAGYYLI----PHTPMPNRDVASFKLLE--RIDFAGSVTGVV 253
             +   ++L      ++++  Y+ I       P       + K  +   +DF GS   + 
Sbjct: 178 G-YKGIFYLTFAVMLVISIISYFSIGTSANQKPCTKDSPKTTKWSDALSLDFIGSFMFIS 236

Query: 254 GLILFNFAWNQGPVVGWQTPYTYALLIVGTVFLIIFAFIESRXXXXXXXXXXXSSD---- 309
             IL      +G    W+ P  Y  LIVG    ++F FI +            +S+    
Sbjct: 237 STILIVVGLTEGG-ESWKKPSAYVTLIVGIALFVLF-FIWNICYGVLVKNLKSASNPKVY 294

Query: 310 ----TAFVL------------SCIAAGWASFGIW---IFYTWQFMEDSRGQTPLLSSAQF 350
               T  VL                A +A++G     ++   Q+ +     +PLL++ + 
Sbjct: 295 NYFRTIQVLIPKDVLMMKNFIPITVAVFANYGCLFSNLYIVNQYCQYVSKNSPLLAAVKL 354

Query: 351 SPVAISGFCAALMTGFLLSHTPPSTVMFFAMTAFTVGTILIATAPV--HQTYWAQTFVSI 408
            P+ +S     ++         P   +        +G+I++    +     YW   F S 
Sbjct: 355 LPLVVSMLIPNVVIAIKSDLISPRKAVVLGFFIMFIGSIILIQLHLITDNLYWKIFFCSQ 414

Query: 409 IVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVND-- 466
            ++ +G  + FP +  +L    P E++G+A+ ++ T   + + +   +  +I  N+N+  
Sbjct: 415 SLIAFGAAIFFPYSLNILIGFAPDEYKGIASGVMQTFGQFGVEVTFSVMTSILGNINELS 474

Query: 467 ---GGANVLKGY--RCSWY 480
              G A + K     C+++
Sbjct: 475 GKSGSAGIYKTRFQNCTYF 493

>Suva_10.11 Chr10 (18934..20556) [1623 bp, 540 aa] {ON} YOR378W
           (REAL)
          Length = 540

 Score = 70.9 bits (172), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 94/443 (21%), Positives = 175/443 (39%), Gaps = 45/443 (10%)

Query: 84  SWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNQIFFDCCR 143
           SW  ++Y++T   FI   GRLGDI G+   F +  F++A+ SLL   +V  N   F   R
Sbjct: 67  SWSLTSYAVTFAGFIAFMGRLGDIVGNSILFTVSCFFFAILSLLC--AVMPNFPAFAVFR 124

Query: 144 AFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSL----FGASAPGGFVLGAVFSSMLGQL 199
           A QG+  A L+P A A++     P       FS+    F ++   G ++G  F++     
Sbjct: 125 AIQGISAAGLVPCAYALI-PMLAPEEEVQKYFSIVSCGFSSTIGLGLIIGGAFAA---TK 180

Query: 200 AWWPWAYWLMGIACFLLAVAGY---YLIPHTPMPNRDVASFKLLERIDFAGSVTGVVGLI 256
             +   ++L     FL+++  +   Y + +   P R   +   +  +DF GS+  V G I
Sbjct: 181 IGYKGIFYLTFAVMFLISIVAFFFTYGVENLSEPPRKDQATNRVRSLDFIGSLIFVTGSI 240

Query: 257 LFNFAWNQGPVVGWQTPYTYALLIVGTVFLIIFAFIESRXXXXXXXXXXXSSDTAF---- 312
           L      +G    W  P TY  L++G +    F F                 DT+     
Sbjct: 241 LIVVGLTEGG-ESWNRPATYVTLVIGIILFFGFFFWNCSYARIVRGIRCCGIDTSRYFEK 299

Query: 313 -----------------VLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAI 355
                            ++   A   A     I+   Q+ +     +PL +  +  P+ I
Sbjct: 300 VQLLIPVDVLFMKNFIPIVLAFALNNACLFSCIYIIDQYSQYEEKNSPLYAGVKLVPLII 359

Query: 356 SGFCAALMTGFLLSHTPPSTVMFFAMTAFTVGTILIATAPV--HQTYWAQTFVSIIVMPW 413
                  +  F  +   P   +    +    G+I++    +     +W   F S  ++ +
Sbjct: 360 CMVIGNGLCAFESTKLKPKVGVVLGFSLALAGSIILTQLHLIKEDMFWKIFFSSQALVGF 419

Query: 414 GMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVN--DGGANV 471
           G+ + +P A  +     P   +G+A+ +  T     I I   +  ++  N++   G +  
Sbjct: 420 GVAIFYPYALQIAVGGAPDRSKGIASGVAQTFGQLGIEITFSVMASVLGNIDGIRGKSGA 479

Query: 472 LKGYR-----CSWY-LGIGLSGF 488
            + +R     C+++ + +G  GF
Sbjct: 480 SQKFRTGFQNCTYFTVAVGALGF 502

>KLLA0C18931g Chr3 (1680133..1681794) [1662 bp, 553 aa] {ON}
           uniprot|Q874B4 Kluyveromyces lactis KLLA0C18931g Drug
           efflux permease KNQ1
          Length = 553

 Score = 65.5 bits (158), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 64/217 (29%), Positives = 102/217 (47%), Gaps = 18/217 (8%)

Query: 82  QLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNQIFFDC 141
           Q  W  ++Y +T   FI   GR+GDI G+     +    + ++SLL   +V  N I F  
Sbjct: 59  QSGWALTSYVITFAGFIAFFGRVGDIVGNGIMMCVFSVIFGIFSLLC--AVVPNFIAFTV 116

Query: 142 CRAFQGMGPAFLLPNAIAILGRTYK-PGRRK--NMVFSLFGASAPGGFVLGAVFSSMLGQ 198
            RAFQGM  A ++P A A++ + ++ P  ++  +++ S+  A A  GF++G  F      
Sbjct: 117 FRAFQGMAGAGIVPCAYALVNKMFQGPNLQRYFSILSSVISAMAGVGFIIGGAFGET--A 174

Query: 199 LAWWPWAYWL----MGIACFLLAVAGYYLIPHTPMPNRD--VASFKLLERIDFAGSVTGV 252
           L +  + Y+L    +  A  +  + GY   P   + NR      F+ + ++D  G +  +
Sbjct: 175 LGYKSFFYFLFAASLATAAVICVLIGY---PEL-LLNRHSYKEKFQRVYKLDVIGCLLFI 230

Query: 253 VGLILFNFAWNQGPVVGWQTPYTYALLIVGTVFLIIF 289
            G IL      QG    W  P  Y  L V  V LIIF
Sbjct: 231 SGSILLVVGLTQGG-ESWNDPTAYVPLAVSIVLLIIF 266

>KLTH0H16214g Chr8 complement(1398230..1399885) [1656 bp, 551 aa]
           {ON} conserved hypothetical protein
          Length = 551

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 107/526 (20%), Positives = 197/526 (37%), Gaps = 67/526 (12%)

Query: 13  DMNVETLKKDDEVLSDEFDVQEEKPESLLWESAFVGVLCSAQLMTQAGLGQSLAPLHIIG 72
           +M+     K  E + +     +     L+   A + + C+  L+  AG+   ++ +  +G
Sbjct: 3   NMHTTAAPKLSEGIYNLRRRCQNSKYQLIINMALIFLGCTFDLLNVAGV---ISVIEDLG 59

Query: 73  DSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSV 132
           +++G       SW  ++Y++T    I   GRLGDI G+   F +  F+++L+ LL   +V
Sbjct: 60  ETYGLEYT-TASWALTSYAITFAGLIAFMGRLGDIIGNSVLFTISGFFFSLFCLLC--AV 116

Query: 133 YSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSLFGASAPGGFVLGAVF 192
            +N   F   RA QG+  A L+P   A++     P   +     LF A    G      F
Sbjct: 117 VTNFPAFAVLRALQGIAAAGLVPCGYALIPTLADPEDVQ-----LFFAVVSCG------F 165

Query: 193 SSMLGQLAWWPWAYWLMGI---ACFLLAVAGY-----------YLIPHTPMPNRD----V 234
           SS +G       A+ L  +     F L+ AG            Y I       +D    +
Sbjct: 166 SSTIGIGLIIGGAFALTNVGYKGIFYLSFAGMLLVSIAAFFFTYRIEEHKFAEQDYEGSI 225

Query: 235 ASFKLLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTVF--------- 285
                +  +DF GS+  + G +L      +G    W+ P  Y    +G +F         
Sbjct: 226 HRPGKVASLDFVGSLIFISGSVLIVVGLTEGG-ESWKRPVAYVPFTIGMIFFCGFFAWNC 284

Query: 286 ----LIIF---------AFIESRXXXXXXXXXXXSSDTAFVLSCIAAGWASFGIWIFYTW 332
               L+IF          ++E             ++     L  +  G   +   I+   
Sbjct: 285 SYQNLVIFLKKLGCDTSRYLEKVQVLIPRDVLFMTNFIPITLGFLCNGGCLYS-NIYIID 343

Query: 333 QFMEDSRGQTPLLSSAQFSPVAISGFCAALMTGFLLSHTPPSTVMFFAMTAFTVGT-ILI 391
           Q+ +     +PLL+  +  P+ I+      +         P   +     +   G+ ILI
Sbjct: 344 QYSQYVDKNSPLLAGVKLVPLIITMVIGNTICASKSVKLRPRIGVALGFLSMVCGSIILI 403

Query: 392 ATAPVHQT-YWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSI 450
               V +  YW   F S I++ +G  + +P A  ++    P   +G+A+ +  T     I
Sbjct: 404 QLHLVEENLYWKIMFCSQILVGFGAAIFYPYALKLVVGDAPSGAKGIASGVTQTFAQLGI 463

Query: 451 SIGLGIAGTIESNVN------DGGANVLKGYRCSWYLGIGLSGFGI 490
            +   +  ++  N+       D       G++   Y  +    FG+
Sbjct: 464 EMTFSVMVSVLGNITQVKSRPDSFERFRDGFQKCTYFTLASGAFGL 509

>Kwal_34.15746 s34 (37757..39313) [1557 bp, 518 aa] {ON} YGR224W
           (AZR1) - MFS-MDR [contig 274] FULL
          Length = 518

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 89/453 (19%), Positives = 173/453 (38%), Gaps = 51/453 (11%)

Query: 51  CSAQLMTQAGLGQSLAPLHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGH 110
           C+  L+  AG+   ++ +  +G+++     G  SW  ++Y++T   FI   GRLGDI G+
Sbjct: 37  CTFDLLNVAGV---ISVIEDLGETYKLGYTGA-SWALTSYAITFAGFIAFMGRLGDIVGN 92

Query: 111 KKFFVLGFFWYALWSLLAGFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRR 170
              F +  F + L+SLL   +V  +   F   RA QG+  A ++P   A++    +P   
Sbjct: 93  SVLFTISCFLFTLFSLLC--AVVRDFPTFAVFRALQGISAAGIVPCGYALIPLLAEPQDI 150

Query: 171 KNMVFSL----FGASAPGGFVLGAVFS-SMLGQLAWWPWAYWLMGIACFLLAVAGYYL-- 223
           +   FS+    F ++   G ++G  F+ + +G    +  ++  M +     +   Y +  
Sbjct: 151 QKF-FSIVSCGFSSTIGIGLIVGGAFALTKVGYAGIFYLSFAGMLVVSIAASFYTYRIEE 209

Query: 224 -------IPHTPMPNRDVASFKLLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTY 276
                  +   P  +  VAS      +DF GS+  V G +L      +G    W+ P  Y
Sbjct: 210 RKFLEVKVEDIPHDHPKVAS------LDFVGSLIFVSGSVLIVAGLTEGG-ESWRRPVAY 262

Query: 277 ALLIVGTVFLIIFAF-------IESRXXXX--------XXXXXXXSSDTAF------VLS 315
               +G +    F         + SR                     D  F      ++ 
Sbjct: 263 VPFSIGVLLFCSFFIWNCYYQKMVSRLKAVGFNTPQYLNNVQVLVPKDVLFMPNFIPIIL 322

Query: 316 CIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAISGFCAALMTGFLLSHTPPST 375
             A   A     I+   Q+ +     +PL++  +  P+ +S                P  
Sbjct: 323 SFACNNACLFSVIYIIDQYSQYVEKNSPLIAGVRLIPLIVSMVIGNTTCAIRSLQLRPKV 382

Query: 376 VMFFAMTAFTVGTILIATAPVHQT--YWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHE 433
            +         G+I++      +   +W   F S I +  G  + +P A  ++    P  
Sbjct: 383 GVVLGFLFMLCGSIILIQLHTIENGIFWKLFFCSQISVGLGAAIFYPYALKLVVGGAPDG 442

Query: 434 HQGLAASLVNTVVNYSISIGLGIAGTIESNVND 466
            +G+A+ +  T   + + +   +  ++  N+ D
Sbjct: 443 AKGIASGMTQTFAQFGVEVTFSVMVSVLGNITD 475

>TDEL0D06610 Chr4 complement(1195341..1196834) [1494 bp, 497 aa]
           {ON}  possible pseudogene; N added at two sites to avoid
           frameshifts
          Length = 497

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 84/410 (20%), Positives = 152/410 (37%), Gaps = 37/410 (9%)

Query: 84  SWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNQIFFDCCR 143
           SW  ++Y++T   FI   GRLGDI G+ + F +    +A+ SLL G  +  N   F   R
Sbjct: 67  SWSLTSYAVTFAGFIAFMGRLGDIVGNSRLFTVSCGCFAILSLLCG--LMPNFEAFAVMR 124

Query: 144 AFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSLFGASAPGGFVLGAVFSSMLGQLAWWP 203
           A QG+  A L+    A++     P  +    FS+      G      +   + G    + 
Sbjct: 125 ALQGIAAAGLVMCGYALI-PILSPKEQVQEYFSIVSC---GFSSTIGIGFIIGGAXXGYK 180

Query: 204 WAYWLMGIACFLLAVAGYYLIPHTPMPNRDVASFK----LLERIDFAGSVTGVVGLILFN 259
             ++L   A  L+ +  ++               K     +  +DF GS+  + G IL  
Sbjct: 181 GIFYLTFAAMTLICIMAFFFTCDVEKNEEKGLEVKESTATVASLDFIGSLIFITGSILIV 240

Query: 260 FAWNQGPVVGWQTPYTYALLIVGTVFLIIFAFIESRXXXXXXXXXXXSSDTA-------- 311
               +G    W+    Y    +G +  + F                   DT         
Sbjct: 241 VGLTEGG-ESWREAKAYVTFAIGIILFLSFFAWNCFYLKIVNGIRLIGIDTTKYFEKVQL 299

Query: 312 -----------FVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAISGFCA 360
                       VL+        F   I+   Q+ +     +PL++  +  P+ IS    
Sbjct: 300 LVPLNIHFMTXIVLAFAMNNACPFS-SIYIIDQYSQYKENDSPLMAGVKLVPLIISMIIG 358

Query: 361 ALMTGFLLSHTPPS---TVMFF-AMTAFTVGTILIATAPVHQTYWAQTFVSIIVMPWGMD 416
             + G   +   P    T+ FF A++   + T L A    +  +W   F + +++ +G+ 
Sbjct: 359 NFLCGIEKTRMRPKFGVTLGFFLALSGSIILTQLRAVK--YDVFWKIFFSAEVLVGFGVA 416

Query: 417 MSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVND 466
           + +P A  +     P E +G+A+ +  T     I I   I  ++  N+ +
Sbjct: 417 IFYPYAQQLAVGRAPDEAKGIASGVAQTFGQLGIEIAFSIMASVLGNIEE 466

>SAKL0C02178g Chr3 complement(191542..193239) [1698 bp, 565 aa] {ON}
           weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 565

 Score = 54.3 bits (129), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 53/193 (27%), Positives = 81/193 (41%), Gaps = 21/193 (10%)

Query: 82  QLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNQIFFDC 141
           Q+SW A+AY L+   F  + G+L DIFG K   +L    +AL   + G S ++N ++   
Sbjct: 77  QMSWIATAYLLSCSAFQPLYGKLSDIFGRKILLILSNLTFALGCAICG-SPWTNNVWVLS 135

Query: 142 CRAFQ----GMGPAFLLPNAIAILGRTYKPGRRKNMVFSLFGASAPGGFVLGAVFSSMLG 197
              F     G G A L     + +    K G  + +V   F      G VLGAV    +G
Sbjct: 136 TGRFVAGIGGGGQATLSTITTSDIIPLRKRGVYQGLVNICFSLGCASGSVLGAVLQQGIG 195

Query: 198 QLAWWPWAYWL---MGIACFLLAVAGYYLIPHTP---------MPNRDVASFKLLERIDF 245
               W WA+ +   M + C L+      L   +P            + +    + E +DF
Sbjct: 196 ----WRWAFLVQVPMALVCALMIAVVLDLPADSPGRGLLWLELKRGKRLKWCTVTEMVDF 251

Query: 246 AGSVTGVVGLILF 258
            GS T +  +IL 
Sbjct: 252 VGSFTLIASMILL 264

>Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {ON}
           YMR088C (REAL)
          Length = 562

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 54/194 (27%), Positives = 90/194 (46%), Gaps = 20/194 (10%)

Query: 68  LHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLL 127
           ++ + + F  ++  Q  W A+++ LT   F  + G+L DI G K   ++  F++ L  LL
Sbjct: 60  MNRVAEDFSESSRKQ--WIATSFLLTNTAFQPLYGKLSDITGRKSALLIAQFFFGLGCLL 117

Query: 128 AGFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFS-----LFGASA 182
             F+   N   F   RA  G+G   L  NAI+ +  +     R+  V+      +FG   
Sbjct: 118 TCFA--RNVTEFSIARAICGIGAGGL--NAISSIAVSDICTARERGVYQGYANIVFGFGQ 173

Query: 183 PGGFVLGAVFSSMLGQLAWWPWAYWL---MGIACFLLAVAGYYL-IPHTPMPNRDVASFK 238
             G  LG VF   +G    W   + +   M + C +LA+    + + H P P ++  + K
Sbjct: 174 LLGAPLGGVFIETIG----WRALFGVQVPMIMLCTILAIKNINIKLFHVP-PMKERYTLK 228

Query: 239 LLERIDFAGSVTGV 252
            L RID  GS++ V
Sbjct: 229 NLSRIDLFGSLSLV 242

>KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 593

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 66/239 (27%), Positives = 102/239 (42%), Gaps = 33/239 (13%)

Query: 71  IGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGF 130
           IG  F + +  + SW A++Y L+  T   + G+L D  G K   V     +A+  L+ G 
Sbjct: 113 IGSEFNSLD--KASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGL 170

Query: 131 SVYSNQIFFDCC-RAFQGMGPAFLLPNAIAILGRTYKPGRRK-------NMVFSLFGASA 182
              SN I+     R   G+G   L   A  I+     P R +       N VF L   +A
Sbjct: 171 ---SNSIWAVVAGRFISGIGGCGLTSLATMIMS-DLVPLRDRAVYQGLCNFVFGL--GTA 224

Query: 183 PGGFVLGAVFSSMLGQLAWWPWAYWLMGIACFLLAVAGYYLIPHTPMPNRDVASFK---- 238
            GG V GA F         W  A+ L    C +  ++G  ++ +  +P R  AS K    
Sbjct: 225 SGGLV-GAYFRD-------WRLAFILQ---CPISVLSGILIVVYLELPPRASASNKDCWS 273

Query: 239 -LLERIDFAGSVTGVVGLILFNFAWNQ-GPVVGWQTPYTYALLIVGTVFLIIFAFIESR 295
             L R+D+AG+ + +  L LF    +  G  V + +    A+     VF  +F ++E R
Sbjct: 274 ARLRRLDWAGATSLIAFLFLFMLTSSMGGSSVAYGSRLFAAMCAATLVFGAVFVYVELR 332

>KLLA0F17776g Chr6 complement(1627198..1628859) [1662 bp, 553 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 553

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 55/221 (24%), Positives = 97/221 (43%), Gaps = 30/221 (13%)

Query: 81  GQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNQIFFD 140
            Q+SW A++Y L+   F  + G+L D+FG K   +     +    +L G + ++  ++  
Sbjct: 67  NQMSWIATSYLLSCSAFQPLYGKLSDVFGRKPLLIWSNLCFGFGCILCG-APFTKSLWML 125

Query: 141 CC-RAFQGMGPAFLLPNAIA-ILGRTYKPGRRK-------NMVFSLFGASAPGGFVLGAV 191
           C  R   G+G   L  N+++ I      P R++       N+VF+L  AS       G++
Sbjct: 126 CIGRFIAGVGGGGL--NSLSTITTSDIIPLRQRGVYQGMGNIVFALGCAS-------GSL 176

Query: 192 FSSMLGQLAWWPWAYWLMGIACFLLAVAGYYLIPHTP----------MPNRDVASFKLLE 241
             + L Q   W WA+ L  +   LL+ +      + P          + N+ + +  + E
Sbjct: 177 IGAFLQQRIGWRWAF-LCQVPLSLLSCSLIMKFLNLPAGSPGRGLINLSNKKITTADVRE 235

Query: 242 RIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVG 282
            +DF GS T +  ++L     +        T  T+AL IVG
Sbjct: 236 HVDFTGSFTLITTMLLLMIILSVLDNPSHLTYGTWALFIVG 276

>Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 51/191 (26%), Positives = 89/191 (46%), Gaps = 14/191 (7%)

Query: 68  LHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLL 127
           ++ + + F  ++  Q  W A+++ LT   F  + G+L DI G +   +   F++ L  L+
Sbjct: 60  MNRVAEEFSESSKKQ--WIATSFLLTNTAFQPLYGKLSDIIGRRPALLTAQFFFGLGCLM 117

Query: 128 AGFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFS-----LFGASA 182
             F+   N   F   RA  G+G   L  NAI+ +  +     R+  V+      +FG   
Sbjct: 118 TCFA--RNVTEFSIARAVCGIGAGGL--NAISSIAVSDICTARERGVYQGYANIVFGFGQ 173

Query: 183 PGGFVLGAVFSSMLGQLAWWPWAYWLMGIACFLLAVAGYYL-IPHTPMPNRDVASFKLLE 241
             G  LG +F   +G  A +     ++ I C +LA+    + + H P P ++  + K L 
Sbjct: 174 LLGAPLGGIFIETIGWRALFGVQVPMI-IVCSILAIKNINIKLFHVP-PMKERYTLKNLS 231

Query: 242 RIDFAGSVTGV 252
           RID  GS++ V
Sbjct: 232 RIDIFGSLSLV 242

>YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON}
           VBA1Permease of basic amino acids in the vacuolar
           membrane
          Length = 562

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 53/191 (27%), Positives = 89/191 (46%), Gaps = 14/191 (7%)

Query: 68  LHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLL 127
           ++ + + F  ++  Q  W A+++ LT   F  + G+L DI G K   +   F++ L  LL
Sbjct: 60  MNRVAEEFSESSKKQ--WIATSFLLTNTAFQPLYGKLSDITGRKSALLTAQFFFGLGCLL 117

Query: 128 AGFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFS-----LFGASA 182
             F+   N   F   RA  G+G   L  NAI+ +  +     R+  V+      +FG   
Sbjct: 118 TCFA--RNVTEFSIARAICGIGAGGL--NAISSIAVSDICTARERGVYQGYANIVFGFGQ 173

Query: 183 PGGFVLGAVFSSMLGQLAWWPWAYWLMGIACFLLAVAGYYL-IPHTPMPNRDVASFKLLE 241
             G  LG VF   +G  A +     ++ + C +LA+    + + H P P ++  + K L 
Sbjct: 174 LLGAPLGGVFIETIGWRALFGIQVPVI-MLCSVLAIKNINIKLFHVP-PMKERYTLKNLS 231

Query: 242 RIDFAGSVTGV 252
           RID  GS++ V
Sbjct: 232 RIDIFGSLSLV 242

>Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 52/191 (27%), Positives = 88/191 (46%), Gaps = 14/191 (7%)

Query: 68  LHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLL 127
           ++ + + F  ++  Q  W A+++ LT   F  + G+L DI G K   +   F++ +  LL
Sbjct: 60  MNRVAEEFSESSRKQ--WIATSFLLTNTAFQPLYGKLSDITGRKSALLTAHFFFGIGCLL 117

Query: 128 AGFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFS-----LFGASA 182
             F+   N   F   RA  G+G   L  NAI  +  +     R+  V+      +FG   
Sbjct: 118 TCFA--RNVTEFSIARAICGIGAGGL--NAIGSIAVSDICTARERGVYQGYANIVFGLGQ 173

Query: 183 PGGFVLGAVFSSMLGQLAWWPWAYWLMGIACFLLAVAGYYL-IPHTPMPNRDVASFKLLE 241
             G  LG VF   +G  A +     ++ + C +LA+    + + H P P ++  + K L 
Sbjct: 174 LLGAPLGGVFIETIGWRALFGVQVPVI-MLCSVLAIKNINIKLFHVP-PMKERYTLKNLS 231

Query: 242 RIDFAGSVTGV 252
           RID  GS++ V
Sbjct: 232 RIDIFGSLSLV 242

>ZYRO0A00330g Chr1 (19597..21327) [1731 bp, 576 aa] {ON} similar to
           uniprot|P38358 Saccharomyces cerevisiae YBR293W VBA2
           Permease of basic amino acids in the vacuolar membrane
          Length = 576

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 63/250 (25%), Positives = 105/250 (42%), Gaps = 41/250 (16%)

Query: 69  HIIGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLA 128
             IG+ F   +    SW  ++Y +T  +F  + G   D+ G +K        +++  L  
Sbjct: 92  QTIGNEFNHMDLS--SWITASYLITSTSFQPLYGSFSDVLGRRKCLFFASMIFSIGCLGC 149

Query: 129 GFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFS----LFGASAPG 184
           G S+  N ++    RAF G+G   L+  +  I+     P  ++ +  +    L G  A  
Sbjct: 150 GISI--NILWLSFMRAFTGIGGGGLITLS-TIVNSDMIPTSKRGIFQAFQNLLLGLGAIC 206

Query: 185 GFVLGAVFSSMLGQLAWWPWAYWLMGIACFLLAV----AGYYLIPHTPMPNRD------- 233
           G   G V +S +G    W W        CFLL V    AG  LI H  + N+D       
Sbjct: 207 GASFGGVITSSIG----WRW--------CFLLQVPISLAGA-LIGHLYVRNQDEYERRKS 253

Query: 234 ---VASFKLLERIDFAGSVTGVVGLILFNFAWNQGPVVG-----WQTPYTYALLIVGTVF 285
                + ++L+ IDF+G+   ++GL L     + G         W +P   A+L+   + 
Sbjct: 254 KESSQTKEMLKHIDFSGAFLIIIGLTLQLVYLSLGSAADESGNTWSSPGLSAVLVASFIV 313

Query: 286 LIIFAFIESR 295
           L++F   E R
Sbjct: 314 LVLFVLTEER 323

>NDAI0H02200 Chr8 complement(536385..538100) [1716 bp, 571 aa] {ON} 
           YGR224W
          Length = 571

 Score = 47.4 bits (111), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 53/197 (26%), Positives = 86/197 (43%), Gaps = 26/197 (13%)

Query: 68  LHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLL 127
           ++ + + F  ++  Q  W A+++ LT   F  + G+L DI G K   +   F++ L  LL
Sbjct: 67  MNRVAEEFAESDKKQ--WIATSFLLTNTAFQPLYGKLSDITGRKFAVLTAHFFFGLGCLL 124

Query: 128 AGFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFS-----LFGASA 182
             F+    Q  F   RA  GMG   +  NA++ +  +     R+  +F      +FG   
Sbjct: 125 TCFAQNVTQ--FSIARAICGMGAGGI--NAMSSITTSDICTTRERGIFQGYANIVFGMGQ 180

Query: 183 PGGFVLGAVFSSMLGQLAWWPWAYWLMGIACFLLAVAGYYLIP-------HTPMPNRDVA 235
             G  LG +F   L  + W      L GI   ++    Y  I        H P P ++  
Sbjct: 181 VLGAPLGGLF---LDHIGWRT----LFGIQVPMIMFCSYLTITNVNIKLLHVP-PRKERF 232

Query: 236 SFKLLERIDFAGSVTGV 252
           ++K L RID  GS++ V
Sbjct: 233 TWKNLSRIDIFGSLSLV 249

>AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR119W
          Length = 686

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 58/215 (26%), Positives = 88/215 (40%), Gaps = 28/215 (13%)

Query: 82  QLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNQIFFDC 141
           ++SW A+AY L+  TF  + G+L DIFG +   V     + L +L+ G S   N      
Sbjct: 176 RISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCLGALICGMS--KNLWVLVL 233

Query: 142 CRAFQGMGPAFLLPNAIAILGRTYKPGRRK-------NMVFSLFGASAPGGFVLGAVFSS 194
            R   G+G    L +  +I      P R +       N+ F L   +A GG V G     
Sbjct: 234 GRFVAGIGGGG-LTSMCSITTTDIVPLRSRALYQGICNVFFGL--GTACGGLVGGLFADR 290

Query: 195 MLGQLAWWPWAYWLMGIACFLLAVAGYYLIPHTPMP--------NRDVASFKLLERIDFA 246
            +G    W  A+ L+ +   LL+     L    P P         R +     L  +D+ 
Sbjct: 291 AVG----WRMAF-LVQVPLTLLSTTAIQLFLTLPKPVDAHKGAGQRSIPWTTKLRMVDWT 345

Query: 247 GSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIV 281
           G+VT VV L  F    +   + G   P+ Y + +V
Sbjct: 346 GTVTLVVFLFCFTLVCS---LYGEDLPHLYLIFVV 377

>Kwal_26.6697 s26 complement(26786..28519) [1734 bp, 577 aa] {ON}
           YBR293W - Hypothetical ORF [contig 381] FULL
          Length = 577

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 59/240 (24%), Positives = 102/240 (42%), Gaps = 22/240 (9%)

Query: 69  HIIGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLA 128
            +IG+ F        SW  +AY +T  +F  + G   D  G ++        +AL  L  
Sbjct: 71  QLIGNEFEDVKVS--SWITTAYLVTCTSFQPLYGSFSDTLGRRRCLFFANTIFALGCLGC 128

Query: 129 GF--SVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSLFGASAPGGF 186
           G   ++YS  I     RA  G+G   L+  +  I+     P +++ M  S        G 
Sbjct: 129 GLTSTIYSLIIM----RAVTGIGGGGLITLS-TIVNSDIIPAKKRGMYQSFQNILVGTGA 183

Query: 187 VLGAVFSSMLGQLAWWPWAYWLMGIACFLLAVAGYYLIPHTPMPNRDVASFKL------L 240
           V+GA     +     W W + L        AV  Y  +    + +++  S  L      +
Sbjct: 184 VVGASCGGEIASSMGWRWCFLLQVPISIGGAVMAYLFVQDQDVVDKNPRSGALPSNVSKI 243

Query: 241 ERIDFAGS---VTGVVGLILF---NFAWNQGPVVGWQTPYTYALLIVGTVFLIIFAFIES 294
           ++IDF G+   ++G+V  ++F   N +  +G    W +  + AL +V  V LI+FA++E 
Sbjct: 244 KKIDFLGAFLLISGLVSQLIFLTINSSAQEGKST-WLSGRSLALGLVTAVSLILFAYVEK 302

>SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 657

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 89/399 (22%), Positives = 158/399 (39%), Gaps = 32/399 (8%)

Query: 82  QLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNQIFFDC 141
            +SW A+AY L+  TF  + G++ DIFG K   +     +AL  L+ G S          
Sbjct: 165 HISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLS--PGLWCLVA 222

Query: 142 CRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSL----FGASAPGGFVLGAVFSSMLG 197
            R   G+G   L   + +I      P R + +   +    FG     G ++G  FS   G
Sbjct: 223 GRFIAGIGGGGLTSMS-SITTSDIVPLRNRALYQGICNFFFGLGTACGGLVGGWFSEHGG 281

Query: 198 QLAWWPWAYW----LMGIACFLLAVAGYYLIPHTP-----MPNRDVASFKLLERIDFAGS 248
               W  A+     L  I+C L  +  Y  +P          + D    + L RID+ G+
Sbjct: 282 ---GWRVAFLIQIPLCAISCSL--IVAYLELPKGCKGSGIQSDEDNQISEKLRRIDWFGA 336

Query: 249 VTGVVGLILFNFAWNQGPVVGWQTPYT----YALLIVGTVFLIIFAFIESRXXXXXXXXX 304
           ++ VV L+LF  A + G   G + P+     YAL +   V    F ++E+          
Sbjct: 337 LSLVVFLLLFMLASSLG---GKELPFQSNGFYALCVAIVVGGATFVYVETYVSKDPILPV 393

Query: 305 XXSSDTAFVLSCIAAGWASFGIWI--FYTWQFMEDSRGQTPLLSSAQFSPVAISGFCAAL 362
               +   + S +A  ++  G+    ++   +        P     +  P   S    +L
Sbjct: 394 AFLKNRTILGSSLANWFSMMGMMTTSYFLPVYWAGVLNMKPTDMGKRTIPSFFSTALGSL 453

Query: 363 MTGFLLSHTPPSTVMFFAMTAF-TVGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFPA 421
             G+ +  T     +  A  A   VG + I+    +   W Q ++ +++  +G+ +    
Sbjct: 454 GAGYYMKKTGKYKWLLMAFCALAVVGQLQISLIEPNIAVWRQ-YILLVIPGFGLSVLITV 512

Query: 422 ATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTI 460
             + +  ++PHEHQ    S+     +   ++G+ I G I
Sbjct: 513 TLLAMIAAVPHEHQAATTSISYAFRSTGCTLGVSIGGAI 551

>KNAG0E02560 Chr5 (506517..508253) [1737 bp, 578 aa] {ON} Anc_2.473
           YMR088C
          Length = 578

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 76/287 (26%), Positives = 121/287 (42%), Gaps = 27/287 (9%)

Query: 3   LSSPVTEENLDMNVETLKKDDEVLSDEFDVQEEKPESLLWESAFVGVLCSAQLMTQAGLG 62
           L  PV     D+  +T K + E   D   + +      LW  +FV  L    +   A + 
Sbjct: 11  LPDPVESCPNDLPDDT-KLEQEYHRDNMALPKGPILLSLWLGSFVSALDGTVV---ANIM 66

Query: 63  QSLAPLHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYA 122
            S+A        F  ++  Q  W A++Y LT   F  + G+L DI G K   +   F++A
Sbjct: 67  NSIAA------EFAESDKKQ--WIATSYLLTNTAFQPLYGKLSDITGRKVAVITAHFFFA 118

Query: 123 LWSLLAGFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSLFGASA 182
           L  LL  F+    Q  F   RA    G      NA++ +  T     R+  V+  +    
Sbjct: 119 LGCLLTCFAQNVTQ--FSIARAI--CGIGGGGINAMSSITVTDICSARERGVYQGYANVV 174

Query: 183 PG-GFVLGAVFSSMLGQLAWWPWAYWL---MGIACFLLAVAGYYL-IPHTPMPNRDVASF 237
            G G +LGA     L     W   + +   M + C +LA+    + + H P P  +  ++
Sbjct: 175 FGTGQLLGAPIGGFLLDSIGWRSIFGIQVPMLMLCSVLALKNVNIKLVHIP-PRNERFTW 233

Query: 238 KLLERIDFAGSVTGVVG----LILFNFAWNQGPVVGWQTPYTYALLI 280
           K L RID  GS++ V      L L +  WN+  ++G  T  +++L I
Sbjct: 234 KNLSRIDIFGSISLVATISGILFLTSSNWNKS-LLGIFTVLSFSLFI 279

>SAKL0E04246g Chr5 (336416..338113) [1698 bp, 565 aa] {ON} weakly
           similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 565

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 56/196 (28%), Positives = 85/196 (43%), Gaps = 27/196 (13%)

Query: 82  QLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNQIFFDC 141
           Q+SW A++Y L+   F  + G+L DIFG K   V     +A+   L G S ++  I+   
Sbjct: 77  QMSWIATSYLLSCSAFQPLYGKLSDIFGRKILLVWSNLVFAIGCALCG-SPWTTNIWILS 135

Query: 142 CRAFQGMGPAFLLPNAIAILGRTYKPGRRK-------NMVFSLFGASAPGGFVLGAVFSS 194
              F        L     I      P R++       N+ FSL  AS   G VLGAV   
Sbjct: 136 AGRFIAGIGGGGLTTLSTITTSDIIPLRKRGVYQGLGNICFSLGCAS---GSVLGAVLQQ 192

Query: 195 MLGQLAWWPWAYWL---MGIACFLLAVAGYYLIPHTP------MPNRDVASF---KLLER 242
            +G    W WA+ +   + +   LL V    L   +P      + +    +F   K+ + 
Sbjct: 193 GIG----WRWAFLIQVPIALISGLLIVFVLELPSDSPGRGLIWLEHARGNTFQWSKVTKM 248

Query: 243 IDFAGSVTGVVGLILF 258
           IDF GS+T V+ ++L 
Sbjct: 249 IDFVGSITLVMSMLLL 264

>TDEL0C00120 Chr3 complement(7481..9190) [1710 bp, 569 aa] {ON} 
          Length = 569

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 83/387 (21%), Positives = 149/387 (38%), Gaps = 25/387 (6%)

Query: 69  HIIGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLA 128
             IG+ F   N    SW  +AY +T  +F  + G   D  G +         + +  L  
Sbjct: 80  QTIGNEFNHMNIS--SWITTAYLITSTSFQPLYGSFSDALGRRNCLFFANTSFTIGCLAC 137

Query: 129 GFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSLFGASAPG-GFV 187
           G S   N +     RA  G+G   L+  +  I+     P  ++  +F  F     G G +
Sbjct: 138 GLS--PNIVVLSFMRALTGIGGGGLITLS-TIVNSDMIPSSKRG-IFQAFQNLLLGLGAI 193

Query: 188 LGAVFSSMLGQLAWWPWAYWLMGIACFLLA-VAGYYLIPHTPMPNRDVASF----KLLER 242
            GA F   +     W W +++    C   + +   Y+       +R++       K+L+ 
Sbjct: 194 CGASFGGSIASSIGWRWCFFVQVPICITNSLIMSSYVPNQKEYEDREIGFLFHPKKILKD 253

Query: 243 IDFAGSVTGVVGLILFNFAWNQGPV---VGWQTPYTYALLIVGTVFLIIFAFIESRXXXX 299
           ID  GSV  ++GL L     + G     V W +P    LL    + L++F + E++    
Sbjct: 254 IDVTGSVFIIIGLTLQLLYLSLGSSKVGVSWTSPSVLPLLFASGIILVLFVYNEAKTSAR 313

Query: 300 XXX-XXXXSSDTAFVLSCIA--AGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAIS 356
                    S  +FV+  I+   G+AS+  ++F    F +   G +   +  + +  ++ 
Sbjct: 314 AIIPLELMRSSFSFVVLTISILVGFASYA-YLFTLPLFFQIVLGDSTAKAGLRLTIPSLF 372

Query: 357 GFCAALMTGFLLSHTPPSTVMFFA-MTAFTVGTILIATAPVHQTYWAQTFVSIIVMP--W 413
                L+TG  +S      ++ +A +    +G  L          W    V + ++P   
Sbjct: 373 TPVGGLITGICMSRYNCLQILLYAGVFLMALGNFLFLFIEKGSPNW---LVGLFLIPANL 429

Query: 414 GMDMSFPAATIMLSDSMPHEHQGLAAS 440
           G  ++FPA       + P   Q  A S
Sbjct: 430 GQGITFPATLFTFIFAFPKSRQATATS 456

>TPHA0G03150 Chr7 (670343..672145) [1803 bp, 600 aa] {ON} Anc_2.473
           YMR088C
          Length = 600

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 48/189 (25%), Positives = 84/189 (44%), Gaps = 8/189 (4%)

Query: 68  LHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLL 127
           ++ + + F  +N  Q  W A++Y LT   F  + GRL DI G K   ++  F++ + S L
Sbjct: 90  MNRVAEDFNASNQKQ--WIATSYLLTNTAFQPLYGRLSDIIGRKYTQLIVPFFFGMGSFL 147

Query: 128 AGFSVYSNQIFFDCCRAF---QGMGPAFLLPNAIAILGRTYKPGRRKNMVFSLFGASAPG 184
             FS    Q  F   RA     G G + +   A++ +    + G  +      +GA    
Sbjct: 148 TTFSKTLPQ--FALARAVAGIGGGGISAMSSIAVSDICTVKERGMYQGYANIFYGAGQLI 205

Query: 185 GFVLGAVFSSMLGQLAWWPWAYWLMGIACFLLAVAGYYLIPHTPMPNRDVASFKLLERID 244
           G  +G +    +G  A + +   ++ +A FL        + H P P  +   +K L ++D
Sbjct: 206 GAPIGGLLIDRIGWRALFAFQVPMVAVAMFLSFTYLNIKLAHLP-PKEERYKWKHLSKLD 264

Query: 245 FAGSVTGVV 253
             GS+T V+
Sbjct: 265 IFGSITLVI 273

>KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 651

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/157 (26%), Positives = 72/157 (45%), Gaps = 19/157 (12%)

Query: 69  HIIGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLA 128
             IG+ F   N   + W  + YSL+   F L+ GR+  + G K   +L    + + SL+A
Sbjct: 68  ETIGEKFNDYN--DVGWLVTGYSLSSALFTLLWGRMASLLGLKTCLMLSVLIFEIGSLIA 125

Query: 129 GFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMV-----FSLFGASAP 183
             +V ++       R   G G +  + + + I+G +    R + MV     F+  G++A 
Sbjct: 126 --AVSNSMGMLIAGRVVAGAGGSG-IQSLVYIVGTSLVSERSRGMVIMVLTFAFVGSNA- 181

Query: 184 GGFVLGAVFSSMLGQLAWWPWAYWLM----GIACFLL 216
           GG +LG      L + A W W +++     G A F+L
Sbjct: 182 GGPILGGA----LNEHASWRWCFFINLPIGGAAAFML 214

>YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON}
           VBA5Putative transporter of the Major Facilitator
           Superfamily (MFS); proposed role as a basic amino acid
           permease based on phylogeny
          Length = 582

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 58/262 (22%), Positives = 106/262 (40%), Gaps = 55/262 (20%)

Query: 68  LHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLL 127
           + ++ + FG  N  +  W  + YSL      LI GR   I G +   +L    +   SL+
Sbjct: 61  IDVVAEQFG--NYSKTGWLVTGYSLPNAILSLIWGRFASIIGFQHSLILAILIFEAGSLI 118

Query: 128 AGFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSL----FGASAP 183
           A  +   N + F   R   G+G +  L     ++G T    R + +V S+    F  +A 
Sbjct: 119 AALASSMNMLIFG--RVVAGVGGSG-LQTLCFVIGCTMVGERSRPLVISILSCAFAVAAI 175

Query: 184 GGFVLGAVFSSMLGQLAWWPWAYWL------MGIACFLLAVAGYY--LIPHTPMPNRDVA 235
            G ++G  F++ +     W W +++      + I  FLL        ++         ++
Sbjct: 176 VGPIIGGAFTTHV----TWRWCFYINLPIGGLAIIMFLLTYKAENKGILQQIKDAIGTIS 231

Query: 236 SF---KLLERIDFAGSVTGVV-------------GLILF---------NFAWNQGPVVGW 270
           SF   K   +++F   + G++             GL+LF          ++WN G V+ +
Sbjct: 232 SFTFSKFRHQVNFKRLMNGIIFKFDFFGFALCSAGLVLFLLGLTFGGNKYSWNSGQVITY 291

Query: 271 QTPYTYALLIVGTVFLIIFAFI 292
                   L++G V L IF+ +
Sbjct: 292 --------LVLG-VLLFIFSLV 304

>Kwal_56.23754 s56 complement(690851..692620) [1770 bp, 589 aa] {ON}
           YBR293W - Hypothetical ORF [contig 173] FULL
          Length = 589

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 61/235 (25%), Positives = 98/235 (41%), Gaps = 29/235 (12%)

Query: 71  IGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGF 130
           IG  F + +  ++SW A++Y L+  T   + G+L D  G K   V     +++  L+ G 
Sbjct: 109 IGSEFNSLD--KVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLVFSNVVFSIGCLICGM 166

Query: 131 SVYSNQIFFDCCRAFQ----GMGPAFLLPNAIAILGRTYKPGRRKNMVFSLFGASAPGGF 186
              S  I++     F     G G   L    I+ L    +    + +   +FG     G 
Sbjct: 167 ---STSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLCNFIFGLGTASGG 223

Query: 187 VLGAVFSSMLGQLAWWPWAYWLMG----IACFLLAVAGYYLIPHTPMPNRDVASFKLLER 242
           ++GA F         W  A+ +       +C L  +  Y  +P     ++D      L  
Sbjct: 224 LVGAAFQD-------WRMAFTIQCPISLASCAL--IVSYLELPPRHEDDKDRHWTSKLRD 274

Query: 243 IDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYT---YALLIVGTVFL-IIFAFIE 293
           +D+AG VT V  L LF    + G   G +  Y    +ALL V T+ L  IFA++E
Sbjct: 275 LDWAGVVTLVCFLFLFMLVSSLG---GKEIAYDSVLFALLCVTTLVLGSIFAYVE 326

>NCAS0G02990 Chr7 complement(549460..551205) [1746 bp, 581 aa] {ON} 
          Length = 581

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 60/237 (25%), Positives = 101/237 (42%), Gaps = 27/237 (11%)

Query: 2   TLSSPVTEENLDMNVETLKKDDEVLSDEFDVQEEKPESLLWESAFVGVLCSAQLMTQAGL 61
           TLS   T E   ++ ++L+  DE   +E   +   P +LL      G++    L+T  G 
Sbjct: 49  TLSRATTRE---IDGDSLQSSDEE-KNEQASESTSPYTLLTYKQKWGMVA---LLTMCGF 101

Query: 62  GQSLAP------LHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFV 115
             SL        L  +   FG  +  +++     Y L  G    I+G L D+FG +   +
Sbjct: 102 WSSLGSPIYYPALRQLEKQFGL-DENKVNVTVVVYLLFQGIAPTISGGLADVFGRRPVIL 160

Query: 116 LGFFWYALWSL-LAGFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMV 174
           +G   Y + S+ LA    Y   +F    R  Q +G +  +  +  ++G       R   V
Sbjct: 161 IGMLIYVVASIGLACAPSYGVIVFL---RIIQSIGISPTIAISSGVVGDFTLKHERGTFV 217

Query: 175 FSLFGASAPGGFVLGAVFSSMLGQL--AWWPWA--YWLMGIACFLLAVAGYYLIPHT 227
               GA++ G  +LG  F S++G +  A W W   +W + I C    +  + L+P T
Sbjct: 218 ----GATS-GLVLLGQCFGSLIGAVLAAAWNWRAIFWFLTIGCGTSFIIAFLLLPET 269

>YNL065W Chr14 (503724..505484) [1761 bp, 586 aa] {ON}  AQR1Plasma
           membrane multidrug transporter of the major facilitator
           superfamily, confers resistance to short-chain
           monocarboxylic acids and quinidine; involved in the
           excretion of excess amino acids
          Length = 586

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 59/242 (24%), Positives = 97/242 (40%), Gaps = 29/242 (11%)

Query: 2   TLSSPVTEE---NLDMNVETLKKDDEV-LSDEFDVQEEKPESLLWESAFVGVLCSAQLMT 57
           TLS   T E   +LD    +   DD+V  + +   + + P +LL      G++    ++T
Sbjct: 51  TLSKTTTREIEGDLDSETSSHSSDDKVDPTQQITAETKAPYTLLSYGQKWGMVA---ILT 107

Query: 58  QAGLGQSLAP------LHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHK 111
             G   SL        L  +   F   +   ++     Y L  G    ++G L D FG +
Sbjct: 108 MCGFWSSLGSPIYYPALRQLEKQF-NVDENMVNVTVVVYLLFQGISPTVSGGLADCFGRR 166

Query: 112 KFFVLGFFWYALWSL-LAGFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRR 170
              + G   Y + S+ LA    Y   IF  C ++  G+ P   + + +  +G       R
Sbjct: 167 PIILAGMLIYVIASIGLACAPSYGVIIFLRCIQSI-GISPTIAISSGV--VGDFTLKHER 223

Query: 171 KNMVFSLFGASAPGGFVL-GAVFSSMLGQL--AWWPWA--YWLMGIACFLLAVAGYYLIP 225
              V       A  GFVL G  F S++G +  A W W   +W + I C    +  + ++P
Sbjct: 224 GTFV------GATSGFVLLGQCFGSLIGAVLTARWDWRAIFWFLTIGCGSCFLIAFLILP 277

Query: 226 HT 227
            T
Sbjct: 278 ET 279

>Suva_4.553 Chr4 (959592..961280) [1689 bp, 562 aa] {ON} YBR293W
           (REAL)
          Length = 562

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 51/233 (21%), Positives = 88/233 (37%), Gaps = 12/233 (5%)

Query: 69  HIIGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLA 128
             IG+ F   +    SW  +AY +T  +F  + G   D  G +      FF  A++++  
Sbjct: 83  QTIGNEFNQMSIS--SWITTAYLITSTSFQPLYGSFSDALGRRNCL---FFANAVFTIGC 137

Query: 129 GFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSLFGASAPG-GFV 187
               +S  I+               L     I+     P  ++  +F  F     G G +
Sbjct: 138 LACSFSTNIYMLSFMRALAGIGGGGLITLSTIVNSDVIPSSKRG-IFQAFQNLLLGFGAI 196

Query: 188 LGAVFSSMLGQLAWWPWAYWLMGIACFLLAVAGYYLIPHTP-----MPNRDVASFKLLER 242
            GA F   +     W W + +      + ++   Y +P+         N  ++S K+L+ 
Sbjct: 197 CGASFGGTITSTIGWRWCFLIQVPISMIASLLMNYYVPNQKEYDDQKINILLSSKKILKD 256

Query: 243 IDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTVFLIIFAFIESR 295
           ID  GS+  + GL L     + G    W  P    LL+   V +I+F   E +
Sbjct: 257 IDITGSILIIAGLTLQLLYLSLGASFSWTNPPVLMLLLASIVIIILFILNERK 309

>Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198W
           (REAL)
          Length = 543

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 53/247 (21%), Positives = 92/247 (37%), Gaps = 52/247 (21%)

Query: 81  GQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNQIFFD 140
           G + W  + Y+LT   F+L+ GRL +I G  +  ++    + + SL++  S     +   
Sbjct: 43  GNIGWLVTGYALTNAVFMLLWGRLAEILGTNECLMISVIIFEVGSLISALSNSMGTLI-- 100

Query: 141 CCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSLFG----ASAPGGFVLGAVFSSML 196
             R   G G + +   A  +     +   R  M+ +L      A   G F+ GA F+  L
Sbjct: 101 SGRLIAGFGGSGIESLAFVVGTSIVQENHRGTMITALATSYVIAEGVGPFIGGA-FNEHL 159

Query: 197 GQLAWWPWAYWL-MGIACFLLAVAGYYLIPHTPMPN-------RDVASFKLLE------- 241
                W W +++ + I  F L +  +       +P        + + S+K  E       
Sbjct: 160 S----WRWCFYINLPIGAFALIILAFCNTSGESLPKVSLLSKIKSIMSYKYDEVFKASFW 215

Query: 242 ---------RIDFAGSVTGVVGLILF---------NFAWNQGPVVGWQTPYTYALLIVGT 283
                    ++D  G      G  L          NFAWN   ++        +L  VG 
Sbjct: 216 KKAFKVFVFKLDMIGVTLSSAGFTLLMLGLSFGGNNFAWNSSTII--------SLFTVGP 267

Query: 284 VFLIIFA 290
           + LI+F 
Sbjct: 268 ILLILFC 274

>KLTH0E16720g Chr5 (1482846..1484570) [1725 bp, 574 aa] {ON} similar
           to uniprot|P38358 Saccharomyces cerevisiae YBR293W VBA2
           Permease of basic amino acids in the vacuolar membrane
          Length = 574

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 73/306 (23%), Positives = 134/306 (43%), Gaps = 31/306 (10%)

Query: 5   SPVTEENLDMNVETLKKDDEVLS-DEFDVQEEKPESLLWESA-FVGVLCSAQLMTQAGLG 62
           +P   +N+  +  ++ +++++ S  E     E+ + LL E+A F  V  S       GL 
Sbjct: 7   NPNERKNVPPSYSSISREEQMFSLTERPSWSERHKVLLIETALFTNVFLS-------GLD 59

Query: 63  QSLAP--LHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKK--FFVLGF 118
            +++     +IG+ FG       SW  +AY +T  +F  + G   D  G +   FF    
Sbjct: 60  STISASTYQLIGNEFGDVKLS--SWITTAYLITCTSFQPLYGSFSDTLGRRHCLFFANTI 117

Query: 119 FWYALWSLLAGFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSLF 178
           F    +      ++YS  +     RA  G+G   L+  +  I+     P +++ +  +  
Sbjct: 118 FALGCFGCGTTTTIYSLILM----RALTGIGGGGLITLS-TIINSDIIPAKKRGIYQAFQ 172

Query: 179 GASAPGGFVLGAVFSSMLGQLAWWPWAYWL-MGIACFLLAVAGYYLIPHTPMPNRDVASF 237
                 G V+GA    ++     W W + L + I+     VA +++    P  N  V++ 
Sbjct: 173 NVLLGTGAVVGASCGGLIATTMGWRWCFLLQVPISVGGTLVAFFFVHDQRPDINGGVSAV 232

Query: 238 KL-----LERIDFAGSVTGVVGLI--LFNFAWN---QGPVVGWQTPYTYALLIVGTVFLI 287
           +      LE+IDF+G++  V+GL   LF    N   +     W +P +  L +   V LI
Sbjct: 233 RTTGWEKLEKIDFSGALLLVLGLACQLFFLTLNSTSKSSESYWYSPQSIVLTLSTGVSLI 292

Query: 288 IFAFIE 293
           +FA++E
Sbjct: 293 LFAYVE 298

>YBR293W Chr2 (787006..788430) [1425 bp, 474 aa] {ON}  VBA2Permease
           of basic amino acids in the vacuolar membrane
          Length = 474

 Score = 40.0 bits (92), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 72/301 (23%), Positives = 122/301 (40%), Gaps = 21/301 (6%)

Query: 84  SWFASAYSLTVGTFILIAGRLGDIFGHKK--FFVLGFFWYALWSLLAGFSVYSNQIFFDC 141
           +W  +AY +T  +F  + G   D  G +   FF  G F   +  L  GFS   N      
Sbjct: 5   NWITTAYLITSTSFQPLYGSFSDALGRRNCLFFANGAF--TIGCLACGFS--KNIYMLSF 60

Query: 142 CRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSLFGASAPG-GFVLGAVFSSMLGQLA 200
            RA  G+G   L+  +  I+     P  ++  +F  F     G G + GA F   +    
Sbjct: 61  MRALTGIGGGGLITLS-TIVNSDVIPSSKRG-IFQAFQNLLLGFGAICGASFGGTIASSI 118

Query: 201 WWPWAYWLMGIACFLLAVAGYYLIPHTPMPNRDVASF-----KLLERIDFAGSVTGVVGL 255
            W W + +      + ++   Y +P+    NR  +S      K+L  ID  GS+  + GL
Sbjct: 119 GWRWCFLIQVPISVISSILMNYYVPNQKEYNRQNSSIFQNPGKILRDIDVMGSILIITGL 178

Query: 256 ILFNFAWNQG---PVVGWQTPYTYALLIVGTVFLIIFAFIESRXXXXXX--XXXXXSSDT 310
            L     + G     + W +P    LL+   + L++F   E +             SS +
Sbjct: 179 TLQLLYLSLGCSTSKLSWTSPSVLLLLVGSVIILLLFILHERKTSARAIIPMELVNSSYS 238

Query: 311 AFVLS-CIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAISGFCAALMTGFLLS 369
             VLS  I  G+AS+  ++F    F +   G +   +  + +  ++     +L+TGF +S
Sbjct: 239 VVVLSISILVGFASYA-YLFTLPLFFQIVLGDSTAKAGLRLTIPSLFTPVGSLITGFSMS 297

Query: 370 H 370
            
Sbjct: 298 K 298

>SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} similar
           to uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 677

 Score = 40.0 bits (92), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 32/143 (22%), Positives = 58/143 (40%), Gaps = 5/143 (3%)

Query: 66  APLHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWS 125
           A + +I + F   +  +  W  S YSLT     L+ GR   I G K   ++    +   S
Sbjct: 140 ASIEVIAEQF--KDYSKSGWIVSGYSLTEALLTLLWGRFATIIGFKSSLLVSILIFEAGS 197

Query: 126 LLAGFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSLFGASAPGG 185
           L++  S   N +     R   G+G +  + +   ++  T  P R + ++ S+   S    
Sbjct: 198 LISAISNSMNMLIGG--RVVAGIGGSG-IQSLCFVIASTLTPDRSRVIIISVLSCSYAVA 254

Query: 186 FVLGAVFSSMLGQLAWWPWAYWL 208
            V+G      L     W W +++
Sbjct: 255 AVVGPFLGGALTTHVTWRWCFYI 277

>NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa]
           {ON} Anc_2.473
          Length = 568

 Score = 40.0 bits (92), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 51/202 (25%), Positives = 90/202 (44%), Gaps = 22/202 (10%)

Query: 68  LHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLL 127
           ++ + + F  ++  Q  W A+++ LT   F  + G+L DI G K   +   F++ L   L
Sbjct: 64  MNKVAEEFEESDKKQ--WIATSFLLTNTAFQPLYGKLSDITGRKFAVLTSHFFFGLGCFL 121

Query: 128 AGFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFS-----LFGASA 182
             F+   N   F   RA  G+G   +  NA++ +  +     R+  ++      +FG   
Sbjct: 122 TCFA--QNITQFSIARAICGIGAGGV--NAMSSITVSDICSTRERGIYQGYANIVFGLGQ 177

Query: 183 PGGFVLGAVFSSMLGQLAWWPWAYWL---MGIACFLLAVAGYYL-IPHTPMPNRDVASFK 238
             G  LG +F   +G    W   + +   M + C  LA     + + H P P ++  ++K
Sbjct: 178 LLGAPLGGLFIDSVG----WRVIFGVQVPMLLLCSTLATRNINVKLAHIP-PRKERFTWK 232

Query: 239 LLERIDFAGS--VTGVVGLILF 258
            L RID  GS  + G +  +LF
Sbjct: 233 NLSRIDIFGSLALVGTISSLLF 254

>KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 573

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 49/237 (20%), Positives = 90/237 (37%), Gaps = 38/237 (16%)

Query: 69  HIIGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLA 128
             IG+ F   +  ++ W  + Y+L    F L+ GRL  I G K         + + SL+ 
Sbjct: 32  ETIGEKF--KDYARIGWLVTGYALPNALFTLLWGRLASILGLKTSLTFSIVIFEIGSLIV 89

Query: 129 GFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSLFGASAPGGFVL 188
             S     I     R   G G +  + + + ++G +    R + MV ++ G +    F +
Sbjct: 90  AVSNSMGMIIGG--RVVAGCGGSG-IQSLVFVVGTSLVEERNRGMVITVLGLAFAVAFAV 146

Query: 189 GAVFSSMLGQLAWWPWAYWLM----GIACFLLAVA---GYYLIPHTPMPN-RDVASFK-- 238
           G V      +   W W +++     G+A  +L  +       +  T   N R + +++  
Sbjct: 147 GPVIGGAFTENVSWRWCFYINLPIGGVALTMLTFSYNTTEKSVQETLTYNCRQLQTYRYG 206

Query: 239 --------------LLERIDFAGSVTGVVGLILF---------NFAWNQGPVVGWQT 272
                         L+  +DF G      G +LF          +AWN G ++ + T
Sbjct: 207 QWVTASFWRRAYNFLMFDLDFIGFALSSTGFVLFMLGLTFGGNTYAWNSGTIISFLT 263

>SAKL0E08756g Chr5 complement(714902..716599) [1698 bp, 565 aa] {ON}
           similar to uniprot|P53943 Saccharomyces cerevisiae
           YNL065W AQR1 Plasma membrane transporter of the major
           facilitator superfamily that confers resistance to
           short- chain monocarboxylic acids and quinidine
          Length = 565

 Score = 39.3 bits (90), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 38/152 (25%), Positives = 67/152 (44%), Gaps = 18/152 (11%)

Query: 100 IAGRLGDIFGHKKFFVLGFFWYALWSL-LAGFSVYSNQIFFDCCRAFQGMGPAFLLPNAI 158
           I+G L D++G +   + G   Y + S+ LA  + Y   +F  C ++  G+ P  L+  + 
Sbjct: 152 ISGGLADVYGRRPIILAGMLIYVVASIGLACSNSYGVIVFLRCVQS-AGISP--LIAISS 208

Query: 159 AILGRTYKPGRRKNMVFSLFGASAPGGFVL-GAVFSSMLGQ--LAWWPWA--YWLMGIAC 213
            ++G       R + V       A  GF L G  F S++G    A + W   +W + I C
Sbjct: 209 GVVGDFTTKSERGSFV------GAVSGFALMGQAFGSLIGAGLTAAYDWRAIFWFLTIGC 262

Query: 214 FLLAVAGYYLIPHTPMP---NRDVASFKLLER 242
               V  ++L+P T      N  +   +++ R
Sbjct: 263 GTCFVINFFLLPETKRTITGNLSIKPKRMINR 294

>Smik_2.434 Chr2 (773094..774518) [1425 bp, 474 aa] {ON} YBR293W
           (REAL)
          Length = 474

 Score = 38.9 bits (89), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 77/372 (20%), Positives = 143/372 (38%), Gaps = 23/372 (6%)

Query: 84  SWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNQIFFDCCR 143
           +W  +AY +T  +F  + G   D  G +         + +  L  GFS  SN       R
Sbjct: 5   NWITTAYLITSTSFQPLYGSFSDALGRRNCLFFANATFTIGCLACGFS--SNIYMLSFMR 62

Query: 144 AFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSLFGASAPG-GFVLGAVFSSMLGQLAWW 202
           A  G+G   L+  +  +        +R   +F  F     G G + GA F   +     W
Sbjct: 63  ALTGIGGGGLITLSTIVNSDVIPTSKRG--IFQAFQNLLLGFGAICGASFGGTIASTIGW 120

Query: 203 PWAYWLMGIACFLLAVAGYYLIPHTPMPNRDVASF-----KLLERIDFAGSVTGVVGLIL 257
            W + +      + ++   Y +P+    N   ++      K+L  ID  GS+  + GL L
Sbjct: 121 RWCFLIQVPISMISSILMNYYVPNQKEYNDQNSNIFNDPKKILTGIDVMGSILIITGLTL 180

Query: 258 FNFAWNQG---PVVGWQTPYTYALLIVGTVFLIIFAFIESRXXXXXXX-XXXXSSDTAFV 313
                + G     + W +P    LL    + L++F   E +            SS  +FV
Sbjct: 181 QLLYLSLGCSTSNLSWTSPSVLLLLFGSVIILLLFILHERKTTARAIIPMELVSSSYSFV 240

Query: 314 LSCIA--AGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAISGFCAALMTGFLLS-H 370
           +  I+   G+AS+  ++F    F +   G +   +  + +  ++     +L+TGF +S +
Sbjct: 241 VLSISILVGFASYA-YLFTLPLFFQIVLGDSTAKAGLRLTIPSLFTPVGSLITGFSMSKY 299

Query: 371 TPPSTVMFFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMP--WGMDMSFPAATIMLSD 428
               ++++  ++   +G  L          W    +S+ ++P   G  ++FP        
Sbjct: 300 NCLRSLLYLGISLMFLGNFLFLFIEETSPNW---LISLFLIPANLGQGITFPTTLFTFIF 356

Query: 429 SMPHEHQGLAAS 440
             P   Q  A S
Sbjct: 357 MFPKSDQATATS 368

>KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 579

 Score = 38.9 bits (89), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 29/50 (58%)

Query: 82  QLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFS 131
            +SW A+AY L+  TF  + G++ DIFG +   ++   ++ L  L+ G S
Sbjct: 97  HISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLS 146

>Skud_2.423 Chr2 (756345..758027) [1683 bp, 560 aa] {ON} YBR293W
           (REAL)
          Length = 560

 Score = 38.9 bits (89), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 99/489 (20%), Positives = 184/489 (37%), Gaps = 52/489 (10%)

Query: 5   SPVTEENLDMNVETLKKDDEVLSDEFD---VQEEKPESLLWESAFVGVLCSAQLMTQAGL 61
           + + E+N D  +E + KD+++         + E    S ++ S F G + ++   T    
Sbjct: 26  TSLVEDNAD--IEDVDKDEDMALSRIPNLWIIEATLFSNVFLSGFDGTVTASTYQT---- 79

Query: 62  GQSLAPLHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWY 121
                    IG+ F   +     W  +AY +T  +F  + G   D  G +      FF  
Sbjct: 80  ---------IGNEFNQMSISN--WITTAYLITSTSFQPLYGSFSDALGRRNCL---FFAN 125

Query: 122 ALWSLLAGFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSLFGAS 181
           A +++       S  I+               L     I+     P  ++  +F  F   
Sbjct: 126 AAFTIGCLACSLSTNIYTLSLMRALAGIGGGGLITLSTIVNSDVIPSSKRG-IFQAFQNL 184

Query: 182 APG-GFVLGAVFSSMLGQLAWWPWAYWLMGIACFLLAVAGYYLIPHTPMPNRDVA----- 235
             G G + GA F   +     W W + +      + +V   Y +P+    N + +     
Sbjct: 185 LLGFGAICGASFGGTIASTIGWRWCFLIQVPISIISSVLMNYYVPNQKEYNHENSNIFRN 244

Query: 236 SFKLLERIDFAGS---VTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTVFLIIFAFI 292
           S ++L  ID  GS   +TG+   +L+      G  + W +P    LL+     L++F   
Sbjct: 245 SKRILTDIDITGSILIITGLTLQLLYLSLGCSGSKLSWTSPSVLLLLVGSIAILLLFISH 304

Query: 293 ESRXXXXXXX-XXXXSSDTAFV--LSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQ 349
           E +            SS  +FV  L  I  G+AS+  ++F    F +   G +   +  +
Sbjct: 305 EKKTTARAIIPMELVSSSYSFVVLLISILVGFASYA-YLFTLPLFFQIVLGDSTAKAGLR 363

Query: 350 FSPVAISGFCAALMTGFLLS-HTPPSTVMFFAMTAFTVGTILIATAPVHQTYWAQTFVSI 408
            +  ++     +L+TGF +S +    ++++  ++   +G  L          W    +S+
Sbjct: 364 LAIPSLFTPVGSLITGFSMSKYNCLRSLLYVGVSLMFLGNFLFLFIEKTSPNW---LISL 420

Query: 409 IVMP--WGMDMSFPAATIMLSDSMPHEHQGLAASL------VNTVVNYSISIG---LGIA 457
            ++P   G  ++FP          P   Q  A S       + +V   +IS G   L  A
Sbjct: 421 FLIPANLGQGITFPTTLFTFIFLFPKSDQATATSTLYLFRSIGSVWGVAISAGVIQLSFA 480

Query: 458 GTIESNVND 466
             + SN+ D
Sbjct: 481 KYLRSNLKD 489

>Ecym_7399 Chr7 complement(820280..821971) [1692 bp, 563 aa] {ON}
           similar to Ashbya gossypii ABL040W
          Length = 563

 Score = 38.5 bits (88), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 38/181 (20%), Positives = 79/181 (43%), Gaps = 14/181 (7%)

Query: 82  QLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNQIFFDC 141
           ++ W A+++ LT   F  I G+L D+ G +   VL +  + L  L+  ++   N   F  
Sbjct: 83  RIQWVATSFLLTSTVFQPIYGKLSDVTGRRFVLVLAYSLFLLGCLVTAYA--RNIWEFAF 140

Query: 142 CRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSLFGASAPGGFVLGAVFSSMLGQLAW 201
            RA  G+G   +    +  +G  +    +     S++ + A   + +G V  + +G +A 
Sbjct: 141 GRAICGIGAGGIPTMCVITMGDMFSVKEQ-----SIYQSYAHIIYTIGEVLGAPIGGIAL 195

Query: 202 WPWAYWLMGIA-------CFLLAVAGYYLIPHTPMPNRDVASFKLLERIDFAGSVTGVVG 254
               +  + +A       C  L +    L      P+ +  ++K + R+D +GS+  ++ 
Sbjct: 196 ETVGWRAIFLAQVPVLTICIYLTLCDDDLAQQHIPPHGERLTWKNISRMDLSGSILLIIS 255

Query: 255 L 255
           L
Sbjct: 256 L 256

>Smik_14.262 Chr14 (484135..485820) [1686 bp, 561 aa] {ON} YNL065W
           (REAL)
          Length = 561

 Score = 38.5 bits (88), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 42/162 (25%), Positives = 67/162 (41%), Gaps = 18/162 (11%)

Query: 90  YSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSL-LAGFSVYSNQIFFDCCRAFQGM 148
           Y L  G    ++G L D FG +   + G   Y + S+ LA    Y   IF  C ++  G+
Sbjct: 144 YLLFQGISPTVSGGLADCFGRRPIILAGMLIYVVASIGLACAPSYGVIIFLRCIQSI-GI 202

Query: 149 GPAFLLPNAIAILGRTYKPGRRKNMVFSLFGASAPGGFVL-GAVFSSMLGQL--AWWPWA 205
            P   + + +  +G       R   V       A  GFVL G  F S++G +  A W W 
Sbjct: 203 SPTIAISSGV--VGDFTLKHERGTFV------GATSGFVLLGQCFGSLIGAVLTARWDWR 254

Query: 206 --YWLMGIACFLLAVAGYYLIPHTPMP---NRDVASFKLLER 242
             +W + I C    +  + ++P T      N  +   +L+ R
Sbjct: 255 SIFWFLTIGCGSCFLIAFLILPETKRTIAGNLSIKPKRLINR 296

>ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 590

 Score = 38.5 bits (88), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 29/50 (58%)

Query: 82  QLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFS 131
           ++SW A+AY L+  TF  + G+L DIFG K   +L    + +  L+ G +
Sbjct: 115 RISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLT 164

>Skud_14.267 Chr14 (493984..495672) [1689 bp, 562 aa] {ON} YNL065W
           (REAL)
          Length = 562

 Score = 38.1 bits (87), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 40/144 (27%), Positives = 61/144 (42%), Gaps = 15/144 (10%)

Query: 90  YSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSL-LAGFSVYSNQIFFDCCRAFQGM 148
           Y L  G    I+G L D FG +   + G   Y + S+ LA    Y   IF  C ++  G+
Sbjct: 145 YLLFQGVSPTISGGLADCFGRRPIILAGMLIYVVASIGLACAPSYGVIIFLRCIQSI-GI 203

Query: 149 GPAFLLPNAIAILGRTYKPGRRKNMVFSLFGASAPGGFV-LGAVFSSMLGQL--AWWPWA 205
            P   + +   ++G       R   V       A  GFV LG  F S++G +  A W W 
Sbjct: 204 SPTIAISS--GVVGDFTLKHERGTFV------GATSGFVLLGQCFGSLIGAVLTARWDWR 255

Query: 206 --YWLMGIACFLLAVAGYYLIPHT 227
             +W + I C    +  + ++P T
Sbjct: 256 SIFWFLTIGCGSCFLIAFLVLPET 279

>Suva_14.276 Chr14 (502686..504374) [1689 bp, 562 aa] {ON} YNL065W
           (REAL)
          Length = 562

 Score = 38.1 bits (87), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 36/134 (26%), Positives = 58/134 (43%), Gaps = 15/134 (11%)

Query: 100 IAGRLGDIFGHKKFFVLGFFWYALWSL-LAGFSVYSNQIFFDCCRAFQGMGPAFLLPNAI 158
           + G L D FG +   + G   Y + S+ LA    Y   IF  C ++  G+ P   + + +
Sbjct: 155 VCGGLADCFGRRPIILGGMLVYVVASVGLACAPSYGVIIFLRCVQSI-GISPTIAISSGV 213

Query: 159 AILGRTYKPGRRKNMVFSLFGASAPGGFVL-GAVFSSMLGQL--AWWPWA--YWLMGIAC 213
             +G       R   V       A  GFVL G  F S++G +  A W W   +W + I C
Sbjct: 214 --VGDFTLKHERGTFV------GATSGFVLLGQCFGSLIGAVLTARWDWRSIFWFLTIGC 265

Query: 214 FLLAVAGYYLIPHT 227
               +  ++++P T
Sbjct: 266 GTCFLIAFFILPET 279

>Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON}
           (96992..98923) [1932 nt, 644 aa]
          Length = 643

 Score = 38.1 bits (87), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 29/50 (58%)

Query: 82  QLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFS 131
           ++SW A+AY L+  TF  I G++ DIFG K   +     + + SL+ G S
Sbjct: 157 RISWVATAYLLSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLS 206

>KLLA0E09879g Chr5 complement(874102..875994) [1893 bp, 630 aa] {ON}
           similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 630

 Score = 37.7 bits (86), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 66/316 (20%), Positives = 122/316 (38%), Gaps = 39/316 (12%)

Query: 4   SSPVTEENLDMNVETLKKDDEV-LSDEFDVQEEKPESLLWESAFVGVLCSAQLMTQAGLG 62
           S PV+++  D       +D  V L + F    EK +S +     + V   A ++ Q  + 
Sbjct: 30  SEPVSKKYEDKKAGEDAEDVPVDLKNVFTSDNEKTQSSIMAGMRLYVCLFALVLAQLIVA 89

Query: 63  QSLAPLHIIGD--SFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFW 120
             +  ++ + D  S       +  W  + YSL      LI GR   + G +   ++  F 
Sbjct: 90  LDVFIVNTVIDVVSKNLGGYAKSGWLITGYSLPNSLLSLIWGRATSLLGFQSSMLISIFI 149

Query: 121 YALWSLLAGFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVF----S 176
           + + S+++  +   N +     R   G+G + L   ++ I+G +    R + +V     S
Sbjct: 150 FEVGSIVSATATSMNNLVVG--RVVAGIGGSGLQTVSM-IIGCSLVEERNRTIVIAVIMS 206

Query: 177 LFGASAPGGFVLGAVFSSMLGQLAWWPWAYWLM----GIACFLL--------------AV 218
            F  S+  G  +G  F++     A W W +W+     G A FL                V
Sbjct: 207 AFAVSSLIGPFIGGAFTTH----ATWRWCFWISLPVGGSAAFLFFFTYNPERLSITARLV 262

Query: 219 AGYYLIPHTPMPN-RDVASFK-----LLERIDFAGSVTGVVGLILFNFAWNQGPVVG-WQ 271
               L+   P+   + V ++K     L+ R D  G      G+ LF      G     W+
Sbjct: 263 RCLKLVKAIPLKQFQYVETYKTIVRNLVFRFDLIGFTLNCTGICLFLLGLTFGSEDNSWK 322

Query: 272 TPYTYALLIVGTVFLI 287
             +    L++G + ++
Sbjct: 323 RAFVVCFLVIGGLLVV 338

>ZYRO0G21868g Chr7 complement(1799212..1801074) [1863 bp, 620 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 620

 Score = 37.7 bits (86), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 75/306 (24%), Positives = 127/306 (41%), Gaps = 66/306 (21%)

Query: 16  VETLKKDDEVLSDEFDVQEEKPESLLWESAFVGVLCSAQLMTQAGLGQSLAPLHIIGDSF 75
           +E  K+D+E L  E D+++  P++  W      +  ++ L    G   S   ++ +   F
Sbjct: 81  LEGNKEDEEDL--EIDLRD--PKTFKW--VLTSLWTNSALSALDGTIVS-TTVNDVASRF 133

Query: 76  GTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSN 135
             A+   ++W A+AY LT      + G++ DI G +K  + G   +A+     G  ++S 
Sbjct: 134 QQAS--MVTWVATAYLLTTTAAQPLYGKISDIIGRRKCLLFGEIVFAVG---VGLCIFSK 188

Query: 136 QIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSLFGA-SAPG-----GFVLG 189
            I            P   +   I  +G +   G   N++ S     S  G     G +LG
Sbjct: 189 SI------------PQLAIARGICGIGGS-GTGAMTNIILSDMAPLSERGKYWGYGSMLG 235

Query: 190 AVFSSMLGQLAWWPWAYWLMGIACFLLAVAGYYLIPHTPMP--------------NRDVA 235
            VF S+ G L      Y+          V+G + IP  P                N+D  
Sbjct: 236 GVFQSLGGPLGGILLTYF---------GVSGLF-IPQIPFCLATLYLSWKYVQDYNQDTK 285

Query: 236 -SFKLLERIDFAGSVTGVVGL--ILFNFAWNQGPVV----GWQTPYTYALLIVGTVFLII 288
            S+K   RIDF GS+  +VG+   +F F+ ++ P +    GW +PY      +  +F I+
Sbjct: 286 GSWK---RIDFGGSICLLVGISSFIFFFSADENPSISEHSGW-SPYKKWSFAIFVLFTIL 341

Query: 289 FAFIES 294
           F  +E 
Sbjct: 342 FLVVEK 347

>YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasma
           membrane multidrug transporter of the major facilitator
           superfamily, acts as an extrusion permease; partial
           multicopy suppressor of gal11 mutations
          Length = 543

 Score = 37.7 bits (86), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 57/247 (23%), Positives = 95/247 (38%), Gaps = 52/247 (21%)

Query: 81  GQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNQIFFD 140
           G + W  + Y+L+   F+L+ GRL +I G K+  ++    + + SL++  S  ++     
Sbjct: 43  GNIGWLVTGYALSNAVFMLLWGRLAEILGTKECLMISVIVFEIGSLISALS--NSMATLI 100

Query: 141 CCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSL----FGASAPGGFVLGAVFSSML 196
             R   G G + +   A  +     +   R  M+ +L      A   G F+ GA F+  L
Sbjct: 101 SGRVVAGFGGSGIESLAFVVGTSIVRENHRGIMITALAISYVIAEGVGPFIGGA-FNEHL 159

Query: 197 GQLAWWPWAYWLM----GIACFLLAVAGYYLIPHTPM---------PNRDV-----ASF- 237
                W W +++       A  +LA       PH  M          N D      ASF 
Sbjct: 160 S----WRWCFYINLPIGAFAFIILAFCNTSGEPHQKMWLPSKIKKIMNYDYGELLKASFW 215

Query: 238 -----KLLERIDFAGSVTGVVGLILF---------NFAWNQGPVVGWQTPYTYALLIVGT 283
                 L+ ++D  G +    G  L          NF WN G ++ + T        VG 
Sbjct: 216 KNTFEVLVFKLDMVGIILSSAGFTLLMLGLSFGGNNFPWNSGIIICFFT--------VGP 267

Query: 284 VFLIIFA 290
           + L++F 
Sbjct: 268 ILLLLFC 274

>TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.272
           YDR119W
          Length = 631

 Score = 37.7 bits (86), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 86/398 (21%), Positives = 164/398 (41%), Gaps = 34/398 (8%)

Query: 82  QLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNQIFFDC 141
           ++SW A++Y L+  TF  + G++ DIFG K   V     + +  L+ G S   +  +   
Sbjct: 147 KVSWIATSYLLSSATFQPLYGKVSDIFGRKCLLVFTNVAFLIGCLMCGLS--KSFWWLVI 204

Query: 142 CRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSL----FGASAPGGFVLGAVFSSMLG 197
            R   G+G   L   + +I      P R + M   +    +G     G ++G  FS   G
Sbjct: 205 ARFVAGVGGGGLTSMS-SITITDLVPLRERAMYQGICNVFYGLGTACGGIVGGWFSDNKG 263

Query: 198 QLAWWPWAYWLMGIACFLLAVAGYYLIPHTPMP------NRDVASFKLLERIDFAGSVTG 251
               W  A+    I   L A++   +I H  +P      N+D +  + L  ID+ G+ T 
Sbjct: 264 ---GWRMAFL---IQVPLSAISLLVIILHLKLPSKRATRNQDNSIKRKLLAIDWLGASTL 317

Query: 252 VVGLILFNFAWNQGPVVGWQTPY---TYALLIVGTVF-LIIFAFIESRXXXXXXXXXXXS 307
           V+ L+LF    + G   G +  Y   T+AL+++ ++   ++F ++E R            
Sbjct: 318 VIFLVLFLLTASLG---GKEIAYGSRTFALMLISSLLSCLVFIYVELRVAADPILPLRFL 374

Query: 308 SDTAFVLSCIAAGWASFGIWI--FYTWQFMEDSRGQTPLLSSAQFSPVAISGFCAALMTG 365
           +  + + S ++  +         +Y   +       +P     +  P   S    +L  G
Sbjct: 375 AIRSVLGSSLSNWFCMMATMTTSYYLPIYFSGVLNMSPTDVGKRLMPNFFSVAFGSLGAG 434

Query: 366 FLLSHTPPS---TVMFFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFPAA 422
           + +  T      +++F A+       IL+    +    W Q ++ ++V   G  +    A
Sbjct: 435 YYMKKTRKYYWFSLIFCAVAVLGQLQILLIDPKIPT--WRQ-YILLLVPGVGTSVLITVA 491

Query: 423 TIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTI 460
            + +  ++PHEHQ    S+     +   ++G+ I G I
Sbjct: 492 LLAMIAAVPHEHQAATTSISYAFRSAGCTLGVSIGGAI 529

>TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {ON}
           Anc_8.272 YDR119W
          Length = 906

 Score = 37.4 bits (85), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 41/185 (22%), Positives = 81/185 (43%), Gaps = 18/185 (9%)

Query: 82  QLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNQIFFDC 141
           ++ W A++Y L+   F  + G+L DIFG K   +     +    ++ G S   N + +  
Sbjct: 433 KVPWVATSYLLSSAVFQPLYGKLSDIFGRKALLIFSNLIFFFGCIICGMSNSLNMLVWG- 491

Query: 142 CRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSL----FGASAPGGFVLGAVFSSMLG 197
            R   G+G   +  +   I      P R + +   +    FG     G V+G +F   + 
Sbjct: 492 -RFVAGIGGGGIT-SMTTITVSDIVPLRSRAVYQGICNFFFGLGTAFGGVIGGIF---VD 546

Query: 198 QLAWWPWAYW----LMGIACFLLAVAGYYLIPHTPMPNRDVASFKLLERIDFAGSVTGVV 253
               W   +W    + G++  L  +  + ++P   + N +V+  + L R+D+ GS++ ++
Sbjct: 547 HQYGWRMVFWSQVPVSGLSTLL--ICSFLVVPR--IKNYEVSLGRKLMRVDWLGSISMIL 602

Query: 254 GLILF 258
            L  F
Sbjct: 603 WLTSF 607

>SAKL0E08778g Chr5 complement(716961..718763) [1803 bp, 600 aa] {ON}
           similar to uniprot|P40474 Saccharomyces cerevisiae
           YIL121W QDR2 Multidrug transporter required for
           resistance to quinidine barban cisplatin and bleomycin
           member of the major facilitator superfamily of
           transporters conferring multiple drug resistance
           (MFS-MDR)
          Length = 600

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 56/234 (23%), Positives = 99/234 (42%), Gaps = 30/234 (12%)

Query: 8   TEENLDMNVETLKKDDEVLSDEFDVQEEKPESLL--WESAFVGVLCSAQLMTQAGLGQSL 65
           T++N  + +E + K      +     +E P S     E + + VLC++     AGL  ++
Sbjct: 41  TDDNQKV-IEQISKPSSANPNNEKTCQEPPYSRFGKSEKSILAVLCAS-----AGLFSTI 94

Query: 66  -APLH-----IIGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFF 119
            AP++     II + F  +    ++     Y +  G   ++ G L D  G +   +    
Sbjct: 95  SAPIYYPALTIIEEDFNISQ-EMVNITVVVYFILQGLAPMLMGGLADKVGRRPIVLCSIA 153

Query: 120 WYALWSL-LAGFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSLF 178
            YA+  + LA    Y   +F  C ++  G+ P   + N I  +G       R   +  + 
Sbjct: 154 LYAVACIGLASAQNYGEVLFLRCLQS-AGISPVVAVNNGI--IGDITTKAERGGYLGLMA 210

Query: 179 GASAPGGFVLGAVFSSMLGQ--LAWWPWA--YWLMGIAC-FLLAVAGYYLIPHT 227
           G       V+G+ F +++G    A W W   +W + I   F LAVA  +L+P T
Sbjct: 211 GTQ-----VIGSAFGALIGAGITARWGWRAIFWFLAIGSGFSLAVAS-FLLPET 258

>TPHA0F01290 Chr6 complement(294550..296238) [1689 bp, 562 aa] {ON}
           Anc_2.241 YIL121W
          Length = 562

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 59/132 (44%), Gaps = 13/132 (9%)

Query: 101 AGRLGDIFGHKKFFVLGFFWYALWSL-LAGFSVYSNQIFFDCCRAFQGMGPAFLLPNAIA 159
            G L D+FG +   + G   Y + S+ LA  + Y   +F  C ++  G+ P   + +  A
Sbjct: 147 CGGLADLFGRRPVILTGMLIYTVASIGLACSNSYGVIVFLRCLQS-AGISPTISISSG-A 204

Query: 160 ILGRTYKPGRRKNMVFSLFGASAPGGFVLGAVFSSMLGQ-LAW---WPWAYWLMGIACFL 215
           +   T K  R        F  +  G  +LG  F S++G  LA    W   +W + I C +
Sbjct: 205 VGDFTVKSER------GTFVGAVSGLVLLGQAFGSLIGAALAASFNWRAIFWFLTIGCGV 258

Query: 216 LAVAGYYLIPHT 227
             +  ++++P T
Sbjct: 259 SMMVAFFVLPET 270

>Kwal_23.4824 s23 (883258..884919) [1662 bp, 553 aa] {ON} YNL065W
           (AQR1) - multidrug resistance transporter [contig 5]
           FULL
          Length = 553

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 53/237 (22%), Positives = 96/237 (40%), Gaps = 28/237 (11%)

Query: 4   SSPVTEENLDMNVETLKKDDEVLSDEFDVQEEKPESLLWESAFVGVLCSAQLMTQAGLGQ 63
           S   T E    + E+++  D +  D   + +  P +LL  +      C   L+T AG   
Sbjct: 44  SRVTTHEMKGSSSESIEGHD-IAHDNAPLPQHAPYTLLSNAQ---KWCMVALLTSAGFWS 99

Query: 64  SL-APLHIIGDSFGTANPGQLSWFASAYSLTVGTFIL-------IAGRLGDIFGHKKFFV 115
           SL +P++            Q S      ++TV  +++       I+G L D++G +   +
Sbjct: 100 SLGSPIYYPALK---QLEKQFSVSEELVNITVVVYLIFQGVAPTISGGLADVYGRRPVIL 156

Query: 116 LGFFWYALWSL-LAGFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMV 174
           +G   Y   S+ LA  + Y   +F  C ++  G+ P   + N+  +   T K  R     
Sbjct: 157 IGMLIYVCASIGLACSNSYGVIVFLRCLQS-AGISPIIAI-NSGVVGDFTVKQER----- 209

Query: 175 FSLFGASAPGGFVLGAVFSSMLGQLAW----WPWAYWLMGIACFLLAVAGYYLIPHT 227
              F  +  G  ++G  F S++G        W   +W + I C    +  + L+P T
Sbjct: 210 -GTFVGAVSGFTLMGQAFGSLIGAALTAAFDWRAIFWFLTIGCGTCMLVNFLLLPET 265

>Smik_11.368 Chr11 complement(649880..651622) [1743 bp, 580 aa] {ON}
           YKR105C (REAL)
          Length = 580

 Score = 36.6 bits (83), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 56/262 (21%), Positives = 98/262 (37%), Gaps = 53/262 (20%)

Query: 68  LHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLL 127
           + ++ + FG  N  +  W  + YSL      L+ GR   I G +   +L    +   SL+
Sbjct: 59  IDVVAEQFG--NYSKTGWLVTGYSLPNAILSLVWGRFASIIGFQHSLILAVLIFEAGSLV 116

Query: 128 AGFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSL----FGASAP 183
           A  +   N +                L     ++G T    R + +V S+    F  +A 
Sbjct: 117 AALANSMNMLI---VGRVVAGVGGSGLQTLCFVIGCTMVNERSRPLVISILSCAFAVAAI 173

Query: 184 GGFVLGAVFSSMLGQLAWWPWAYWL------MGIACFLLA------------------VA 219
            G ++G  F++ +     W W +++        +  FLL                   ++
Sbjct: 174 VGPIIGGAFTTHV----TWRWCFYINLPIGGFAVIMFLLTYKTKSENILQQTRNILGRIS 229

Query: 220 GYYLIPHTPMPNRDVASFKLLERIDFAGSVTGVVGLILF---------NFAWNQGPVVGW 270
            + L   T   N   A   +L + DF G      GL+LF          ++WN G ++  
Sbjct: 230 KFELRRLTEPGNLRKALIGILFKFDFLGFALSSAGLVLFLLGLTFGGNKYSWNSGQII-- 287

Query: 271 QTPYTYALL-IVGTVFLIIFAF 291
               TY +L I+  VF +I+ F
Sbjct: 288 ----TYLVLGILLFVFSLIYDF 305

>TDEL0A02490 Chr1 (446429..448093) [1665 bp, 554 aa] {ON} Anc_2.473
           YMR088C
          Length = 554

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 45/188 (23%), Positives = 81/188 (43%), Gaps = 12/188 (6%)

Query: 68  LHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLL 127
           ++ + + F  ++  Q  W A+++ LT   F  + G+L D+ G K   ++ +F+  +  LL
Sbjct: 59  MNRVAEEFSESDKKQ--WIATSFLLTNTAFQPLYGKLSDVTGRKFALLMAYFFLVIGCLL 116

Query: 128 AGFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFS-----LFGASA 182
              +   N   F   RA    G      NA + +  +     ++  ++      +FG   
Sbjct: 117 TCLA--RNVTEFAVARAI--CGIGGGGINACSSITVSDICTAKERGIYQGYANIVFGMGQ 172

Query: 183 PGGFVLGAVFSSMLGQLAWWPWAYWLMGIACFLLAVAGYYLIPHTPMPNRDVASFKLLER 242
             G  LG +F   +G  A +     ++ ++ FL        + H P P  +  + K L R
Sbjct: 173 MLGAPLGGLFIDTIGWRAIFGIQVPVVMVSAFLAYRNVNIKLSHVP-PISERFTRKNLSR 231

Query: 243 IDFAGSVT 250
           IDF GSVT
Sbjct: 232 IDFLGSVT 239

>CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088c
          Length = 564

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 61/264 (23%), Positives = 102/264 (38%), Gaps = 43/264 (16%)

Query: 10  ENLDMNVETLKKDDEVLSDEFDVQEEKPESL----------LWESAFVGVL---CSAQLM 56
           ENLD     L++  +    +   QE    +L          LW  +F+  L     A +M
Sbjct: 2   ENLDETTGLLEQTPDTTEQDALEQEYHEHNLSLPKLPIVLSLWLGSFLSSLDGTIVANIM 61

Query: 57  TQAGLGQSLAPLHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVL 116
            +            + + F  ++  Q  W A++Y LT   F  + G+L D+ G K   + 
Sbjct: 62  NR------------VAEEFQESDKKQ--WIATSYLLTNTAFQPLYGKLSDLTGRKFAVLT 107

Query: 117 GFFWYALWSLLAGFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFS 176
             F++ L  LL  F+    Q  F   RA  G+G   +  NA++ +  +    +R+  ++ 
Sbjct: 108 AHFFFGLGCLLTCFANSVTQ--FAIARAICGVGGGGI--NAMSSITVSDICTQRERGIYQ 163

Query: 177 -----LFGASAPGGFVLGAVFSSMLGQLAWWPWAYWLMG---IACFLLAVAGYYLIPHTP 228
                +FG     G  +G +F   LG    W   + L     + C  L      +     
Sbjct: 164 GYANIVFGLGQILGAPIGGLFIDTLG----WRILFGLQVPTILLCSSLVHKNVNIKLSHL 219

Query: 229 MPNRDVASFKLLERIDFAGSVTGV 252
           +P  +   +  L RID  GS T V
Sbjct: 220 LPVEERFKWSNLSRIDILGSSTLV 243

>CAGL0J09944g Chr10 (976274..978052) [1779 bp, 592 aa] {ON} similar
           to uniprot|P53943 Saccharomyces cerevisiae YNL065w
          Length = 592

 Score = 36.6 bits (83), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 58/240 (24%), Positives = 92/240 (38%), Gaps = 27/240 (11%)

Query: 2   TLSSPVTEE-NLDMNVETLKKDDEVLSDEFDVQEEK-PESLLWESAFVGVLCSAQLMTQA 59
           T+S   T E   D+  E      +   ++ ++Q    P SLL    +    C   L+T  
Sbjct: 52  TVSRTTTRELPEDLESEISSTHSQDAKEDLEIQHNAAPYSLL---NYRDKWCMVALLTAC 108

Query: 60  GLGQSLAP------LHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKF 113
           G   SL        L  +   F   +   ++     Y L  G     +G L D FG +  
Sbjct: 109 GFWSSLGSPIYYPALKQLEKQFDI-DENMVNITVVVYLLFQGLAPTCSGGLADKFGRRPV 167

Query: 114 FVLGFFWYALWSL-LAGFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKN 172
            ++G   Y + S+ LA    Y   +F  C ++  G+ P+  + + +  +G       R  
Sbjct: 168 LLIGMLIYVVASIGLACAPSYGVIVFLRCVQSI-GISPSIAISSGV--VGDFTVKSERGT 224

Query: 173 MVFSLFGASAPGGFVL-GAVFSSMLGQL--AWWPWA--YWLMGIACFLLAVAGYYLIPHT 227
            V       A  GFVL G  F S++G    A W W   +W + I C       + L+P T
Sbjct: 225 FV------GATSGFVLLGQAFGSLIGAALAAAWDWRAIFWFLTIGCGASFAICFALLPET 278

>SAKL0E02992g Chr5 complement(243652..245364) [1713 bp, 570 aa] {ON}
           similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 570

 Score = 36.2 bits (82), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 66/272 (24%), Positives = 106/272 (38%), Gaps = 49/272 (18%)

Query: 3   LSSPVTEENLDMNVE-TLKKDDEVLSDEFDVQEEKPESL-----LWESAFVGVL---CSA 53
           L   +  ++L +N+E    + +  L +E+         L     LW  +F+G L     A
Sbjct: 13  LPDTLDPQSLSLNLEDEFNRKNSSLEEEYHKHNLDLPKLPIVFSLWMGSFLGALDGTIVA 72

Query: 54  QLMTQAGLGQSLAPLHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKF 113
            +M +            + + F  ++  Q  W A+++ LT   F  + G+L DI G K  
Sbjct: 73  NIMNR------------VAEEFQESDKKQ--WIATSFLLTNTAFQPLYGKLSDITGRKFA 118

Query: 114 FVLGFFWYALWSLLAGFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRR--- 170
            ++   ++ L  LL  F+   N   F   RA  G+G   +   +   +        R   
Sbjct: 119 LLVAHTFFCLGCLLTCFA--RNVTEFSIARAICGIGGGGISAMSSITVSDICTARERGAY 176

Query: 171 ---KNMVFS---LFGASAPGGFVLGAVFSSMLGQLAWWPWAYWLMGIACFLLAVAGYY-- 222
               N+VFS   L GA   GGF L  +          W   + L      +  V GY   
Sbjct: 177 QGYANVVFSTGQLLGAPL-GGFALDRI---------GWRAIFGLQVPMLLICMVLGYRNV 226

Query: 223 --LIPHTPMPNRDVASFKLLERIDFAGSVTGV 252
              + H P P  +  ++K L RID  GS+T V
Sbjct: 227 NIKLAHVP-PLEERFTWKNLSRIDIGGSITLV 257

>NDAI0D04840 Chr4 complement(1145041..1146960) [1920 bp, 639 aa]
           {ON} Anc_4.30
          Length = 639

 Score = 35.8 bits (81), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 37/136 (27%), Positives = 59/136 (43%), Gaps = 13/136 (9%)

Query: 99  LIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNQIFFDCCRAFQGM---GPAFLLP 155
           +I   L +I+G +   V+  F + ++      +     I    CR F G+    P  ++P
Sbjct: 253 VIYAPLSEIYGRRGVLVISAFAFCIFQFAVATAENLQTIMI--CRFFSGVIGSAPMAVVP 310

Query: 156 NAIAILGRTYKPGRRKNMVFSLFGASAPGGFVLGAVFSSMLGQLAWWPWAYWLMGI---A 212
            A A +  T   G+   + FSLF    P   +L  VF S + Q   W W  +++GI    
Sbjct: 311 AAFADMFDTNLRGKAICL-FSLFVFVGP---ILSPVFGSYMAQRTTWRWLEYVVGIFAGV 366

Query: 213 CFLLAVAGYYLIPHTP 228
            F+L V  +Y   H P
Sbjct: 367 VFVLIVL-FYEETHHP 381

>TBLA0G02550 Chr7 complement(668523..670364) [1842 bp, 613 aa] {ON}
           Anc_2.242 YNL065W
          Length = 613

 Score = 35.8 bits (81), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 39/151 (25%), Positives = 67/151 (44%), Gaps = 16/151 (10%)

Query: 100 IAGRLGDIFGHKKFFVLGFFWYALWSL-LAGFSVYSNQIFFDCCRAFQGMGPAFLLPNAI 158
           ++G L DI+G +   + G   Y + S+ +A  + Y   IF  C ++  G+ P   + +  
Sbjct: 153 VSGGLADIYGRRPVILFGMLVYVVASIGIAACNSYGVIIFLRCLQS-TGISPLIAISSG- 210

Query: 159 AILGRTYKPGRRKNMVFSLFGASAPGGFVLGAVFSSMLGQ-LAW---WPWAYWLMGIAC- 213
           A+   T K  R        F  +  G  ++G  F S++G  LA    W   +W + I C 
Sbjct: 211 AVGDFTVKAER------GTFVGAVSGLVLMGQAFGSLIGAALAAAYNWRAIFWFLAIGCG 264

Query: 214 FLLAVAGYYL--IPHTPMPNRDVASFKLLER 242
             +A+AG  L     T + N  V   +++ R
Sbjct: 265 ACMAIAGIVLPETKRTLVGNLSVTPKRIINR 295

>KAFR0J00930 Chr10 (168674..170374) [1701 bp, 566 aa] {ON} Anc_2.242
           YNL065W
          Length = 566

 Score = 35.8 bits (81), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 63/142 (44%), Gaps = 11/142 (7%)

Query: 90  YSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSL-LAGFSVYSNQIFFDCCRAFQGM 148
           Y L  G    I+G L D++G +   + G   + + S+ +A    Y   +F  C ++  G+
Sbjct: 135 YLLFQGVAPAISGGLADVYGRRPVILGGMLIFVVASIGIAKAPSYGVIVFLRCIQSI-GI 193

Query: 149 GPAFLLPNAIAILGRTYKPGRRKNMVFSLFGASAPG---GFVLGAVFSSMLGQLAWWPWA 205
            P   + + + +   T K   R   V +  G    G   G +LGAV ++ L     W   
Sbjct: 194 SPTIAISSGV-VSDFTVK-RERGTFVGATSGLVLIGQGIGPLLGAVITAAL----HWRAV 247

Query: 206 YWLMGIACFLLAVAGYYLIPHT 227
           +W + I C    + G++L+P T
Sbjct: 248 FWFLTIGCGSCMIIGFFLLPET 269

>KLTH0G09372g Chr7 (780184..781839) [1656 bp, 551 aa] {ON} similar
           to uniprot|P53943 Saccharomyces cerevisiae YNL065W AQR1
           Plasma membrane transporter of the major facilitator
           superfamily that confers resistance to short- chain
           monocarboxylic acids and quinidine
          Length = 551

 Score = 35.4 bits (80), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 34/151 (22%), Positives = 62/151 (41%), Gaps = 16/151 (10%)

Query: 100 IAGRLGDIFGHKKFFVLGFFWYALWSL-LAGFSVYSNQIFFDCCRAFQGMGPAFLLPNAI 158
           I+G L D++G +   ++G   Y   S+ LA    Y   +F  C ++  G+ P   + N+ 
Sbjct: 141 ISGGLADVYGRRPVILMGMLIYVCASIGLACSQSYGVIVFLRCLQS-AGISPIIAI-NSG 198

Query: 159 AILGRTYKPGRRKNMVFSLFGASAPGGFVLGAVFSSMLGQLAW----WPWAYWLMGIACF 214
            +   T K  R        F  +  G  ++G  F S++G        W   +W + I C 
Sbjct: 199 VVGDFTLKHER------GTFVGAVSGFTLMGQAFGSLIGAALTAAFDWRAIFWFLTIGCG 252

Query: 215 LLAVAGYYLIPHTPMP---NRDVASFKLLER 242
              +  + ++P T      N  +   +L+ R
Sbjct: 253 TCMIINFLILPETKRTLVGNLSIRPKRLINR 283

>Kwal_33.13713 s33 (361891..363393) [1503 bp, 500 aa] {ON} YCR028C
           (FEN2) - Amino acid permease [contig 114] FULL
          Length = 500

 Score = 35.0 bits (79), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 35/114 (30%), Positives = 50/114 (43%), Gaps = 11/114 (9%)

Query: 124 WSLLAGFSVYSNQIFFDCC--RAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSLFGAS 181
           W LL  FS+Y    F  CC  R FQ +  +        ILG  YK  R   +  ++F +S
Sbjct: 131 WGLLT-FSMYKVTSFQQCCAIRFFQAVFESCTFSGTHLILGSWYKE-RELTIRTAIFTSS 188

Query: 182 AP-----GGFVLGAVFSSMLGQ--LAWWPWAYWLMGIACFLLAVAGYYLIPHTP 228
                   GF+  A+  S+ G   LA W W + +  +    +AV G+   P TP
Sbjct: 189 GLVGSIFSGFMQVAIHKSLDGHRGLAGWRWLFIVDFLITLPVAVYGFIFFPTTP 242

>ZYRO0G21890g Chr7 complement(1801391..1803121) [1731 bp, 576 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 576

 Score = 35.0 bits (79), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 54/225 (24%), Positives = 96/225 (42%), Gaps = 30/225 (13%)

Query: 83  LSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNQIFFDCC 142
           ++W A+AY LT      + G++ DI G +K  + G   +AL  LL  F+   N I     
Sbjct: 97  VTWVATAYLLTTTAVQPLYGKISDIIGRRKCLLFGEVIFALGVLLCNFA---NTI----- 148

Query: 143 RAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSLFGASAPG-----GFVLGAVFSSMLG 197
                  P   +  AI  +G +        M+  +   S        G +L ++F S+ G
Sbjct: 149 -------PQLAIARAICGIGGSGNSAMGNIMLNDILPLSVRATYWSYGAILASIFQSLGG 201

Query: 198 QLAWWPWAYWLMG---IACFLLAVAGYYLIPHTPMPNRDVASFKLLERIDFAGSVTGVVG 254
            +      ++ +G          +   YL  +  + +    +    +RIDF GS+  +VG
Sbjct: 202 PIGGLLLKWFGVGGLFTPQIPFCIGSIYL-SYKYIHDYKEHARSSWKRIDFGGSICLLVG 260

Query: 255 LILFNFAWNQGPVV-----GWQTPYTYALLIVGTVFLIIFAFIES 294
           +  F F ++          GW TP  ++++++  V +I FAFIE+
Sbjct: 261 ISSFIFFFSASDNTTIEDDGWSTPKKWSVVLL-IVSIIAFAFIEN 304

>KLLA0D19941g Chr4 complement(1698889..1700724) [1836 bp, 611 aa]
           {ON} similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 611

 Score = 35.0 bits (79), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 30/129 (23%), Positives = 57/129 (44%), Gaps = 13/129 (10%)

Query: 85  WFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNQIFFDCCRA 144
           W  + YSL    F LI GR   + G +    L  F + + S+++  +   + +     R 
Sbjct: 97  WLIAGYSLPNSLFSLIWGRTASLLGFQASMTLSIFIFEVGSIVSASATSMDNLIVG--RV 154

Query: 145 FQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSLF-----GASAPGGFVLGAVFSSMLGQL 199
             G+G + L   ++ ++G +    + + M+ S+       AS  G FV GA  + ++   
Sbjct: 155 IAGVGGSGLQTLSL-VIGSSIVEEKNRAMIVSIVMSAFAAASLIGPFVGGAFTTHVI--- 210

Query: 200 AWWPWAYWL 208
             W W +W+
Sbjct: 211 --WRWCFWI 217

>SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {ON}
           similar to uniprot|P33335 Saccharomyces cerevisiae
           YPR198W SGE1 Member of drug-resistance protein family
           multicopy suppressor of gal11 null mutation
          Length = 569

 Score = 35.0 bits (79), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 34/141 (24%), Positives = 55/141 (39%), Gaps = 5/141 (3%)

Query: 68  LHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLL 127
           L+ I D F   +  ++ W  + YSL+   F L+ GR   IFG K   ++    + + SL+
Sbjct: 44  LNTIADKFNAYS--KIGWLITGYSLSNALFTLLWGRFAVIFGSKTTLMVSIIIFEIGSLV 101

Query: 128 AGFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSLFGASAPGGFV 187
              S   + I     R   G G + +     AI         R  +V +L   S      
Sbjct: 102 IAVSNSMDMIIGG--RVIAGCGASGIQTLVFAIATSLVDEHTRGTIV-TLLSLSYAVASA 158

Query: 188 LGAVFSSMLGQLAWWPWAYWL 208
           LG      L +   W W +++
Sbjct: 159 LGPYIGGALTEYVTWRWCFYI 179

>KLLA0F03311g Chr6 (311639..313267) [1629 bp, 542 aa] {ON} similar
           to uniprot|P53943 Saccharomyces cerevisiae YNL065W AQR1
           Plasma membrane transporter of the major facilitator
           superfamily that confers resistance to short- chain
           monocarboxylic acids and quinidine
          Length = 542

 Score = 34.7 bits (78), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 56/220 (25%), Positives = 89/220 (40%), Gaps = 32/220 (14%)

Query: 17  ETLKKD-DEVLSDEFDVQEE-----KPESLLWESAFVGVLCSAQ------LMTQAGLGQS 64
             L+ D D+V++ E   +E      K E L  E     +L   Q      L+T AG   S
Sbjct: 37  RELRDDTDDVVTHEIYDEESFPDGSKQEQLSEEDVPYTLLTYRQKWFMVALLTSAGFWSS 96

Query: 65  L-APLHIIG----DSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFF 119
           L +P++       ++    N   ++     Y L  G    I+G L D++G +   +LG  
Sbjct: 97  LGSPIYYPALKELEAEFDVNEELINITVVVYLLFQGIAPTISGGLADVYGRRPIILLGML 156

Query: 120 WYALWSL-LAGFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSLF 178
            Y + S+ LA    Y   +F  C ++  G+ P   + + +A  G       R   V    
Sbjct: 157 IYVIASIGLACSKSYGAVVFLRCLQS-AGISPIIAINSGVA--GDFTVKSERGTFV---- 209

Query: 179 GASAPGGFVL-GAVFSSMLGQ--LAWWPWA--YWLMGIAC 213
              A  GF L G  F S++G    A + W   +W + I C
Sbjct: 210 --GAVSGFTLMGQAFGSLIGAALTAAYDWRAIFWFLVIGC 247

>SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 598

 Score = 34.7 bits (78), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 35/170 (20%), Positives = 65/170 (38%), Gaps = 15/170 (8%)

Query: 85  WFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNQIFFDCCRA 144
           W  + YSL      L+ GR   I G K   +L    + + SL++  +   N +     R 
Sbjct: 82  WLVTGYSLPTALLSLVWGRAASIIGFKSSMLLSIIIFEVGSLVSALANSMNMLIGG--RV 139

Query: 145 FQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSLFGASAPGGFVLGAVFSSMLGQLAWWPW 204
             G+G + L      I+  T    R + M  S+   S     ++G            W W
Sbjct: 140 ISGVGGSGLQTLCFLII-STLVNERSRGMAISVLSCSFAVASIVGPFLGGAFTTHVTWRW 198

Query: 205 AYWL---MGIACFLLAVAGYYLIPHTPMPNRDVASF----KLLERIDFAG 247
            +++   +G   FL+     +++ + P     + +F    + +  +DF G
Sbjct: 199 CFYINLPIGGLAFLV-----FVLSYNPNGGNSIKNFTKAVRSISHVDFGG 243

>Kwal_26.6686 s26 complement(23884..25593) [1710 bp, 569 aa] {ON}
           YIL171W (HXT12) - hexose permease [contig 381] FULL
          Length = 569

 Score = 34.3 bits (77), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 42/88 (47%), Gaps = 4/88 (4%)

Query: 377 MFFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQG 436
           +   +  + VGTI+  +A   Q  W Q F+  I+  WG+      A +++S++ P   +G
Sbjct: 148 LMIVIVLYVVGTIIQISA---QDKWYQYFIGKIIYGWGVGGVSVLAPMLISETAPKHLRG 204

Query: 437 LAASLVNTVVNYSISIG-LGIAGTIESN 463
              S    +V + I +G   + GT + N
Sbjct: 205 TLISCYQLMVTFGIFLGYCAVYGTRKYN 232

>Suva_12.245 Chr12 (391999..393774) [1776 bp, 591 aa] {ON} YAL067C
           (REAL)
          Length = 591

 Score = 34.3 bits (77), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 54/116 (46%), Gaps = 15/116 (12%)

Query: 124 WSLLAGFSVYSNQI-FFDCCRAFQGMGPAFLLPNAIA---ILGRTYKPGR--RKNMVFSL 177
           WSLL   + Y N +      R F G   AF  P+ +A   + G  YK     R++  + L
Sbjct: 212 WSLLTVGAAYVNSVPHLKAIRFFIG---AFEAPSYLAYQYLFGSFYKHDEMVRRSAFYYL 268

Query: 178 ---FGASAPGGFVLGAVFSSMLGQ--LAWWPWAYWLMGIACFLLAVAGYYLIPHTP 228
               G  + GG +  AVFSS+ G   LA W W + +  I    + + G+Y++P  P
Sbjct: 269 GQYLGILSAGG-IQSAVFSSLNGVNGLAGWRWNFIIDAIVSVAVGIIGFYVLPGDP 323

>ABL040W Chr2 (321534..323237) [1704 bp, 567 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR088C
          Length = 567

 Score = 34.3 bits (77), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 54/205 (26%), Positives = 87/205 (42%), Gaps = 16/205 (7%)

Query: 68  LHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLL 127
           ++ I + F  ++  Q  W A+++ LT   F  + GR  DI G K   ++   ++ L +LL
Sbjct: 68  MNKIAEEFHESDKKQ--WMATSFLLTNAAFQPLYGRCSDIVGRKCALLIAQSFFLLGTLL 125

Query: 128 AGFSVYSNQIFFDCCRAFQGMGPAFLLPN---AIAILGRTYKPGRRKNMVFSLFGASAPG 184
             F+   N   F   RA  GMG   +       ++ +  T + G  +     +FGA    
Sbjct: 126 TCFA--RNVTEFAIARAICGMGGGGIGAMSSITVSDICTTKERGMYQGYANVIFGA---- 179

Query: 185 GFVLGAVFSSMLGQLAWWPWAYWLMGIA---CFLLAVAGYYL-IPHTPMPNRDVASFKLL 240
           G VLGA    ++ +   W   +    +A   C +LA     L + H P P     + K L
Sbjct: 180 GQVLGAPVGGLIMETFNWRIIFAAQVVAIMICMILAYRNINLKLLHIP-PFHQRFTRKNL 238

Query: 241 ERIDFAGSVTGVVGLILFNFAWNQG 265
            RID  GS      L+ F   ++ G
Sbjct: 239 SRIDLFGSSMLSCSLVSFLMLFSSG 263

>NDAI0D01020 Chr4 complement(229357..231135) [1779 bp, 592 aa] {ON} 
          Length = 592

 Score = 34.3 bits (77), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 60/143 (41%), Gaps = 13/143 (9%)

Query: 90  YSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSL-LAGFSVYSNQIFFDCCRAFQGM 148
           Y L  G    ++G L D+FG +   + G   Y + S+ LA    Y    F  C ++  G+
Sbjct: 146 YLLFQGIAPTVSGGLADVFGRRPIILGGMVIYVVASIGLACAPSYGVICFLRCIQSI-GI 204

Query: 149 GPAFLLPNAIAILGRTYKPGRRKNMVFSLFGASAPGGFVLGAVFSSMLGQL--AWWPWA- 205
            P   + + + +   T K  R        F  +  G  +LG  F S++G +  A W W  
Sbjct: 205 SPTIAISSGV-VGDFTLKHER------GTFVGATSGLVLLGQCFGSLIGAVLTARWDWRA 257

Query: 206 -YWLMGIACFLLAVAGYYLIPHT 227
            +W + I   +  +   + +P T
Sbjct: 258 IFWFLAIGSGVALIVAAFTLPET 280

>NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {ON} 
          Length = 630

 Score = 33.9 bits (76), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 26/127 (20%), Positives = 52/127 (40%), Gaps = 3/127 (2%)

Query: 82  QLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNQIFFDC 141
           +  W  + YSL      L+ GR+  I G K   +     + + SL++G +   N +    
Sbjct: 114 KTGWIFAGYSLPNALLALLWGRIASIIGFKSCMLAAIIIFEIGSLISGVANSMNMLIGG- 172

Query: 142 CRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSLFGASAPGGFVLGAVFSSMLGQLAW 201
            R   G+G + +   A  ++G      RR+ ++ +   ++     V+G          A 
Sbjct: 173 -RVIAGVGGSGIQSLAF-VIGSNLVDERRRGLIIACMSSAFAVASVIGPFLGGAFTTHAT 230

Query: 202 WPWAYWL 208
           W W +++
Sbjct: 231 WRWCFYI 237

>Kpol_1039.19 s1039 (63222..64943) [1722 bp, 573 aa] {ON}
           (63222..64943) [1722 nt, 574 aa]
          Length = 573

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 56/143 (39%), Gaps = 13/143 (9%)

Query: 90  YSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSL-LAGFSVYSNQIFFDCCRAFQGM 148
           Y L  G    + G L DI+G +   + G   Y + S+ LA  + Y   IF  C    Q  
Sbjct: 147 YLLFQGISPTVCGGLADIYGRRPVILFGMLVYIVASIALACANSYGVIIFLRC---LQSC 203

Query: 149 GPAFLLPNAIAILGRTYKPGRRKNMVFSLFGASAPGGFVLGAVFSSMLGQL--AWWPWA- 205
           G + ++  +   +G       R   V      +  G  +LG  F S++G    A W W  
Sbjct: 204 GISPIIAISSGCVGDFTMKAERGTFV-----GAVSGLVLLGQAFGSLIGAALAAAWDWRA 258

Query: 206 -YWLMGIACFLLAVAGYYLIPHT 227
            +W + I        G  ++P T
Sbjct: 259 IFWFLAIGAGCCLFVGILVLPET 281

>Ecym_4298 Chr4 complement(636605..638641) [2037 bp, 678 aa] {ON}
           similar to Ashbya gossypii AGR076C
          Length = 678

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 25/47 (53%)

Query: 83  LSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAG 129
           +SW A++Y L+   F  + G+L DIFG K   +     + L  L+ G
Sbjct: 189 ISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCG 235

>KLLA0F10043g Chr6 complement(928691..930277) [1587 bp, 528 aa] {ON}
           uniprot|Q701Q9 Kluyveromyces lactis KLLA0F10043g jen2
           Carboxylic acid permease
          Length = 528

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 47/100 (47%), Gaps = 7/100 (7%)

Query: 99  LIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNQIFFDCCRAFQG--MGPAFLLPN 156
           LI G LGD +G K  FVL      +  +  GF V S   F   CRA  G  MG  F + +
Sbjct: 132 LIFGYLGDRYGRKYSFVLTMALIIVIQIGTGF-VNSFSAFLG-CRAIFGIIMGSVFGVAS 189

Query: 157 AIAILGRTYKPGRRKNMVFSLFGASAPGGFVLGAVFSSML 196
           A A+      P + K+++  +F      G++LG VF   +
Sbjct: 190 ATAL---ENAPNKAKSILSGIFQEGYAFGYLLGVVFQRAI 226

>TPHA0A01750 Chr1 complement(354061..355971) [1911 bp, 636 aa] {ON}
           Anc_8.272 YDR119W
          Length = 636

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 21/30 (70%)

Query: 82  QLSWFASAYSLTVGTFILIAGRLGDIFGHK 111
           ++SW A+AY L+  TF  + G++ DIFG K
Sbjct: 131 RISWIATAYLLSSATFQPLYGKISDIFGRK 160

>ZYRO0G03234g Chr7 (247798..249486) [1689 bp, 562 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 562

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 66/281 (23%), Positives = 110/281 (39%), Gaps = 36/281 (12%)

Query: 21  KDDEVLSDEFDVQEEKPESL-----LWESAFVGVL---CSAQLMTQAGLGQSLAPLHIIG 72
           +D+E L  E+         L     LW  +F+G L     A +M +            + 
Sbjct: 14  RDEESLEAEYHRYNLSLPKLPILTSLWLGSFIGSLDGTIVANIMNR------------VA 61

Query: 73  DSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSV 132
           + F  ++  Q  W A+++ LT   F  + G+L DI G +   +   F++ L  LL  F+ 
Sbjct: 62  EEFEESDKKQ--WIATSFLLTNTAFQPLYGKLSDITGRRFALLTAHFFFGLGCLLTCFAQ 119

Query: 133 YSNQIFFDCCRAFQGMGPAFLLPN---AIAILGRTYKPGRRKNMVFSLFGASAPGGFVLG 189
              Q  F   RA  G+G   +      A++ +    + G  +     +FG     G  +G
Sbjct: 120 SVEQ--FALARAICGIGGGGINACSSIAVSDICTAKERGSYQGYANIVFGTGQMLGGPIG 177

Query: 190 AVFSSMLGQLAWWPWAYWLMGIACFLLAVAGYYLIPHTPMPNRDVASFKLLERIDFAGSV 249
            +    +G  A +     ++    FL        + H P P  +  ++  L RID  GS 
Sbjct: 178 GLLIDTIGWRAIFAVQVPIIMFCSFLTYKNITIKLSHIP-PVSERFTWMNLSRIDIMGSS 236

Query: 250 TGVVGL--ILFNFAWNQGPVVGWQTPYTYALLIVGTVFLII 288
           + VV +  ILF  + N      W         IVG +F I+
Sbjct: 237 SLVVVICGILFICSTN------WNKVILSTFTIVGFLFFIV 271

>SAKL0F07700g Chr6 complement(588619..590118) [1500 bp, 499 aa] {ON}
           similar to uniprot|Q08777 Saccharomyces cerevisiae
           YOR306C MCH5 or uniprot|Q08268 Saccharomyces cerevisiae
           YOL119C MCH4
          Length = 499

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 57/126 (45%), Gaps = 15/126 (11%)

Query: 6   PVTEENLDMN-VETLKKDDEVLSDEFDVQE---EKPESLLWES------AFVGVLCSAQL 55
           P+T EN + N ++T  +  + +  +FDV     E PE   WE+      +F+G+  +  L
Sbjct: 27  PLTPENSNTNQIQTTFEFQDTIDVDFDVDSNGFEYPEGG-WEAWLVVFGSFLGIFPTWGL 85

Query: 56  MTQAGLGQSLAPLHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFV 115
              AG+ Q+    +I        +   +SW  S Y+  V +  + +G   D  G +K  V
Sbjct: 86  YFSAGIIQT----YIASHQLSAVSTSTVSWIFSIYNFFVLSSSVFSGLYFDKNGARKPLV 141

Query: 116 LGFFWY 121
           LG   Y
Sbjct: 142 LGTLMY 147

>KLLA0F13684g Chr6 complement(1267367..1269082) [1716 bp, 571 aa]
           {ON} similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 571

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 49/220 (22%), Positives = 88/220 (40%), Gaps = 31/220 (14%)

Query: 41  LWESAFVGVLCS---AQLMTQAGLGQSLAPLHIIGDSFGTANPGQLSWFASAYSLTVGTF 97
           LW  +F+G L S   A +M +            + + F  ++  Q  W  +++ LT   F
Sbjct: 46  LWMGSFLGSLDSTIVANIMNK------------VAEEFEESDKKQ--WIVTSFLLTNTAF 91

Query: 98  ILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNQIFFDCCRAFQGMGPAFLLPNA 157
             + G+L D+ G K   ++   ++ +  L    S   N + F   RA  GMG   +   +
Sbjct: 92  QPLYGKLSDLAGRKTALMVAHSFFLVGCLFTALS--RNLVEFSIARAVCGMGAGGISALS 149

Query: 158 IAILGRTYKPGRR------KNMVFSLFGASAPGGFVLGAVFSSMLGQLAWWPWAYWLMGI 211
              +     P  R       N+VF     S  GG + G +  S   ++ +      +M  
Sbjct: 150 SISVSDICTPKERGVYQGYANVVFG--TGSMLGGPIGGWLMDSFGWKVIFAGQVPLIM-- 205

Query: 212 ACFLLAVAGYYL-IPHTPMPNRDVASFKLLERIDFAGSVT 250
            C  L      + + H P P  +   ++ ++RID  GS++
Sbjct: 206 TCMFLGYRNVNIKLLHVP-PRHERYRWENIKRIDLGGSIS 244

>Kpol_478.3 s478 (12238..13980) [1743 bp, 580 aa] {ON}
           (12238..13980) [1743 nt, 581 aa]
          Length = 580

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 34/147 (23%), Positives = 60/147 (40%), Gaps = 9/147 (6%)

Query: 99  LIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNQIFFDCCRAFQGM---GPAFLLP 155
           +I   L +++G K   +L  F ++++      S     I    CR F G+    P  ++P
Sbjct: 194 IIYAPLSELYGRKGVIILSAFGFSVFQFAVAVSKDFQSIMI--CRFFGGLIGAAPMAVVP 251

Query: 156 NAIAILGRTYKPGRRKNMVFSLFGASAPGGFVLGAVFSSMLGQLAWWPWAYWLMGIACFL 215
              A +  T   G+      +LF      G +LG V  S + Q   W W  +++G     
Sbjct: 252 ACFADMFDTNMRGK----AIALFSLGVFVGPILGPVMGSYIVQHTTWRWLEYVIGCFSAA 307

Query: 216 LAVAGYYLIPHTPMPNRDVASFKLLER 242
           + VA  + +  T  P+  V   K + +
Sbjct: 308 IFVALLFFMEETHHPSILVNKAKQMRK 334

>SAKL0D04510g Chr4 complement(360010..361605) [1596 bp, 531 aa] {ON}
           similar to uniprot|P36035 Saccharomyces cerevisiae
           YKL217W JEN1 Lactate transporter, required for uptake of
           lactate and pyruvate; expression is derepressed by
           transcriptional activator Cat8p under nonfermentative
           growth conditions, and repressed in the presence of
           glucose, fructose, and mannose
          Length = 531

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 34/147 (23%), Positives = 60/147 (40%), Gaps = 7/147 (4%)

Query: 102 GRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAIL 161
           G +GD +G K  F++  F+  +  ++ GF +  N  +F   RAF G+    +  N+ A  
Sbjct: 131 GYIGDRYGRKVSFIINLFFMMVLEIITGF-IKHNFKYFLIARAFFGVVLGGIFGNSAAQC 189

Query: 162 GRTYKPGRRKNMVFSLFGASAPGGFVLGAVFSSMLGQLA--WWPWAYWLMGIACFLLAVA 219
                P    + +   F      G++L  +F+  L       W   +W      FLL + 
Sbjct: 190 FDDCPP-EAHSFISGFFQQGYTLGYLLAVIFTRALADTTKDRWRSCFWFAAGITFLLIIF 248

Query: 220 GYYLIPHTP--MPNRDVASFKLLERID 244
              L+P T   +  + + + K L   D
Sbjct: 249 R-ALLPETNAFLERQRIKAEKKLNNED 274

>Kwal_14.722 s14 (9019..10854) [1836 bp, 611 aa] {ON} YCL073C -
           Hypothetical ORF [contig 245] FULL
          Length = 611

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 29/59 (49%), Gaps = 2/59 (3%)

Query: 239 LLERIDFAGSV--TGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTVFLIIFAFIESR 295
           +  +ID  G+V  T  +GLIL       G    W  P   A L++G   L++F F E++
Sbjct: 273 IFNQIDIVGTVLVTAALGLILVPLTLAGGVSERWHEPGIIATLVIGIALLLVFLFWEAK 331

>TPHA0C04830 Chr3 (1043390..1045186) [1797 bp, 598 aa] {ON}
           Anc_8.858 YML123C
          Length = 598

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 55/209 (26%), Positives = 80/209 (38%), Gaps = 47/209 (22%)

Query: 90  YSLTVGTFILI-AGRLG---------DIFGHKKFFVLGFFWYALWSLLAGFSVYS---NQ 136
           Y+  VG  ILI AG L          DI G K     GFF   +   + GF+ +    N 
Sbjct: 396 YNSAVGNLILICAGSLPGYWASVFTIDIIGRKPIQTFGFFILTVLFCVIGFAYHRLTPNS 455

Query: 137 I--FFDCCRAFQGMGP---AFLLPNAIAILGRTYKPGRRKNMVFSLFGASAPGGFVLGAV 191
           +   +  C+ FQ  GP    F++P  I        P R ++   +  G SA  G V   +
Sbjct: 456 LLGLYIVCQFFQNFGPNTTTFIIPGEIF-------PTRYRS---TAHGISAASGKVGAII 505

Query: 192 FSSMLGQL-------AWWPWAYWLMGI----ACFLLAVAGY-YLIPHTPMPNRDVASFKL 239
             ++LG L          P   WL  +    A F+L   G  +LIP T     +  S K 
Sbjct: 506 AQTVLGTLINHNCARDGKPTNCWLPHVMEIFALFMLCGLGLSFLIPETKRMTLEEISEKY 565

Query: 240 LERIDFAGSVTGVVGLILFNFAWNQGPVV 268
              +D       +  L   N  +N+  V+
Sbjct: 566 HGEVD-------LTKLAERNLNYNKNSVI 587

>Skud_18.3 Chr18 complement(10782..12554) [1773 bp, 590 aa] {ON}
           YCL069W (REAL)
          Length = 590

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 40/207 (19%), Positives = 79/207 (38%), Gaps = 22/207 (10%)

Query: 68  LHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLL 127
           + ++   FG  N  +  W  + YSL      L+ GR   I G +   +L    +   SL+
Sbjct: 69  IDVVAKQFG--NYSKTGWLVTGYSLPNAVLSLLWGRFASIIGFQHSLILAVLIFEAGSLV 126

Query: 128 AGFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSL----FGASAP 183
           A  +   N +                L     ++G T    R + +V S+    F  +A 
Sbjct: 127 AALANSMNMLI---VGRVVAGVGGSGLQTLCFVIGCTMVDERSRPLVISILSCAFAVAAI 183

Query: 184 GGFVLGAVFSSMLGQLAWWPWAYWL------MGIACFLLAVAGYY--LIPHTPMPNRDVA 235
            G ++G  F++ +     W W +++      + +  FLL        +I       R ++
Sbjct: 184 VGPIIGGAFTTHV----TWRWCFYINLPIGGLAVIMFLLTYDAKNDGIIQQMKGALRKIS 239

Query: 236 SFKLLERIDFAGSVTGVVGLILFNFAW 262
            F+   R+   G++   +  ++F F +
Sbjct: 240 GFE-FSRLKKPGNLRKAINCLIFKFDF 265

>TBLA0A08510 Chr1 (2095273..2097174) [1902 bp, 633 aa] {ON} 
          Length = 633

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 38/149 (25%), Positives = 60/149 (40%), Gaps = 13/149 (8%)

Query: 99  LIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNQIF--FDCCR---AFQGMGPAFL 153
           +I   L +++G K   V+    +AL+     F+V + + F     CR    F G  P  +
Sbjct: 247 IIYAPLSELYGRKGVLVVSGLGFALFQ----FAVATAENFQTIMICRFFAGFIGAAPMAI 302

Query: 154 LPNAIAILGRTYKPGRRKNMVFSLFGASAPGGFVLGAVFSSMLGQLAWWPWAYWLMGIAC 213
           +P   A +  T   G+       LF      G +LG V  S + Q   W W  +++G   
Sbjct: 303 VPAVFADMFDTDFRGK----AICLFTLGVFVGPILGPVMGSYIVQHTTWRWLNYVVGFQA 358

Query: 214 FLLAVAGYYLIPHTPMPNRDVASFKLLER 242
             + VA    +  T  P   V   KLL +
Sbjct: 359 CAVFVAIVLFVEETHHPTILVNKAKLLRK 387

>Kwal_55.19582 s55 (35002..36705) [1704 bp, 567 aa] {ON} YNR072W
           (HXT17) - Putative hexose transporter [contig 159] FULL
          Length = 567

 Score = 32.3 bits (72), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 37/77 (48%), Gaps = 3/77 (3%)

Query: 377 MFFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQG 436
           + F +  + VGTI+  +A      W Q F+  I+  WG+      A +++S++ P   +G
Sbjct: 145 LMFVVGVYVVGTIIQISA---SDKWYQYFIGKIIYGWGVGGVSVLAPMLISETAPKHLRG 201

Query: 437 LAASLVNTVVNYSISIG 453
              S    +V + I +G
Sbjct: 202 TLISCYQLMVTFGIFLG 218

>Kpol_467.24 s467 (55523..56632) [1110 bp, 370 aa] {ON}
           (55523..56632) [1110 nt, 370 aa]
          Length = 370

 Score = 32.0 bits (71), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 53/203 (26%), Positives = 81/203 (39%), Gaps = 26/203 (12%)

Query: 68  LHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLL 127
           ++ + + F  +   Q  W A+++ LT   F  + G+L DI G K   +    ++ L   L
Sbjct: 58  MNKVAEEFQESQEKQ--WIATSFLLTNTAFQPLYGKLSDITGRKFALLTALSFFGLGCFL 115

Query: 128 AGFSVYSNQIFFDCCRAFQGMGPAFLLPNAIA--ILGRTYKPGRR------KNMVFSLFG 179
              S    Q  F   RA    G      NAI+   +G       R       N+V   FG
Sbjct: 116 TSLSTNIKQ--FAIARAI--CGIGGGGINAISSITVGDICTAKDRGIYQGYANIV---FG 168

Query: 180 ASAPGGFVLGAVFSSMLGQLAWWPWAYW----LMGIACFLLAVAGYYLIPHTPMPNRDVA 235
                G  +G +F + +G    W   +W    L+ IA  L  +     + H P P+    
Sbjct: 169 MGQLLGAPVGGLFIATIG----WRALFWIQVPLVIIAIILGEMYVNIKLVHVPPPSERF- 223

Query: 236 SFKLLERIDFAGSVTGVVGLILF 258
            +K + RIDF GS T V  +  F
Sbjct: 224 KWKNISRIDFLGSFTLVSSITCF 246

>TBLA0A08520 Chr1 (2101458..2103356) [1899 bp, 632 aa] {ON} 
          Length = 632

 Score = 32.3 bits (72), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 46/110 (41%), Gaps = 9/110 (8%)

Query: 104 LGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNQIFFDCCRAFQGM---GPAFLLPNAIAI 160
           L +I+G K   V+  F +AL+      +     I    CR F G+    P  ++P   A 
Sbjct: 251 LSEIYGRKLILVISGFGFALFQFAVATAENLQTIMI--CRFFSGLIGGAPMAVVPAVFAD 308

Query: 161 LGRTYKPGRRKNMVFSLFGASAPGGFVLGAVFSSMLGQLAWWPWAYWLMG 210
           +  T   G+       LF A    G +LG +  S + Q   W W  +++G
Sbjct: 309 MFDTNFRGK----AICLFSAFVFIGPILGPIMGSYIVQHTSWRWLNYVVG 354

>Kwal_33.15020 s33 (919334..921127) [1794 bp, 597 aa] {ON} YGR138C
           (TPO2) -  [contig 96] FULL
          Length = 597

 Score = 32.0 bits (71), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 26/60 (43%)

Query: 168 GRRKNMVFSLFGASAPGGFVLGAVFSSMLGQLAWWPWAYWLMGIACFLLAVAGYYLIPHT 227
            + + +  SLF A+   G V+G +  S+L     W W YW M I    L       +P T
Sbjct: 241 NKERGVAMSLFSAAPFLGPVMGPIVGSLLSVYCSWRWVYWFMVILSGCLYAVMAVFMPET 300

>KNAG0G03530 Chr7 (750723..752477) [1755 bp, 584 aa] {ON} Anc_8.858
           YML123C
          Length = 584

 Score = 32.0 bits (71), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 46/195 (23%), Positives = 72/195 (36%), Gaps = 42/195 (21%)

Query: 81  GQLSWFASAYSLTVGTFILI-AGRLG---------DIFGHKKFFVLGFFWYALWSLLAGF 130
           G  + +   Y+  VG  ILI AG L          DI G K   + GFF   +   + GF
Sbjct: 375 GSKNVYHKLYNSAVGNLILICAGSLPGYWASVFTIDIIGRKPIQLFGFFILTVLFCVIGF 434

Query: 131 SVYSNQI-----FFDCCRAFQGMGP---AFLLPNAIAILGRTYKPGRRKNMVFSLFGASA 182
           + +          +  C+ FQ  GP    F++P  +        P R ++   +  G SA
Sbjct: 435 AYHRITDHGLLGLYIVCQFFQNFGPNVTTFIIPGEVF-------PTRYRS---TAHGISA 484

Query: 183 PGGFVLGAVFSSMLGQL-------------AWWPWAYWLMGIACFLLAVAGYYLIPHTPM 229
             G +   +  + LG L              W P    +  +   LL +   +LIP T  
Sbjct: 485 ACGKIGAIIAQTALGTLINHHCARDGKKENCWLPHVMEIFALF-MLLGLCLTFLIPETKR 543

Query: 230 PNRDVASFKLLERID 244
              +  S K  + +D
Sbjct: 544 MTLEEISEKYHDEVD 558

>KNAG0I01910 Chr9 complement(373073..374869) [1797 bp, 598 aa] {ON} 
          Length = 598

 Score = 32.0 bits (71), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 38/155 (24%), Positives = 65/155 (41%), Gaps = 15/155 (9%)

Query: 79  NPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSL-LAGFSVYSNQI 137
           N  Q++     Y L  G     +G L D +G +   + G   Y + S+ LA    Y   +
Sbjct: 147 NESQVNVTVVVYLLFQGIAPTFSGGLADRYGRRPIILGGMLVYVVASIGLARAPSYGVIV 206

Query: 138 FFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSLFGASAPGGFVL-GAVFSSML 196
           F    ++  G+ P   + + +      Y   R +    +  GA++  GFVL G     +L
Sbjct: 207 FLRIVQSI-GISPTIAISSGVV---SDYTLKRERG---TFVGATS--GFVLIGQGIGPLL 257

Query: 197 GQL--AWWPWA--YWLMGIACFLLAVAGYYLIPHT 227
           G +  A W W   +W + I C    +  ++L+P T
Sbjct: 258 GAVIAARWDWRAIFWFLVIGCGTSMLIAFFLLPET 292

>KLTH0E04400g Chr5 (397784..399256) [1473 bp, 490 aa] {ON} weakly
           similar to uniprot|Q08777 Saccharomyces cerevisiae
           YOR306C MCH5
          Length = 490

 Score = 32.0 bits (71), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 53/221 (23%), Positives = 93/221 (42%), Gaps = 25/221 (11%)

Query: 20  KKDDEVLSD-----EFDVQEEKPES-LLWESAFVGVLCSAQLMTQAGLGQSLAPLHIIGD 73
           KK +EV+ D     EF+  E   ++ +    +F+G   +      AG+ Q+    +I  +
Sbjct: 28  KKREEVVEDYSVPDEFEYAEGGWKAWMAILGSFLGFFPTWGFFYTAGVMQN----YIAKN 83

Query: 74  SFGTANPGQLSWFASAYSLT-VGTFILIAGRLGDIFGHKKFFVLG--FFWYALWSLLAGF 130
              TA+   +SW  S Y+   +G+F+  +G   D+ G ++  +LG   F   +++L    
Sbjct: 84  QLATASTSTISWVFSVYNFCLLGSFVF-SGLYFDLNGARRPLILGNVMFLTGMFALGNCT 142

Query: 131 SVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSLFGASAPGGFVLGA 190
            V+    F  C     GMG        I ++   +   RR+ +  +L   +  GG + G 
Sbjct: 143 KVWH---FIVCLGILVGMGSGISSSPLIGVVCHHFN--RRRGIATAL---AMNGGSIGGV 194

Query: 191 VFSSMLGQL---AWWPWAYWLMGIACFLLAVAGYYLIPHTP 228
           V   ML  L   + +PWA   +G       V   +L    P
Sbjct: 195 VIPLMLRSLFEKSGYPWAMRSLGFLSTGFLVCSVFLAREDP 235

>TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON} 
          Length = 612

 Score = 32.0 bits (71), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 28/127 (22%), Positives = 53/127 (41%), Gaps = 9/127 (7%)

Query: 85  WFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNQIFFDCCRA 144
           W  + YSL      LI GR+  + G K   +     + + SL+A  +   + +     R 
Sbjct: 94  WIYAGYSLPSALLTLIWGRIAAVCGFKSSMLTAIIIFEVGSLVAALANSMDMLIGG--RV 151

Query: 145 FQGMGPAFLLPNAIAILGRTYKPGRRKNMVF---SLFGASAPGGFVLGAVFSSMLGQLAW 201
             G+G + +      I+    +  +R  ++    S FG ++  G  LG  F++ +     
Sbjct: 152 IAGLGGSGIQTLCFVIISTLVEESKRGLLIACMGSAFGIASVVGPFLGGAFTTHVT---- 207

Query: 202 WPWAYWL 208
           W W +W+
Sbjct: 208 WRWCFWI 214

>TBLA0A01420 Chr1 (333707..335425) [1719 bp, 572 aa] {ON} Anc_1.451
           YCR023C
          Length = 572

 Score = 32.0 bits (71), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 53/127 (41%), Gaps = 19/127 (14%)

Query: 79  NPGQLSWFASAYSLTVGTFILIA----GRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYS 134
           N  Q+S ++   S T      +A    GR  D +G K   +LG     +  L+ GFS + 
Sbjct: 56  NEAQVSRYSGYLSATFSLCKFLAAYHWGRFSDEYGRKLTVILGMLGTCISLLILGFSKH- 114

Query: 135 NQIFFDCCRAFQGMGPAFLLPNAIA----ILGRTYKPGRRKNMVFSLFGASAPGGFVLGA 190
              F+    A   MG   LL   IA    I+G     GR + + FS    + P  F  G 
Sbjct: 115 ---FYQAMIARSMMG---LLNGNIAVIRTIVGELTTEGRHQAIAFS----TIPLLFQFGT 164

Query: 191 VFSSMLG 197
           V  S++G
Sbjct: 165 VIGSIIG 171

>KLLA0F04950g Chr6 (486258..488345) [2088 bp, 695 aa] {ON} similar
           to uniprot|P32791 Saccharomyces cerevisiae YLR214W FRE1
           Ferric reductase and cupric reductase reduces
           siderophore-bound iron and oxidized copper prior to
           uptake by transporters expression induced by low copper
           and iron levels
          Length = 695

 Score = 32.0 bits (71), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 34/64 (53%), Gaps = 14/64 (21%)

Query: 172 NMVFSLFGASAPGGFVLGAVFSSMLGQLAWWPWAYWLMGIACFLLAVAGYYLIPHTPMPN 231
           +++++++  S  GG           G LAWWP AYW  G+   +L+   ++++ H+    
Sbjct: 320 SIIWTVWAKSKEGG-----------GYLAWWPDAYWQWGVFATMLS---FFMVAHSHKWI 365

Query: 232 RDVA 235
           RD+A
Sbjct: 366 RDLA 369

>SAKL0C04708g Chr3 (455246..456799) [1554 bp, 517 aa] {ON} similar
           to uniprot|P25621 Saccharomyces cerevisiae YCR028C FEN2
           Plasma membrane H -pantothenate symporter confers
           sensitivity to the antifungal agent fenpropimorph
          Length = 517

 Score = 31.6 bits (70), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 51/113 (45%), Gaps = 9/113 (7%)

Query: 124 WSLLAGFSVYSNQIFFDCC--RAFQGMGPAFLLPNAIAILGRTYKPGRR--KNMVFSLFG 179
           W +L   S+Y    F  CC  R FQ +  +        ILG  Y+      ++ +F+  G
Sbjct: 126 WGVLT-LSMYRVSSFNQCCAIRFFQALFESCTFSGTHLILGSWYREDELSVRSAIFTSSG 184

Query: 180 --ASAPGGFVLGAVFSSMLGQ--LAWWPWAYWLMGIACFLLAVAGYYLIPHTP 228
              S   GF+  ++ SS+ G+  LA W W + +  +    +AV G+   P TP
Sbjct: 185 LVGSLFSGFMQVSIHSSLDGRRGLAGWRWLFIIDFLITLPIAVYGFVCFPDTP 237

>Smik_17.11 Chr17 complement(8582..10216) [1635 bp, 544 aa] {ON}
           YPR198W (REAL)
          Length = 544

 Score = 31.6 bits (70), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 14/51 (27%), Positives = 28/51 (54%)

Query: 81  GQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFS 131
           G + W  + Y+L+   F+L+ GRL +I G  +  ++    + + SL++  S
Sbjct: 43  GNIGWLVTGYALSNAVFMLLWGRLAEILGTTECLMISVVIFEIGSLISALS 93

>Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878
           bp, 625 aa] {ON} YGR224W (REAL)
          Length = 625

 Score = 31.6 bits (70), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 28/138 (20%), Positives = 57/138 (41%), Gaps = 7/138 (5%)

Query: 82  QLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNQIFFDC 141
           ++ W  + YSL     +LI GR+    G K   +     + + SL++  +   N +    
Sbjct: 97  EIGWLFTGYSLPNALLVLIWGRIATPIGFKATMLFAIVIFEIGSLISALASSMNMLI--G 154

Query: 142 CRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSLFGASAPGGFVLGAVFSSMLGQLAW 201
            R   G+G   +   +  ++G T     ++ M+ ++  +S     V+G     +      
Sbjct: 155 GRVIAGIGGCGIQSLSF-VIGSTLVEESKRGMLIAILSSSFAIASVVGPFLGGVFTSSVT 213

Query: 202 WPWAYWLM----GIACFL 215
           W W +++     G+A FL
Sbjct: 214 WRWCFYINLPIGGLAFFL 231

>SAKL0B12716g Chr2 (1101141..1103039) [1899 bp, 632 aa] {ON} similar
           to uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 632

 Score = 31.2 bits (69), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 39/176 (22%), Positives = 70/176 (39%), Gaps = 14/176 (7%)

Query: 66  APLHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWS 125
           A + +I + F   +  +  W  S YSL      L+ GR   IFG K   +L    +   S
Sbjct: 63  ASIEVISEQFN--DYSKSGWIVSGYSLPEALLTLLWGRFATIFGFKLSLLLSILIFETGS 120

Query: 126 LLAGFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSL----FGAS 181
           L++  S   N +     R   G+G +  + +   ++  T    R + +  S+    +  +
Sbjct: 121 LISAVSNSMNVLIGG--RVVAGIGGSG-IQSLCFVIASTLTTERSRGVAISVLSCAYAVA 177

Query: 182 APGGFVLGAVFSSMLGQLAWWPWAYWL-MGIACFLLAVAGYYLIPHTPMPNRDVAS 236
           A  G  +G  F++ +     W W +++ + I     AV      PH     R + S
Sbjct: 178 AVAGPFMGGAFTTHV----TWRWCFYINLPIGSLAFAVLVLTYKPHEGNSARSIVS 229

>KLTH0B03894g Chr2 complement(317072..318892) [1821 bp, 606 aa] {ON}
           weakly similar to uniprot|P53283 Saccharomyces
           cerevisiae YGR138C TPO2 Polyamine transport protein
          Length = 606

 Score = 31.2 bits (69), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 22/44 (50%)

Query: 168 GRRKNMVFSLFGASAPGGFVLGAVFSSMLGQLAWWPWAYWLMGI 211
            + + +  SLF A+   G V+G +  S+L     W W YW M I
Sbjct: 254 NKERGVAMSLFSAAPFLGPVMGPIVGSLLSVKCSWRWVYWFMVI 297

>SAKL0F16632g Chr6 complement(1375911..1377758) [1848 bp, 615 aa]
           {ON} similar to gnl|GLV|KLLA0F24200g Kluyveromyces
           lactis KLLA0F24200g and some similarities with
           uniprot|P53918 Saccharomyces cerevisiae YNL125C ESBP6
          Length = 615

 Score = 31.2 bits (69), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 39/149 (26%), Positives = 63/149 (42%), Gaps = 15/149 (10%)

Query: 97  FILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNQIFFD---CCRAFQGMGPAFL 153
           F+L+  R   IFG K   +LG  +  L  +LA ++    Q++      C    GMG AF+
Sbjct: 201 FVLLFSR---IFGFKVPMLLGTVFLFLGHMLASYAAKLWQLYLTQGLLC----GMGIAFV 253

Query: 154 LPNAIAILGRTYKPGRRKNMVFSLFGASAPGGFVLGAVFSSMLGQLAWWPWAYWLMGIAC 213
              A  +L   +   R   +  SL G  A GG       + ++ +     WA   + IAC
Sbjct: 254 FAPATVVLPGWFLRKRSFAVGLSLVGTGA-GGVTYSLAVNQIIQRTGDPRWALRTLAIAC 312

Query: 214 FLLAVAGYYLI----PHTPMPNRDVASFK 238
            +  +    +I    P TP+  +  A+ K
Sbjct: 313 SVTCLVAIAVIRQRVPATPIGIKSAAALK 341

>TBLA0A10540 Chr1 (2603824..2605305) [1482 bp, 493 aa] {ON} 
          Length = 493

 Score = 31.2 bits (69), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 42/182 (23%), Positives = 72/182 (39%), Gaps = 40/182 (21%)

Query: 9   EENLDM--NVETLKKDDEVLSDEFDVQEEK---PESLL--WES---AFVGVLCSAQLMTQ 58
           E+  D+   V T+K   + L   F  +EEK   PE  L  W +   +F+G++ S   M  
Sbjct: 43  EDKHDIIDKVSTIKDKTDTL---FICKEEKNSFPEGGLRGWLAVFASFIGMVASYGTMYA 99

Query: 59  AGLGQSLAPLHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGF 118
            G+ ++    +I  +     +  ++ W  S Y        ++ G L D FG KK  ++G 
Sbjct: 100 PGVIEN----YIKENQLNDTSSFEIGWIFSLYIFICFITFILGGTLFDNFGFKKPILIGT 155

Query: 119 FWYA-----------LWSLLAGFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKP 167
             +            LW  + G+S+              G G   L+P  I+I  + +  
Sbjct: 156 IIHVGSLFSLANCRELWQFILGYSI------------LGGFGNGILIPCLISIPSQYFNR 203

Query: 168 GR 169
            R
Sbjct: 204 KR 205

>SAKL0G13376g Chr7 complement(1147643..1149508) [1866 bp, 621 aa]
           {ON} weakly similar to uniprot|Q06451 Saccharomyces
           cerevisiae YPR156C TPO3 Polyamine transport protein
          Length = 621

 Score = 31.2 bits (69), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 24/49 (48%), Gaps = 2/49 (4%)

Query: 168 GRRKNMVFSLFGASAPGGFVLGAVFSSMLGQLAWWPWAYWLMGI--ACF 214
            + + +  S+F A+   G V+G +  S+L     W W YW M I  AC 
Sbjct: 259 NKERGVAMSVFSAAPFMGPVMGPIVGSLLSVKCSWRWVYWFMLIFSACL 307

>NDAI0D04220 Chr4 complement(987497..989347) [1851 bp, 616 aa] {ON}
           Anc_4.212
          Length = 616

 Score = 30.8 bits (68), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 37/81 (45%), Gaps = 7/81 (8%)

Query: 155 PNAIAILGRTYKPGRRKNMVFSLFGASAPGGFVLG----AVFSSMLGQ--LAWWPWAYWL 208
           P +  ILG  Y P    + VF  F     GG   G     +F S+ G   LA W W + +
Sbjct: 258 PVSQYILGCWYAPDELTSRVFLFFCGQLLGGVTSGLLQARIFKSLNGVNGLAGWRWMFLI 317

Query: 209 MGIACFL-LAVAGYYLIPHTP 228
             IA  L  A+ G+++IP  P
Sbjct: 318 DAIAISLPTAILGFFVIPGIP 338

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.326    0.138    0.442 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 49,749,544
Number of extensions: 1987485
Number of successful extensions: 7361
Number of sequences better than 10.0: 258
Number of HSP's gapped: 7230
Number of HSP's successfully gapped: 269
Length of query: 516
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 402
Effective length of database: 40,409,475
Effective search space: 16244608950
Effective search space used: 16244608950
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 68 (30.8 bits)