Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_15.3626.69ON46546522920.0
YOR177C (MPC54)6.69ON46446518640.0
Suva_8.2336.69ON46546518430.0
Skud_15.3446.69ON46546518190.0
SAKL0A05368g6.179ON99371820.21
ZYRO0E04708gsingletonON611101790.48
Kwal_26.93864.238ON1215199770.91
AFR561W8.752ON267118722.1
TPHA0F026606.77ON364141722.6
Kpol_1008.29singletonON538120723.1
KLLA0E02377g5.443ON122039713.8
NDAI0G035308.125ON539109713.8
KAFR0F014601.427ON105767714.4
KAFR0C051007.37ON705160705.3
ZYRO0G17996g7.488ON1455197705.4
SAKL0A08206g6.69ON64537705.5
KLLA0A00594g5.702ON1748137706.4
AGR189W8.443ON1240135697.0
TDEL0C009608.68ON122261688.7
NOTE: 6 genes in the same pillar as Smik_15.362 were not hit in these BLAST results
LIST: KLTH0G15334g AGR274C Kwal_56.23256 TDEL0G04560 Ecym_3119 TPHA0K01150

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_15.362
         (465 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_15.362 Chr15 complement(622220..623617) [1398 bp, 465 aa] {...   887   0.0  
YOR177C Chr15 complement(665785..667179) [1395 bp, 464 aa] {ON} ...   722   0.0  
Suva_8.233 Chr8 complement(415017..416414) [1398 bp, 465 aa] {ON...   714   0.0  
Skud_15.344 Chr15 complement(616669..618066) [1398 bp, 465 aa] {...   705   0.0  
SAKL0A05368g Chr1 complement(484027..487008) [2982 bp, 993 aa] {...    36   0.21 
ZYRO0E04708g Chr5 complement(354494..356329) [1836 bp, 611 aa] {...    35   0.48 
Kwal_26.9386 s26 complement(1192963..1196610) [3648 bp, 1215 aa]...    34   0.91 
AFR561W Chr6 (1439423..1440226) [804 bp, 267 aa] {ON} Syntenic h...    32   2.1  
TPHA0F02660 Chr6 (592297..593391) [1095 bp, 364 aa] {ON} Anc_6.7...    32   2.6  
Kpol_1008.29 s1008 complement(62595..64211) [1617 bp, 538 aa] {O...    32   3.1  
KLLA0E02377g Chr5 complement(218647..222309) [3663 bp, 1220 aa] ...    32   3.8  
NDAI0G03530 Chr7 (849660..851279) [1620 bp, 539 aa] {ON} Anc_8.125     32   3.8  
KAFR0F01460 Chr6 (284981..288154) [3174 bp, 1057 aa] {ON} Anc_1....    32   4.4  
KAFR0C05100 Chr3 (1011347..1013464) [2118 bp, 705 aa] {ON} Anc_7...    32   5.3  
ZYRO0G17996g Chr7 (1477518..1481885) [4368 bp, 1455 aa] {ON} wea...    32   5.4  
SAKL0A08206g Chr1 (729465..731402) [1938 bp, 645 aa] {ON} conser...    32   5.5  
KLLA0A00594g Chr1 complement(53304..58550) [5247 bp, 1748 aa] {O...    32   6.4  
AGR189W Chr7 (1108696..1112418) [3723 bp, 1240 aa] {ON} Syntenic...    31   7.0  
TDEL0C00960 Chr3 (153572..157240) [3669 bp, 1222 aa] {ON} Anc_8....    31   8.7  

>Smik_15.362 Chr15 complement(622220..623617) [1398 bp, 465 aa] {ON}
           YOR177C (REAL)
          Length = 465

 Score =  887 bits (2292), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/465 (94%), Positives = 441/465 (94%)

Query: 1   MPKDITYSDSFEEFNNSNTLAVSPYKDIFFKEMTPSKPNVRFGDDDVNIFDQRKKVNEIN 60
           MPKDITYSDSFEEFNNSNTLAVSPYKDIFFKEMTPSKPNVRFGDDDVNIFDQRKKVNEIN
Sbjct: 1   MPKDITYSDSFEEFNNSNTLAVSPYKDIFFKEMTPSKPNVRFGDDDVNIFDQRKKVNEIN 60

Query: 61  KNSSIKRTFQXXXXXXXXXXXXXXXXXXXXXXXXDIFNYGNKSETREETFKDVNDAVNRC 120
           KNSSIKRTFQ                        DIFNYGNKSETREETFKDVNDAVNRC
Sbjct: 61  KNSSIKRTFQTSTSTTTTPNKSSLKSPKSKKTSKDIFNYGNKSETREETFKDVNDAVNRC 120

Query: 121 YALCNIPTKHISIKSISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKE 180
           YALCNIPTKHISIKSISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKE
Sbjct: 121 YALCNIPTKHISIKSISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKE 180

Query: 181 LNEKSLQMAIDHLLKVTKQNLRQADDNNKLKDTEVLKSFIEEIEEVDDNKISINSLEQQL 240
           LNEKSLQMAIDHLLKVTKQNLRQADDNNKLKDTEVLKSFIEEIEEVDDNKISINSLEQQL
Sbjct: 181 LNEKSLQMAIDHLLKVTKQNLRQADDNNKLKDTEVLKSFIEEIEEVDDNKISINSLEQQL 240

Query: 241 FEEKTANNILRRDYYKLQERGRRLCHDFQDLQDDYSKQMKQKEYEVQKLKNEIKTLLCMN 300
           FEEKTANNILRRDYYKLQERGRRLCHDFQDLQDDYSKQMKQKEYEVQKLKNEIKTLLCMN
Sbjct: 241 FEEKTANNILRRDYYKLQERGRRLCHDFQDLQDDYSKQMKQKEYEVQKLKNEIKTLLCMN 300

Query: 301 DNLKADRTLLSQKEKQYFQKCTYIEKYMNHVKEEYNRKENECNKLKYIIDKSMKRIEHLE 360
           DNLKADRTLLSQKEKQYFQKCTYIEKYMNHVKEEYNRKENECNKLKYIIDKSMKRIEHLE
Sbjct: 301 DNLKADRTLLSQKEKQYFQKCTYIEKYMNHVKEEYNRKENECNKLKYIIDKSMKRIEHLE 360

Query: 361 RSLQSQSTVQNSFSTATILEEGSKDIDLEDRYHKVKEFMEQKLQTSKIHDSSCSETEALD 420
           RSLQSQSTVQNSFSTATILEEGSKDIDLEDRYHKVKEFMEQKLQTSKIHDSSCSETEALD
Sbjct: 361 RSLQSQSTVQNSFSTATILEEGSKDIDLEDRYHKVKEFMEQKLQTSKIHDSSCSETEALD 420

Query: 421 NVLGLIENTMKKLDKNNKYVPTTAKKCIKYVTGSSRFDENEHITN 465
           NVLGLIENTMKKLDKNNKYVPTTAKKCIKYVTGSSRFDENEHITN
Sbjct: 421 NVLGLIENTMKKLDKNNKYVPTTAKKCIKYVTGSSRFDENEHITN 465

>YOR177C Chr15 complement(665785..667179) [1395 bp, 464 aa] {ON}
           MPC54Component of the meiotic outer plaque, a
           membrane-organizing center which is assembled on the
           cytoplasmic face of the spindle pole body during meiosis
           II and triggers the formation of the prospore membrane;
           potential Cdc28p substrate
          Length = 464

 Score =  722 bits (1864), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/465 (77%), Positives = 395/465 (84%), Gaps = 1/465 (0%)

Query: 1   MPKDITYSDSFEEFNNSNTLAVSPYKDIFFKEMTPSKPNVRFGDDDVNIFDQRKKVNEIN 60
           MP+D +YS+SFE++ N N+ A+SPYKD F+KEMTPSKPNVRFGDDDVNIFDQRKKVNEIN
Sbjct: 1   MPEDTSYSNSFEDYYN-NSHAISPYKDSFYKEMTPSKPNVRFGDDDVNIFDQRKKVNEIN 59

Query: 61  KNSSIKRTFQXXXXXXXXXXXXXXXXXXXXXXXXDIFNYGNKSETREETFKDVNDAVNRC 120
           KN+++KR+                          + F+   K E++ ET K+VNDAVNRC
Sbjct: 60  KNNTVKRSIPSSISTTITPNKSSLKSPRGKRASKNSFDNETKLESKNETLKEVNDAVNRC 119

Query: 121 YALCNIPTKHISIKSISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKE 180
           YALCNIPTKH+SI SISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKE
Sbjct: 120 YALCNIPTKHVSINSISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKE 179

Query: 181 LNEKSLQMAIDHLLKVTKQNLRQADDNNKLKDTEVLKSFIEEIEEVDDNKISINSLEQQL 240
           LNEKSLQMAIDHLLKVTKQNLRQADD NKLK+TE LKSFIEEIEEVDDNKISINSL+QQL
Sbjct: 180 LNEKSLQMAIDHLLKVTKQNLRQADDGNKLKETEALKSFIEEIEEVDDNKISINSLQQQL 239

Query: 241 FEEKTANNILRRDYYKLQERGRRLCHDFQDLQDDYSKQMKQKEYEVQKLKNEIKTLLCMN 300
            EEKTANNILRRDYYKLQERGRRLCH+FQ+LQDDYSKQMKQKEYEVQKLKNEIK LL MN
Sbjct: 240 LEEKTANNILRRDYYKLQERGRRLCHEFQELQDDYSKQMKQKEYEVQKLKNEIKVLLNMN 299

Query: 301 DNLKADRTLLSQKEKQYFQKCTYIEKYMNHVKEEYNRKENECNKLKYIIDKSMKRIEHLE 360
           DNLKA++   SQKEKQYFQK TYIEKYMNHVKEEYNRKE+EC KL +IIDKSMK+IEHLE
Sbjct: 300 DNLKAEKAHYSQKEKQYFQKYTYIEKYMNHVKEEYNRKEDECKKLNFIIDKSMKKIEHLE 359

Query: 361 RSLQSQSTVQNSFSTATILEEGSKDIDLEDRYHKVKEFMEQKLQTSKIHDSSCSETEALD 420
           RSLQ+Q T QNSFSTA I EEG KD  L+DRYHKVKEFMEQKLQTSKI+D SCSE EALD
Sbjct: 360 RSLQTQFTAQNSFSTAMIQEEGPKDAHLKDRYHKVKEFMEQKLQTSKINDPSCSEAEALD 419

Query: 421 NVLGLIENTMKKLDKNNKYVPTTAKKCIKYVTGSSRFDENEHITN 465
           NVL LIE++MK LDKN+K  P   KKCIKYVT S R  ENEH+TN
Sbjct: 420 NVLCLIESSMKTLDKNSKCYPIATKKCIKYVTDSPRLKENEHVTN 464

>Suva_8.233 Chr8 complement(415017..416414) [1398 bp, 465 aa] {ON}
           YOR177C (REAL)
          Length = 465

 Score =  714 bits (1843), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/465 (77%), Positives = 392/465 (84%)

Query: 1   MPKDITYSDSFEEFNNSNTLAVSPYKDIFFKEMTPSKPNVRFGDDDVNIFDQRKKVNEIN 60
           MP+D  YSDS+ E NNSN   VSPYKD FFKE+TPSKPNVRFGDDDVNIFDQRKKVNEIN
Sbjct: 1   MPEDPHYSDSYGENNNSNPNMVSPYKDSFFKEVTPSKPNVRFGDDDVNIFDQRKKVNEIN 60

Query: 61  KNSSIKRTFQXXXXXXXXXXXXXXXXXXXXXXXXDIFNYGNKSETREETFKDVNDAVNRC 120
           K+S IK++                            F+Y ++ E+ +ETFKDVNDAVNRC
Sbjct: 61  KSSYIKKSIPLSTNTNSTPNKSSLKSPRSDSTSKPGFDYIDQLESNDETFKDVNDAVNRC 120

Query: 121 YALCNIPTKHISIKSISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKE 180
           YALCNIPTKH+SIKSISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKE
Sbjct: 121 YALCNIPTKHVSIKSISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKE 180

Query: 181 LNEKSLQMAIDHLLKVTKQNLRQADDNNKLKDTEVLKSFIEEIEEVDDNKISINSLEQQL 240
           LNEKSLQMAIDHLLKVTKQNLRQADD NKLK+TEVLKSF EEIEEVDDNKISIN+LEQQL
Sbjct: 181 LNEKSLQMAIDHLLKVTKQNLRQADDTNKLKETEVLKSFFEEIEEVDDNKISINNLEQQL 240

Query: 241 FEEKTANNILRRDYYKLQERGRRLCHDFQDLQDDYSKQMKQKEYEVQKLKNEIKTLLCMN 300
            EEK ANNILRRDYYKLQERGRRLCH+FQDLQ+DY++Q+K KEYE+QKLKNEIKTLL MN
Sbjct: 241 LEEKKANNILRRDYYKLQERGRRLCHEFQDLQNDYTQQIKHKEYELQKLKNEIKTLLNMN 300

Query: 301 DNLKADRTLLSQKEKQYFQKCTYIEKYMNHVKEEYNRKENECNKLKYIIDKSMKRIEHLE 360
           +NLKAD+T  SQ EKQYFQK TYIEKYM HVKEEYN+KE+EC+KLK+IID ++K+I+HLE
Sbjct: 301 NNLKADKTQFSQMEKQYFQKYTYIEKYMTHVKEEYNKKEDECDKLKFIIDNNLKKIDHLE 360

Query: 361 RSLQSQSTVQNSFSTATILEEGSKDIDLEDRYHKVKEFMEQKLQTSKIHDSSCSETEALD 420
           R+LQSQ   QNSFSTA I EE   D  LEDRY KVKEFMEQKLQTSKI D   SETEALD
Sbjct: 361 RALQSQIATQNSFSTAAIQEEDPDDAHLEDRYQKVKEFMEQKLQTSKIDDPMKSETEALD 420

Query: 421 NVLGLIENTMKKLDKNNKYVPTTAKKCIKYVTGSSRFDENEHITN 465
           NVLGLIENTMK LD+N+KY PTT KKCIKYV GSSR  ENEHITN
Sbjct: 421 NVLGLIENTMKTLDRNSKYQPTTTKKCIKYVIGSSRLKENEHITN 465

>Skud_15.344 Chr15 complement(616669..618066) [1398 bp, 465 aa] {ON}
           YOR177C (REAL)
          Length = 465

 Score =  705 bits (1819), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/465 (74%), Positives = 394/465 (84%)

Query: 1   MPKDITYSDSFEEFNNSNTLAVSPYKDIFFKEMTPSKPNVRFGDDDVNIFDQRKKVNEIN 60
           MP+DI+Y+  FEEF+N+N+  +SP+KD +FK+MTPSKPNVRFGDDDVNIFDQRKKVNEIN
Sbjct: 1   MPEDISYTGPFEEFSNNNSHGISPFKDSYFKDMTPSKPNVRFGDDDVNIFDQRKKVNEIN 60

Query: 61  KNSSIKRTFQXXXXXXXXXXXXXXXXXXXXXXXXDIFNYGNKSETREETFKDVNDAVNRC 120
           KNSSI+R                             F+Y  + ETR++TFK+VNDAVNRC
Sbjct: 61  KNSSIRRGIPPSININNTPNKSSLKSPKSNNLSDCGFDYERRFETRDDTFKEVNDAVNRC 120

Query: 121 YALCNIPTKHISIKSISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKE 180
           YALCNIPTKHISI SISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKK+
Sbjct: 121 YALCNIPTKHISISSISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKD 180

Query: 181 LNEKSLQMAIDHLLKVTKQNLRQADDNNKLKDTEVLKSFIEEIEEVDDNKISINSLEQQL 240
           LNEKSLQMAIDHLLKVTKQN RQ D  +KL++TEVLKSFI+EIEEV+DNKISINSLEQQL
Sbjct: 181 LNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISINSLEQQL 240

Query: 241 FEEKTANNILRRDYYKLQERGRRLCHDFQDLQDDYSKQMKQKEYEVQKLKNEIKTLLCMN 300
            EEKTANNILRRDYYKLQERG+RLCH+FQDLQDDYSK+MKQKEYEVQKLKNE+K L  MN
Sbjct: 241 LEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMN 300

Query: 301 DNLKADRTLLSQKEKQYFQKCTYIEKYMNHVKEEYNRKENECNKLKYIIDKSMKRIEHLE 360
            NLKAD+T  SQKEKQY QK  YIEKYM+HVK+EYN+KE+ECN+LK+++DK+MK+I+HLE
Sbjct: 301 TNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLE 360

Query: 361 RSLQSQSTVQNSFSTATILEEGSKDIDLEDRYHKVKEFMEQKLQTSKIHDSSCSETEALD 420
           RSLQ+Q+  QNSFS  T+ +E  KD  LEDRYHKVKEFMEQKLQTSK +D SCSE EALD
Sbjct: 361 RSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTSKNNDPSCSEAEALD 420

Query: 421 NVLGLIENTMKKLDKNNKYVPTTAKKCIKYVTGSSRFDENEHITN 465
           NVLGLIENTMK L+ N+KY  TT KKC+KYVTGSSR  ENEHITN
Sbjct: 421 NVLGLIENTMKTLEGNSKYYSTTTKKCLKYVTGSSRLKENEHITN 465

>SAKL0A05368g Chr1 complement(484027..487008) [2982 bp, 993 aa] {ON}
           weakly similar to uniprot|P53148 Saccharomyces
           cerevisiae YGL093W SPC105 Protein required for accurate
           chromosome segregation localizes to the nuclear side of
           the spindle pole body forms a complex with YDR532C-P
          Length = 993

 Score = 36.2 bits (82), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 38/71 (53%), Gaps = 6/71 (8%)

Query: 236 LEQQLFEEKTANNILRRDYYKLQERGRRLCHDFQDLQDDYSKQMKQK---EYEVQKLKNE 292
           LE+Q+    TA  +L RDY++  E  RRL +D   L   YS+   +K   E+  Q LK  
Sbjct: 611 LEEQI--SSTAPPLLLRDYFESSEEVRRLMNDQIQLVKSYSRLEAKKVWLEWRSQHLKG- 667

Query: 293 IKTLLCMNDNL 303
           IK  LC N +L
Sbjct: 668 IKNALCENLSL 678

>ZYRO0E04708g Chr5 complement(354494..356329) [1836 bp, 611 aa] {ON}
           conserved hypothetical protein
          Length = 611

 Score = 35.0 bits (79), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 26/101 (25%), Positives = 42/101 (41%), Gaps = 17/101 (16%)

Query: 30  FKEMTPSKPNVRFGDDDVNIFDQRKKVN-EINKNSSIKRTFQXXXXXXXXXXXXXXXXXX 88
           F ++   K NV+FGD ++ IF++ +++   +  NSS+                       
Sbjct: 68  FSKLQAPKGNVKFGDKEIVIFNEDERIGHSMKANSSVDNVI-----------LPLPILKI 116

Query: 89  XXXXXXDI--FNYGNKSETREETFKDVNDAVNRCYALCNIP 127
                 DI      NK  T++E   +V     RCY LCN+P
Sbjct: 117 SQKGASDIKYMEPDNKMATQQERLFEV---FRRCYTLCNLP 154

>Kwal_26.9386 s26 complement(1192963..1196610) [3648 bp, 1215 aa]
           {ON} YDL058W (USO1) - Integrin analogue gene [contig 72]
           PARTIAL
          Length = 1215

 Score = 34.3 bits (77), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 54/199 (27%), Positives = 92/199 (46%), Gaps = 29/199 (14%)

Query: 174 EQLEKKELNEKSLQMAIDHLLKVTKQNLRQADDNNKLKDTEVLKSFIEEIEEVDDNKISI 233
           EQLEKK    K  Q+ +++        L++A D    KD +V K  IEEI E   +    
Sbjct: 742 EQLEKKLAGSKEKQLELEN-------GLKEAVDQGMEKDGKVTK-LIEEIAEAKAD---- 789

Query: 234 NSLEQQLFEEKTANNILRRDYYKLQERGRRLCHDFQDLQDDYSKQMKQKEYEVQKLKNEI 293
                 L E+     IL  +  KL++  +R   +    +   S + +  E EV  L+N++
Sbjct: 790 ------LKEKAEEIRILSLEKSKLEDSYKRSMEELSRYKSSASDERQGLENEVTMLRNKL 843

Query: 294 KTLLCMNDNLKADRTLLSQKE----KQYFQKCTYIEKYMNHVKEEYNRKE----NECNKL 345
           K   C+    + +R LL++      + Y  K + +EK ++ ++ EY+ K     NE N+L
Sbjct: 844 KD-KCL--EFEKERKLLNEGSTSVTEDYSNKVSSLEKKLDSLEAEYSSKRRDFANEQNEL 900

Query: 346 KYIIDKSMKRIEHLERSLQ 364
           + ++ KS K     +  LQ
Sbjct: 901 RALLAKSEKAASKTDAELQ 919

>AFR561W Chr6 (1439423..1440226) [804 bp, 267 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR226C
          Length = 267

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 25/118 (21%), Positives = 53/118 (44%), Gaps = 2/118 (1%)

Query: 104 ETREETFKDVNDAVNRCYALCNIPTKHISIKSISDLAQTFETLAVGITHETNRKAECERS 163
           E   E F+D++  +N   A   + T+ +   S+ D+ + F T  +G+ H T       ++
Sbjct: 87  EGLPEEFRDIDILINN--AGKALGTERVGEISMDDIQEVFNTNVIGLVHLTQEVLPIMKA 144

Query: 164 KNAIDSLYYHEQLEKKELNEKSLQMAIDHLLKVTKQNLRQADDNNKLKDTEVLKSFIE 221
           KN+ D +       ++     S+  A  H +K   + +R+   + K++  E+    +E
Sbjct: 145 KNSGDIVNVGSIAGREAYPGGSIYCATKHAVKAFTRAMRKELISTKIRVFEIAPGSVE 202

>TPHA0F02660 Chr6 (592297..593391) [1095 bp, 364 aa] {ON} Anc_6.77
           YLR283W
          Length = 364

 Score = 32.3 bits (72), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 64/141 (45%), Gaps = 3/141 (2%)

Query: 163 SKNAIDSLYYHEQLEKKELNEKSLQMAIDHLLKVTKQNLRQADDNNKLKDTEV-LKSFIE 221
           ++N +D+L YHE L       +  Q+ ID +L+V  +   +  ++  L+  E+  +S + 
Sbjct: 126 AENELDTLQYHEMLTANGFTSEQSQIIIDLMLEVLNEEFFRKYNSRFLRTVELDNQSHLF 185

Query: 222 EIEEVDDNKISINSLEQQLFEEKTANNILRRDYYKLQERGRRLCHDFQDLQDDYSKQMKQ 281
            + E +      NS E QL ++      L RD   LQ+  R L  +F  L+ D       
Sbjct: 186 HVAETELRYTIQNSRETQLNDQHLQVTKLSRDLDSLQDELRELAINF--LEKDSKVDFNN 243

Query: 282 KEYEVQKLKNEIKTLLCMNDN 302
           ++ E   L  +IK  L   DN
Sbjct: 244 QKIENTSLLKDIKLELANCDN 264

>Kpol_1008.29 s1008 complement(62595..64211) [1617 bp, 538 aa] {ON}
           complement(62595..64211) [1617 nt, 539 aa]
          Length = 538

 Score = 32.3 bits (72), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 31/120 (25%), Positives = 53/120 (44%), Gaps = 22/120 (18%)

Query: 112 DVNDAVNRCYALCNIPTKHISIKSISDLAQTFETLAVGITHETNRKAECER-SKNAIDS- 169
           ++   V R + LC +  KHI  + IS   +  E L+V IT+  N K  C +  K  ++S 
Sbjct: 127 EITQIVKRMFTLCGVNLKHI--EGIS-FKEQLERLSVSITNAFNTKEMCSKYIKQKLESQ 183

Query: 170 -----------------LYYHEQLEKKELNEKSLQMAIDHLLKVTKQNLRQADDNNKLKD 212
                            L+    +  KEL +  +QMA   L +  ++  + A+ N+ LK+
Sbjct: 184 LNDKILEQQETVKYWKNLFDESTVRLKELEKSQIQMASGKLKETVQEQQKLAELNSSLKN 243

>KLLA0E02377g Chr5 complement(218647..222309) [3663 bp, 1220 aa]
           {ON} uniprot|O42726 Kluyveromyces lactis UBP2 Ubiquitin
           carboxyl-terminal hydrolase 2
          Length = 1220

 Score = 32.0 bits (71), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 22/39 (56%)

Query: 9   DSFEEFNNSNTLAVSPYKDIFFKEMTPSKPNVRFGDDDV 47
           D F +  ++N+  V+P K++ +    PS   V FGDD V
Sbjct: 770 DLFNDMIHTNSRCVTPTKELVYLAFAPSNVEVEFGDDTV 808

>NDAI0G03530 Chr7 (849660..851279) [1620 bp, 539 aa] {ON} Anc_8.125
          Length = 539

 Score = 32.0 bits (71), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 48/109 (44%), Gaps = 20/109 (18%)

Query: 190 IDHLLK---VTKQNLRQADDNNKLKDTEVLKSFIEEIEEVDDNKISINSLEQQLFEE--K 244
           I +LLK   +T Q+L Q      LK        I  I+E+ DN +S   L   LF++   
Sbjct: 378 ISYLLKTELLTNQSLSQ-----DLKQ-------ISSIKELTDNNLSDTQLFTILFQQLLT 425

Query: 245 TANNILRRDYYKLQERGRRLCHDFQDLQDDYSKQMKQKEYEVQKLKNEI 293
             + I   D  K  +R     H FQ+  DDYS+ +   E  +  +  +I
Sbjct: 426 PGSKISSLDLEKFYQR---KIHSFQNKLDDYSRVLSDIESAISGINGDI 471

>KAFR0F01460 Chr6 (284981..288154) [3174 bp, 1057 aa] {ON} Anc_1.427
           YCR011C
          Length = 1057

 Score = 32.0 bits (71), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 37/67 (55%), Gaps = 2/67 (2%)

Query: 279 MKQKEYEVQKL-KNEIKTLLC-MNDNLKADRTLLSQKEKQYFQKCTYIEKYMNHVKEEYN 336
           + Q+E+E   + ++EI+TLL   NDN      LLS+   + F++ TY E   N +KE  N
Sbjct: 701 LTQREWEHFAVHRDEIRTLLNDGNDNTVNKGILLSEPLNKKFKESTYYEALSNEIKEVTN 760

Query: 337 RKENECN 343
              N+ N
Sbjct: 761 DPRNDSN 767

>KAFR0C05100 Chr3 (1011347..1013464) [2118 bp, 705 aa] {ON} Anc_7.37
           YOR354C
          Length = 705

 Score = 31.6 bits (70), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 42/160 (26%), Positives = 72/160 (45%), Gaps = 23/160 (14%)

Query: 135 SISDLAQTFETLAVGITHETNRKAECERSK-NAIDSLYYHEQLEKKELNEKSLQMAIDHL 193
           S+ DL+   + L V +    N  +  +R K   I +L+    L KK + E S  M    L
Sbjct: 314 SVVDLSTLNDFLLVAVA---NLGSNSKRYKLTRIQALW--NDLIKKNITENSYTMLFKAL 368

Query: 194 LKVTKQNLRQADDNNKLKDT-----EVLKSFIEEIEEVDDNKISINSLEQQLFEE----K 244
           L     N  ++  NN+L +       +L+S++  I  ++  K+S N ++ +L  E     
Sbjct: 369 LHSKNFNELESVWNNELPENFKANQLILESYLNSI--LNFQKVSFNDIKDKLPNEIQTLD 426

Query: 245 TANNILRRDYYKLQERGRRLCHDFQDLQDDYSKQMKQKEY 284
             NN+L+R  Y    R R++  DF      Y+K  + K +
Sbjct: 427 LVNNVLKRVLYDPTIRNRKVFDDF------YTKYFENKRF 460

>ZYRO0G17996g Chr7 (1477518..1481885) [4368 bp, 1455 aa] {ON} weakly
           similar to uniprot|P34216 Saccharomyces cerevisiae
           YBL047C EDE1 Key endocytic protein involved in a network
           of interactions with other endocytic proteins binds
           membranes in a ubiquitin-dependent manner may also bind
           ubiquitinated membrane-associated proteins
          Length = 1455

 Score = 31.6 bits (70), Expect = 5.4,   Method: Composition-based stats.
 Identities = 45/197 (22%), Positives = 87/197 (44%), Gaps = 25/197 (12%)

Query: 174 EQLEKKELNEKSLQMAIDHLLKVTKQNLRQADDNNKLKDTEVLKSFIEEIEEVDDNKISI 233
           E+LE K         A++  L VT+ N    +     K TE+ +++ E  ++    K  I
Sbjct: 681 EELEAKLTEANKETAALEQQLTVTEGNYHAVES----KVTELTQTYEEAQQKNHQLKTQI 736

Query: 234 NSLEQQLFEEKTANNILRRDYYKLQERGRRLCHDFQDLQDDYSKQMKQKEYEVQKLKNEI 293
           ++L          N +      +L E+ R++  + + + D  SKQM+  ++ V   +NEI
Sbjct: 737 SNL----------NAMSSTLQAQLAEKQRQVKQE-RSMVDVNSKQMELNQFTVANFENEI 785

Query: 294 KTLLCMNDNLKADRTLLSQKEKQYFQKCTYIEKYMNHVKEEYNRKENECNKLK---YIID 350
           + L       K    L  +KE   +Q+   +E+    ++ +Y + E +   L      ++
Sbjct: 786 QGL-----GEKLQVYLSKRKELNDYQRT--VEQQHGQLQTKYQQLETKNQDLATRGQDLE 838

Query: 351 KSMKRIEHLERSLQSQS 367
           K  K ++  E++ Q QS
Sbjct: 839 KRRKALKEQEKAYQQQS 855

>SAKL0A08206g Chr1 (729465..731402) [1938 bp, 645 aa] {ON} conserved
           hypothetical protein
          Length = 645

 Score = 31.6 bits (70), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 12/37 (32%), Positives = 21/37 (56%), Gaps = 3/37 (8%)

Query: 115 DAVNRCYALCNIPTKHISIKSISDLAQTFETLAVGIT 151
           +A+ RC+ LCN+P + +      DL  + + L+ GI 
Sbjct: 217 EAITRCFNLCNVPLEDL---DEDDLVMSLQRLSFGIV 250

>KLLA0A00594g Chr1 complement(53304..58550) [5247 bp, 1748 aa] {ON}
           similar to uniprot|Q02455 Saccharomyces cerevisiae
           YKR095W MLP1 Myosin-like protein associated with the
           nuclear envelope connects the nuclear pore complex with
           the nuclear interior involved in the Tel1p pathway that
           controls telomere length involved in the retention of
           unspliced mRNAs in the nucleus
          Length = 1748

 Score = 31.6 bits (70), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 34/137 (24%), Positives = 72/137 (52%), Gaps = 15/137 (10%)

Query: 223 IEEVDDNKISINSLEQQLFEEKTANNILRRDYYKLQERGRRLCHDFQDLQDDY------- 275
           I E+ D+++ ++++E +L   +T+N  L++  + L E+  +   + ++++D+Y       
Sbjct: 219 ISELQDSQLKVSNMESELEIARTSNQKLKQSVHSLHEQLEQKLSENKEIKDEYNFSKQEL 278

Query: 276 SKQMKQKEYEVQKLKNEIKTLLCMNDNLK--ADRTLLSQKEKQYFQKCTYIEKYMNHVKE 333
           +K+M  K+  +  L+  +++L    D  K   D +  ++KE+        IE+ +N VK 
Sbjct: 279 TKEMSLKQRMIDALEKHMESLKKEMDATKNNMDSSYFTEKERDEL-----IEE-LNAVKY 332

Query: 334 EYNRKENECNKLKYIID 350
             +  E+ C KLK  ID
Sbjct: 333 RLDASESNCIKLKETID 349

>AGR189W Chr7 (1108696..1112418) [3723 bp, 1240 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YDR227W (SIR4);
            Tandem gene duplication in this genome
          Length = 1240

 Score = 31.2 bits (69), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 32/135 (23%), Positives = 60/135 (44%), Gaps = 29/135 (21%)

Query: 275  YSKQMKQKEYEVQKLKNEIKTLLCMNDNLKADRTLLSQKEKQYFQKCTYIEKYMNHVKEE 334
            Y +Q+ +    ++KLK+E+  L C+   +   + LL+Q  K Y               ++
Sbjct: 905  YEQQIAENNALIKKLKDELDVLKCIP--MSGRKQLLTQLNKMY---------------QK 947

Query: 335  YNRKENECNKLKYIIDKSMKRIEHLERSLQSQSTVQNSFSTATILEEGSKDIDLEDRYHK 394
             + +  E       +DK +  +   E++L    TV         +EE  K ++L D++  
Sbjct: 948  LDERSLELESTSTEVDKKITEVVRREKAL----TVG--------IEEHPKYVELRDKFLT 995

Query: 395  VKEFMEQKLQTSKIH 409
            VK  +E  L+ SK+H
Sbjct: 996  VKGRLESDLKYSKMH 1010

>TDEL0C00960 Chr3 (153572..157240) [3669 bp, 1222 aa] {ON} Anc_8.68
           YFL008W
          Length = 1222

 Score = 30.8 bits (68), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 36/61 (59%)

Query: 307 RTLLSQKEKQYFQKCTYIEKYMNHVKEEYNRKENECNKLKYIIDKSMKRIEHLERSLQSQ 366
           RT +SQ ++      T IE + N +K+EY+ K  E  +   II+ S K++E  + SLQ+Q
Sbjct: 725 RTQISQLKRALEDTNTDIEYHQNLIKQEYDPKIQELEQKLAIINDSRKQLEEEKDSLQTQ 784

Query: 367 S 367
           +
Sbjct: 785 T 785

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.129    0.352 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 52,296,723
Number of extensions: 2451007
Number of successful extensions: 13699
Number of sequences better than 10.0: 1109
Number of HSP's gapped: 13931
Number of HSP's successfully gapped: 1554
Length of query: 465
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 352
Effective length of database: 40,524,141
Effective search space: 14264497632
Effective search space used: 14264497632
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 67 (30.4 bits)