Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_15.3526.65ON28827213610.0
YOR174W (MED4)6.65ON28427210671e-147
Skud_15.3366.65ON28626910361e-142
Suva_8.2276.65ON28727210251e-140
NCAS0F003306.65ON2811997427e-98
ZYRO0D14190g6.65ON2952057185e-94
Kpol_1042.116.65ON2922076777e-88
KNAG0M010206.65ON2791976584e-85
CAGL0L04620g6.65ON2642346556e-85
KAFR0G025006.65ON2892736386e-82
NDAI0J013206.65ON3342116225e-79
SAKL0A08426g6.65ON2992436118e-78
TBLA0G005506.65ON3181996102e-77
AGR270W6.65ON2941755995e-76
Kwal_56.232426.65ON2562435764e-73
TPHA0F025906.65ON3061825762e-72
KLTH0G15444g6.65ON2631695635e-71
Ecym_31246.65ON2742515202e-64
TDEL0G040606.65ON2201645118e-64
KLLA0F20185g6.65ON2851695133e-63
TPHA0M010503.265ON87754760.54
ZYRO0F17908g1.31ON51283731.0
KNAG0E024802.467ON493136721.6
Kpol_1045.68.779ON47859693.4
NCAS0H026405.543ON648167694.0
NCAS0F039603.565ON18696656.5
Suva_13.1992.590ON84086676.6
ZYRO0A06490g5.404ON33463659.2
CAGL0F09229gna 1ON83584659.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_15.352
         (288 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_15.352 Chr15 (614812..615678) [867 bp, 288 aa] {ON} YOR174W...   528   0.0  
YOR174W Chr15 (658747..659601) [855 bp, 284 aa] {ON}  MED4Subuni...   415   e-147
Skud_15.336 Chr15 (607340..608200) [861 bp, 286 aa] {ON} YOR174W...   403   e-142
Suva_8.227 Chr8 (408722..409585) [864 bp, 287 aa] {ON} YOR174W (...   399   e-140
NCAS0F00330 Chr6 (53650..54495) [846 bp, 281 aa] {ON} Anc_6.65 Y...   290   7e-98
ZYRO0D14190g Chr4 (1200325..1201212) [888 bp, 295 aa] {ON} simil...   281   5e-94
Kpol_1042.11 s1042 (21260..22138) [879 bp, 292 aa] {ON} (21260.....   265   7e-88
KNAG0M01020 Chr13 complement(180570..181409) [840 bp, 279 aa] {O...   258   4e-85
CAGL0L04620g Chr12 (533791..534585) [795 bp, 264 aa] {ON} simila...   256   6e-85
KAFR0G02500 Chr7 complement(519629..520498) [870 bp, 289 aa] {ON...   250   6e-82
NDAI0J01320 Chr10 complement(308327..309331) [1005 bp, 334 aa] {...   244   5e-79
SAKL0A08426g Chr1 complement(746101..747000) [900 bp, 299 aa] {O...   239   8e-78
TBLA0G00550 Chr7 (115655..116611) [957 bp, 318 aa] {ON} Anc_6.65...   239   2e-77
AGR270W Chr7 (1244264..1245148) [885 bp, 294 aa] {ON} Syntenic h...   235   5e-76
Kwal_56.23242 s56 (459387..460157) [771 bp, 256 aa] {ON} YOR174W...   226   4e-73
TPHA0F02590 Chr6 (565725..566645) [921 bp, 306 aa] {ON} Anc_6.65...   226   2e-72
KLTH0G15444g Chr7 complement(1353833..1354624) [792 bp, 263 aa] ...   221   5e-71
Ecym_3124 Chr3 complement(232769..233593) [825 bp, 274 aa] {ON} ...   204   2e-64
TDEL0G04060 Chr7 complement(741796..742458) [663 bp, 220 aa] {ON...   201   8e-64
KLLA0F20185g Chr6 complement(1882094..1882951) [858 bp, 285 aa] ...   202   3e-63
TPHA0M01050 Chr13 complement(205757..208390) [2634 bp, 877 aa] {...    34   0.54 
ZYRO0F17908g Chr6 (1483368..1484906) [1539 bp, 512 aa] {ON} simi...    33   1.0  
KNAG0E02480 Chr5 (492142..493623) [1482 bp, 493 aa] {ON} Anc_2.4...    32   1.6  
Kpol_1045.6 s1045 (8627..10063) [1437 bp, 478 aa] {ON} (8627..10...    31   3.4  
NCAS0H02640 Chr8 complement(521008..522954) [1947 bp, 648 aa] {O...    31   4.0  
NCAS0F03960 Chr6 (795002..795562) [561 bp, 186 aa] {ON} Anc_3.56...    30   6.5  
Suva_13.199 Chr13 complement(322643..325165) [2523 bp, 840 aa] {...    30   6.6  
ZYRO0A06490g Chr1 (518601..518707,518772..519669) [1005 bp, 334 ...    30   9.2  
CAGL0F09229g Chr6 complement(908186..910693) [2508 bp, 835 aa] {...    30   9.9  

>Smik_15.352 Chr15 (614812..615678) [867 bp, 288 aa] {ON} YOR174W
           (REAL)
          Length = 288

 Score =  528 bits (1361), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/272 (95%), Positives = 261/272 (95%)

Query: 1   MSVQDTKAVDFSMGHMKSSSVSLVVEATSNMNSEDKLSKVQLYEDLCRYEDTLKKLVESV 60
           MSVQDTKAVDFSMGHMKSSSVSLVVEATSNMNSEDKLSKVQLYEDLCRYEDTLKKLVESV
Sbjct: 1   MSVQDTKAVDFSMGHMKSSSVSLVVEATSNMNSEDKLSKVQLYEDLCRYEDTLKKLVESV 60

Query: 61  DRFKPDIDVARDLIKIDESLFNNVDLLSEYDNIDRNLRKIDKDSEELDSKTKRILEIMNE 120
           DRFKPDIDVARDLIKIDESLFNNVDLLSEYDNIDRNLRKIDKDSEELDSKTKRILEIMNE
Sbjct: 61  DRFKPDIDVARDLIKIDESLFNNVDLLSEYDNIDRNLRKIDKDSEELDSKTKRILEIMNE 120

Query: 121 CHDELGALPMLEQVEFEKNTILQQRSKINSTALLDYATKLSKFTRIPPTFDKGSIGPNNF 180
           CHDELGALPMLEQVEFEKNTILQQRSKINSTALLDYATKLSKFTRIPPTFDKGSIGPNNF
Sbjct: 121 CHDELGALPMLEQVEFEKNTILQQRSKINSTALLDYATKLSKFTRIPPTFDKGSIGPNNF 180

Query: 181 IWPAEDALRRGMLAMASLHSKELTRVPGXXXXXXXXXXXVLVSSPSQNGLDNEHKTAKEE 240
           IWPAEDALRRGMLAMASLHSKELTRVPG           VLVSSPSQNGLDNEHKTAKEE
Sbjct: 181 IWPAEDALRRGMLAMASLHSKELTRVPGEEAEEAAETEEVLVSSPSQNGLDNEHKTAKEE 240

Query: 241 VPSTDSFIFNGTANKNSEEVGDAKDKEEEGNN 272
           VPSTDSFIFNGTANKNSEEVGDAKDKEEEGNN
Sbjct: 241 VPSTDSFIFNGTANKNSEEVGDAKDKEEEGNN 272

>YOR174W Chr15 (658747..659601) [855 bp, 284 aa] {ON}  MED4Subunit
           of the RNA polymerase II mediator complex; associates
           with core polymerase subunits to form the RNA polymerase
           II holoenzyme; essential for transcriptional regulation
          Length = 284

 Score =  415 bits (1067), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 204/272 (75%), Positives = 227/272 (83%), Gaps = 4/272 (1%)

Query: 1   MSVQDTKAVDFSMGHMKSSSVSLVVEATSNMNSEDKLSKVQLYEDLCRYEDTLKKLVESV 60
           MSVQDTKAV+FSMGH++SSSVSLV EATSN NSEDKLSKVQLYEDLCRYEDTL KLVESV
Sbjct: 1   MSVQDTKAVEFSMGHIRSSSVSLVAEATSNTNSEDKLSKVQLYEDLCRYEDTLSKLVESV 60

Query: 61  DRFKPDIDVARDLIKIDESLFNNVDLLSEYDNIDRNLRKIDKDSEELDSKTKRILEIMNE 120
           DRFKP++D+A+DLI+ DE+LF NV LL+EYDNI RNL+KIDKDSEELDSKT++ILEI+NE
Sbjct: 61  DRFKPNLDIAKDLIRTDEALFENVKLLAEYDNIYRNLQKIDKDSEELDSKTRKILEILNE 120

Query: 121 CHDELGALPMLEQVEFEKNTILQQRSKINSTALLDYATKLSKFTRIPPTFDKGSIGPNNF 180
           CHDEL ALPMLEQVEFEKNTILQQRSKINST LLDYATKLSKFT+IPPTFDKG++GPNNF
Sbjct: 121 CHDELKALPMLEQVEFEKNTILQQRSKINSTELLDYATKLSKFTKIPPTFDKGAVGPNNF 180

Query: 181 IWPAEDALRRGMLAMASLHSKELTRVPGXXXXXXXXXXXVLVSSPSQNGLDNEHKTAKEE 240
           IWPAEDALRRGMLAMASLHSKELTR+PG               S  Q G        KE 
Sbjct: 181 IWPAEDALRRGMLAMASLHSKELTRIPGEEVEETEVPTVPPSQSEEQKG----QMAKKEG 236

Query: 241 VPSTDSFIFNGTANKNSEEVGDAKDKEEEGNN 272
            P TDSFIF+GTA +  +E  + KDKE+E NN
Sbjct: 237 TPKTDSFIFDGTAKEVGDEADNTKDKEKEENN 268

>Skud_15.336 Chr15 (607340..608200) [861 bp, 286 aa] {ON} YOR174W
           (REAL)
          Length = 286

 Score =  403 bits (1036), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 201/269 (74%), Positives = 223/269 (82%), Gaps = 3/269 (1%)

Query: 1   MSVQDTKAVDFSMGHMKSSSVSLVVEATSNMNSEDKLSKVQLYEDLCRYEDTLKKLVESV 60
           MSVQ+TKAV+F MGH+KSSSVSLV EA SNMNSEDKLSKVQLYEDLCRYE  L KLVESV
Sbjct: 1   MSVQNTKAVEFPMGHIKSSSVSLVAEAASNMNSEDKLSKVQLYEDLCRYEGVLSKLVESV 60

Query: 61  DRFKPDIDVARDLIKIDESLFNNVDLLSEYDNIDRNLRKIDKDSEELDSKTKRILEIMNE 120
           DRFKPD+DVARDLI  DESLFNNV LL++YDNIDRNL+KIDKDSEELDSK+++ILEI+NE
Sbjct: 61  DRFKPDLDVARDLISADESLFNNVKLLADYDNIDRNLQKIDKDSEELDSKSRKILEILNE 120

Query: 121 CHDELGALPMLEQVEFEKNTILQQRSKINSTALLDYATKLSKFTRIPPTFDKGSIGPNNF 180
           CHDEL  LP LEQVEFEKNTILQQRSKINSTALLDYATKLSKFT+IPPTFDKG++GPNNF
Sbjct: 121 CHDELSGLPTLEQVEFEKNTILQQRSKINSTALLDYATKLSKFTKIPPTFDKGTVGPNNF 180

Query: 181 IWPAEDALRRGMLAMASLHSKELTRVPGXXXXXXXXXXXVLVSSPSQNGLDNEHKTAKEE 240
           IWPAEDALRRGMLAMASLHSKELTRVPG             +S P   G   E +   E+
Sbjct: 181 IWPAEDALRRGMLAMASLHSKELTRVPGEDEQETEEVPTAPLSQP---GQQEEQEAQNED 237

Query: 241 VPSTDSFIFNGTANKNSEEVGDAKDKEEE 269
           +   D+FIF GT +K++E     KDKEEE
Sbjct: 238 ISDKDTFIFKGTPHKDAEHTPGIKDKEEE 266

>Suva_8.227 Chr8 (408722..409585) [864 bp, 287 aa] {ON} YOR174W
           (REAL)
          Length = 287

 Score =  399 bits (1025), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 197/272 (72%), Positives = 226/272 (83%), Gaps = 1/272 (0%)

Query: 1   MSVQDTKAVDFSMGHMKSSSVSLVVEATSNMNSEDKLSKVQLYEDLCRYEDTLKKLVESV 60
           MSVQDTKAV+F M  ++SSSVSLV EATS+MNSE K SKVQLYEDLCRYED L KLVESV
Sbjct: 1   MSVQDTKAVEFPMNQIRSSSVSLVAEATSSMNSEHKSSKVQLYEDLCRYEDILGKLVESV 60

Query: 61  DRFKPDIDVARDLIKIDESLFNNVDLLSEYDNIDRNLRKIDKDSEELDSKTKRILEIMNE 120
           DRFKP++++A+DLIK DESLFNNV LL++YD ID NLRKIDKDSEELDSKT++ILEI+NE
Sbjct: 61  DRFKPNLEIAKDLIKTDESLFNNVKLLADYDKIDLNLRKIDKDSEELDSKTRKILEILNE 120

Query: 121 CHDELGALPMLEQVEFEKNTILQQRSKINSTALLDYATKLSKFTRIPPTFDKGSIGPNNF 180
           CHDEL ALPMLEQVEFEK TILQQRSKINSTALLDYATKLSKFTRIPPTFDKG++GPNNF
Sbjct: 121 CHDELSALPMLEQVEFEKKTILQQRSKINSTALLDYATKLSKFTRIPPTFDKGTVGPNNF 180

Query: 181 IWPAEDALRRGMLAMASLHSKELTRVPGXXXXXXXXXXXVLVSSPSQNGLDNEHKTAKEE 240
           IWPAEDALRRGMLAMASLHSKELTR+PG             +S P +   ++   + +  
Sbjct: 181 IWPAEDALRRGMLAMASLHSKELTRIPGEEEQETEEVPTDTLSQPQKEKKESSENSPQNS 240

Query: 241 VPSTDSFIFNGTANKNSEEVGDAKDKEEEGNN 272
            P+ DSFIFNG ANK++++  + KDK EE NN
Sbjct: 241 -PTKDSFIFNGIANKDTDQADNDKDKIEEDNN 271

>NCAS0F00330 Chr6 (53650..54495) [846 bp, 281 aa] {ON} Anc_6.65
           YOR174W
          Length = 281

 Score =  290 bits (742), Expect = 7e-98,   Method: Compositional matrix adjust.
 Identities = 137/199 (68%), Positives = 163/199 (81%), Gaps = 2/199 (1%)

Query: 12  SMGHMKSSSVSLVVEATSNM--NSEDKLSKVQLYEDLCRYEDTLKKLVESVDRFKPDIDV 69
           SMGH++SSSVSL+ E   N   N ED +SKVQ+Y DLC YE  L  LV SVD+FKPD++ 
Sbjct: 14  SMGHIRSSSVSLLAEVNPNSISNDEDDISKVQIYSDLCSYEQKLANLVNSVDKFKPDMNA 73

Query: 70  ARDLIKIDESLFNNVDLLSEYDNIDRNLRKIDKDSEELDSKTKRILEIMNECHDELGALP 129
           AR+LI++D  LF  +D   EYD ID +L+K++ +S ELD++TK IL I+NECHDEL ALP
Sbjct: 74  ARELIEVDRHLFQTLDSFEEYDKIDNSLKKLNAESIELDARTKEILGILNECHDELNALP 133

Query: 130 MLEQVEFEKNTILQQRSKINSTALLDYATKLSKFTRIPPTFDKGSIGPNNFIWPAEDALR 189
           ML+QVEFE  TILQQRSKINS+ LLDYATKLSKFT+IPPTFDKGSIGPNNFIWPAEDALR
Sbjct: 134 MLKQVEFEMETILQQRSKINSSVLLDYATKLSKFTKIPPTFDKGSIGPNNFIWPAEDALR 193

Query: 190 RGMLAMASLHSKELTRVPG 208
           RGMLA+ASLH+ ELT+ PG
Sbjct: 194 RGMLALASLHADELTKAPG 212

>ZYRO0D14190g Chr4 (1200325..1201212) [888 bp, 295 aa] {ON} similar
           to uniprot|Q12343 Saccharomyces cerevisiae YOR174W MED4
           Member of RNA Polymerase II transcriptional regulation
           mediator Stoichiometric member of mediator complex
          Length = 295

 Score =  281 bits (718), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 130/205 (63%), Positives = 170/205 (82%), Gaps = 1/205 (0%)

Query: 5   DTKAVDFSMGHMKSSSVSLVVEA-TSNMNSEDKLSKVQLYEDLCRYEDTLKKLVESVDRF 63
           DT A   S GH++SSS SL+ +A +S  N++D+LSKVQ+Y DL +YE+ L  LVESVD F
Sbjct: 10  DTPANILSRGHVRSSSTSLISDAMSSGNNNDDELSKVQIYADLTQYEEKLAALVESVDNF 69

Query: 64  KPDIDVARDLIKIDESLFNNVDLLSEYDNIDRNLRKIDKDSEELDSKTKRILEIMNECHD 123
           KPD+ +  +LI++D+SL+ ++D  +EYD ID  L ++DK+S ELD KTK +LE ++EC++
Sbjct: 70  KPDVKIVHELIEVDKSLYKSLDSFAEYDRIDSELNRLDKESNELDRKTKEVLETLSECYE 129

Query: 124 ELGALPMLEQVEFEKNTILQQRSKINSTALLDYATKLSKFTRIPPTFDKGSIGPNNFIWP 183
            L  LPMLEQVEFEK +IL+QRSK+NS+ LL+YATKLSKFT+IPPTFDKG+IGPNNF+WP
Sbjct: 130 MLNGLPMLEQVEFEKQSILKQRSKVNSSVLLNYATKLSKFTKIPPTFDKGTIGPNNFVWP 189

Query: 184 AEDALRRGMLAMASLHSKELTRVPG 208
           AEDALRRGMLA+ASLHSKE+TR+PG
Sbjct: 190 AEDALRRGMLAIASLHSKEMTRIPG 214

>Kpol_1042.11 s1042 (21260..22138) [879 bp, 292 aa] {ON}
           (21260..22138) [879 nt, 293 aa]
          Length = 292

 Score =  265 bits (677), Expect = 7e-88,   Method: Compositional matrix adjust.
 Identities = 133/207 (64%), Positives = 161/207 (77%), Gaps = 12/207 (5%)

Query: 13  MGHMKS-SSVSLVVEATSNM-----------NSEDKLSKVQLYEDLCRYEDTLKKLVESV 60
           MGH+KS SSVSL+ + T+++           N  + LSKVQ+Y D+  YE+TL KLVESV
Sbjct: 6   MGHVKSISSVSLMTDNTNSISTNSLNMIDYNNESNDLSKVQIYNDISEYENTLFKLVESV 65

Query: 61  DRFKPDIDVARDLIKIDESLFNNVDLLSEYDNIDRNLRKIDKDSEELDSKTKRILEIMNE 120
           D+FKPD+ +A  LI +DE LF ++D   EYD I   L + DK++ ELD+KTK IL  +NE
Sbjct: 66  DKFKPDVKLAHQLIDVDERLFKSLDSFVEYDKISTKLEECDKEAAELDTKTKEILGTLNE 125

Query: 121 CHDELGALPMLEQVEFEKNTILQQRSKINSTALLDYATKLSKFTRIPPTFDKGSIGPNNF 180
           CH  L +LPMLEQVEFEK+ IL+QRSKINS  LLDYATKLSKFT+IPPTF+KGSIGPNNF
Sbjct: 126 CHGLLNSLPMLEQVEFEKDIILKQRSKINSKLLLDYATKLSKFTKIPPTFNKGSIGPNNF 185

Query: 181 IWPAEDALRRGMLAMASLHSKELTRVP 207
           IWPAEDALRRGMLAMASLHSKELT++P
Sbjct: 186 IWPAEDALRRGMLAMASLHSKELTKLP 212

>KNAG0M01020 Chr13 complement(180570..181409) [840 bp, 279 aa] {ON}
           Anc_6.65 YOR174W
          Length = 279

 Score =  258 bits (658), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 123/197 (62%), Positives = 151/197 (76%)

Query: 12  SMGHMKSSSVSLVVEATSNMNSEDKLSKVQLYEDLCRYEDTLKKLVESVDRFKPDIDVAR 71
           S GH ++SSVSL+ E T      + L KV++Y  +  YEDTL  LVESVD +KPD+ VA+
Sbjct: 15  SAGHKRASSVSLLQEGTDAAALAEDLKKVRIYSGIVEYEDTLAALVESVDSYKPDMAVAQ 74

Query: 72  DLIKIDESLFNNVDLLSEYDNIDRNLRKIDKDSEELDSKTKRILEIMNECHDELGALPML 131
            L+  D+ LF ++D   EYD I   L ++   S  LD+KT+ ILE +NECHDEL  LP L
Sbjct: 75  RLVDADKELFASLDKFKEYDEISTRLGELKGKSTALDTKTRDILEKLNECHDELNKLPYL 134

Query: 132 EQVEFEKNTILQQRSKINSTALLDYATKLSKFTRIPPTFDKGSIGPNNFIWPAEDALRRG 191
           EQV+FE +TIL+QR KINS+ LLDYATKLSKFTRIPPTFDKGSIGPNNFIWPAEDALR+G
Sbjct: 135 EQVQFEMDTILEQREKINSSELLDYATKLSKFTRIPPTFDKGSIGPNNFIWPAEDALRKG 194

Query: 192 MLAMASLHSKELTRVPG 208
           MLA+A+LHS+ELTR+PG
Sbjct: 195 MLAIAALHSRELTRIPG 211

>CAGL0L04620g Chr12 (533791..534585) [795 bp, 264 aa] {ON} similar
           to uniprot|Q12343 Saccharomyces cerevisiae YOR174w MED4
          Length = 264

 Score =  256 bits (655), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 124/234 (52%), Positives = 166/234 (70%)

Query: 21  VSLVVEATSNMNSEDKLSKVQLYEDLCRYEDTLKKLVESVDRFKPDIDVARDLIKIDESL 80
           +SLV E+ S   SE +L KVQLY DLC YE+ L KLV+SVD FKP +++ + LI+ D+ L
Sbjct: 1   MSLVAESNSGTISEQELDKVQLYSDLCLYEEALTKLVDSVDNFKPQLEIGKQLIEADKKL 60

Query: 81  FNNVDLLSEYDNIDRNLRKIDKDSEELDSKTKRILEIMNECHDELGALPMLEQVEFEKNT 140
           ++ +DLL +YD++   LR +D +  ++D +TK IL I+NECHD+L ALP+LE+VEFEK  
Sbjct: 61  YSTLDLLPQYDSVFTRLRTLDDEISKVDQQTKNILSILNECHDDLNALPLLEEVEFEKKM 120

Query: 141 ILQQRSKINSTALLDYATKLSKFTRIPPTFDKGSIGPNNFIWPAEDALRRGMLAMASLHS 200
           IL+QR KI S  LL+YATKL+KFT+IPPTFDKG+IGPNNFIWPAEDALR+GMLAMASLH 
Sbjct: 121 ILKQREKIKSNVLLEYATKLAKFTKIPPTFDKGTIGPNNFIWPAEDALRKGMLAMASLHG 180

Query: 201 KELTRVPGXXXXXXXXXXXVLVSSPSQNGLDNEHKTAKEEVPSTDSFIFNGTAN 254
           KELT++PG               +  ++    E +  +++    DSF+F   AN
Sbjct: 181 KELTKLPGQEDGEEDGSTANEDKNIVKDAEGAEGEIRQDDKKEDDSFVFGANAN 234

>KAFR0G02500 Chr7 complement(519629..520498) [870 bp, 289 aa] {ON}
           Anc_6.65 YOR174W
          Length = 289

 Score =  250 bits (638), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 130/273 (47%), Positives = 178/273 (65%), Gaps = 11/273 (4%)

Query: 10  DFSMGHMKSSSVSLVVE--ATSNMNSED---------KLSKVQLYEDLCRYEDTLKKLVE 58
           D ++GH KSSS+SL+ E  +TS  NS +          ++KV +Y DL +YE+TL +L++
Sbjct: 3   DLTLGHRKSSSLSLLGEPPSTSITNSNNIDSASGASPAITKVGIYSDLSQYEETLSRLIQ 62

Query: 59  SVDRFKPDIDVARDLIKIDESLFNNVDLLSEYDNIDRNLRKIDKDSEELDSKTKRILEIM 118
           S+D +KPD  +A++LI ID  LFN++D   +YD I   L+  +K  +E   KTK ILE +
Sbjct: 63  SIDTYKPDKKIAQELIDIDSKLFNSLDSFVQYDRISSRLKDFEKQEKESTLKTKEILETL 122

Query: 119 NECHDELGALPMLEQVEFEKNTILQQRSKINSTALLDYATKLSKFTRIPPTFDKGSIGPN 178
           NECH+ L  LP ++QV FE NT+L+QR KINS+ LLDYATKLSKFT+IPPTFDKGSIGPN
Sbjct: 123 NECHNALNLLPTVDQVHFEMNTMLEQRKKINSSVLLDYATKLSKFTKIPPTFDKGSIGPN 182

Query: 179 NFIWPAEDALRRGMLAMASLHSKELTRVPGXXXXXXXXXXXVLVSSPSQNGLDNEHKTAK 238
           NF+WPAEDALRRGMLA+A+ H+ ELT++ G            L    S +  +      K
Sbjct: 183 NFVWPAEDALRRGMLALAASHTDELTKIAGVEMSLSDDNSIALDEIKSVDAGEGPIPEKK 242

Query: 239 EEVPSTDSFIFNGTANKNSEEVGDAKDKEEEGN 271
           +      S+IF G + KN+E   + ++KEE  N
Sbjct: 243 DSSSRRGSYIFAGQSGKNAEHKNNEENKEEADN 275

>NDAI0J01320 Chr10 complement(308327..309331) [1005 bp, 334 aa] {ON}
           Anc_6.65 YOR174W
          Length = 334

 Score =  244 bits (622), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 114/211 (54%), Positives = 160/211 (75%), Gaps = 14/211 (6%)

Query: 12  SMGHMKSSSVSLVVEATSNM--------------NSEDKLSKVQLYEDLCRYEDTLKKLV 57
           S  H+++SSVSL+ EA +N               +S+D LS+V++Y+D+  YE  L +L+
Sbjct: 37  SANHLRASSVSLLAEAVTNGTPSSSEFNRSYDNDSSKDVLSEVRIYDDIITYEKALSRLI 96

Query: 58  ESVDRFKPDIDVARDLIKIDESLFNNVDLLSEYDNIDRNLRKIDKDSEELDSKTKRILEI 117
           +SVD+FKP++++A++LI+ D+SLF+ ++   +YD ID +L+ ++  + ++D  T+  L+ 
Sbjct: 97  DSVDKFKPNLNIAQELIQADKSLFDTLNSFIQYDEIDLHLKALETKASKIDELTQSTLQT 156

Query: 118 MNECHDELGALPMLEQVEFEKNTILQQRSKINSTALLDYATKLSKFTRIPPTFDKGSIGP 177
           +NECHD+L  LP L Q+EFE NTIL QR+KINST LLDYATKLSKFT+IPPTFDKGSIGP
Sbjct: 157 LNECHDDLNKLPTLPQIEFELNTILNQRTKINSTILLDYATKLSKFTKIPPTFDKGSIGP 216

Query: 178 NNFIWPAEDALRRGMLAMASLHSKELTRVPG 208
           NNFIWPAED+LRRGMLAMASL + +LT +PG
Sbjct: 217 NNFIWPAEDSLRRGMLAMASLKADQLTYIPG 247

>SAKL0A08426g Chr1 complement(746101..747000) [900 bp, 299 aa] {ON}
           similar to gnl|GLV|KLLA0F20185g Kluyveromyces lactis
           KLLA0F20185g and weakly similar to YOR174W
           uniprot|Q12343 Saccharomyces cerevisiae YOR174W MED4
           Member of RNA Polymerase II transcriptional regulation
           mediator Stoichiometric member of mediator complex
          Length = 299

 Score =  239 bits (611), Expect = 8e-78,   Method: Compositional matrix adjust.
 Identities = 123/243 (50%), Positives = 163/243 (67%), Gaps = 14/243 (5%)

Query: 34  EDKLSKVQLYEDLCRYEDTLKKLVESVDRFKPDIDVARDLIKIDESLFNNVDLLSEYDNI 93
           +D LS+V++Y D+C YE+TL KLV SVD+FKPD+ VA++LI+ D+ LF  ++   +YD I
Sbjct: 41  QDLLSRVEVYADICEYEETLGKLVSSVDKFKPDLKVAQELIETDKKLFKALEEFPKYDKI 100

Query: 94  DRNLRKIDKDSEELDSKTKRILEIMNECHDELGALPMLEQVEFEKNTILQQRSKINSTAL 153
           D  L  ++K S+E+D KT +ILE++N CH +L +LP LEQV  E++T+L+QR KI S  L
Sbjct: 101 DGRLNDLEKQSQEVDKKTSKILEVLNGCHAQLNSLPALEQVLLERDTMLKQREKIYSGVL 160

Query: 154 LDYATKLSKFTRIPPTFDKGSIGPNNFIWPAEDALRRGMLAMASLHSKELTRVPGX---- 209
           LDYA KL+KFTR+PPTFDKG +GPNNFIWPAEDA+RRGMLAMASL SKELTR+PG     
Sbjct: 161 LDYAMKLAKFTRVPPTFDKGMVGPNNFIWPAEDAMRRGMLAMASLKSKELTRIPGQENEE 220

Query: 210 ----XXXXXXXXXXVLVSSPSQNG--LDNEHKT--AKEEVPSTDSFIFNG--TANKNSEE 259
                            + P       +NE +T  A+EE+P   SF F    +  K+ EE
Sbjct: 221 YEESEENRENEENGEKETKPETKSTLTENESETVAAREEIPRRSSFEFTADDSHKKDQEE 280

Query: 260 VGD 262
             D
Sbjct: 281 SLD 283

>TBLA0G00550 Chr7 (115655..116611) [957 bp, 318 aa] {ON} Anc_6.65
           YOR174W
          Length = 318

 Score =  239 bits (610), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 115/199 (57%), Positives = 153/199 (76%), Gaps = 6/199 (3%)

Query: 14  GHMKSSSVSL----VVEATSNMNSEDKLSKVQLYEDLCRYEDTLKKLVESVDRFKPDIDV 69
           GH K+ S S+    V++  ++ N  D+LSK+Q Y DL +YE+TL KL  SVD++KPD+  
Sbjct: 12  GHHKTLSTSISEGDVLQDNNDKN--DELSKIQTYNDLIQYEETLSKLSSSVDKYKPDLQY 69

Query: 70  ARDLIKIDESLFNNVDLLSEYDNIDRNLRKIDKDSEELDSKTKRILEIMNECHDELGALP 129
           A DLI ID  L++ +D   +YD I   L+K++ D++ LD KTK +L+ +N+CH+ L  LP
Sbjct: 70  AYDLIDIDRKLYSTLDSFVKYDEISTKLKKLEIDTKALDEKTKSVLDSLNDCHELLNTLP 129

Query: 130 MLEQVEFEKNTILQQRSKINSTALLDYATKLSKFTRIPPTFDKGSIGPNNFIWPAEDALR 189
           MLEQVEFEKNT+L+QR KINS  LLDYATKL+KFT+IPPTF+K ++GPNNFIWPAEDALR
Sbjct: 130 MLEQVEFEKNTMLKQREKINSKVLLDYATKLAKFTKIPPTFNKNTLGPNNFIWPAEDALR 189

Query: 190 RGMLAMASLHSKELTRVPG 208
           RGMLA+AS H++ELT +PG
Sbjct: 190 RGMLAVASAHTEELTALPG 208

>AGR270W Chr7 (1244264..1245148) [885 bp, 294 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR174W (MED4)
          Length = 294

 Score =  235 bits (599), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 102/175 (58%), Positives = 148/175 (84%)

Query: 34  EDKLSKVQLYEDLCRYEDTLKKLVESVDRFKPDIDVARDLIKIDESLFNNVDLLSEYDNI 93
           ++KL  V +YEDLC+YE++L++LV SVD+F+PD++ A++LI+ID  L++N+  L +YD I
Sbjct: 44  QNKLHSVAIYEDLCQYEESLQRLVTSVDKFQPDLEAAQELIEIDSKLYSNLAQLPKYDLI 103

Query: 94  DRNLRKIDKDSEELDSKTKRILEIMNECHDELGALPMLEQVEFEKNTILQQRSKINSTAL 153
           D  L+K++++S+++D +T +IL I+ EC+++L +LPM+EQVEFE  T+ +Q+ K+NS+ L
Sbjct: 104 DSQLKKLEEESKDIDERTAKILGILGECYNDLNSLPMVEQVEFEMATMKKQKDKVNSSVL 163

Query: 154 LDYATKLSKFTRIPPTFDKGSIGPNNFIWPAEDALRRGMLAMASLHSKELTRVPG 208
           L+YA KLSKFTR+PPTF+K +IGPNNFIWPAEDA+RRGMLAMASL SKELT +PG
Sbjct: 164 LEYAMKLSKFTRVPPTFNKDAIGPNNFIWPAEDAIRRGMLAMASLKSKELTSLPG 218

>Kwal_56.23242 s56 (459387..460157) [771 bp, 256 aa] {ON} YOR174W
           (MED4) - Stoichiometric member of mediator complex
           [contig 183] FULL
          Length = 256

 Score =  226 bits (576), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 113/243 (46%), Positives = 153/243 (62%), Gaps = 7/243 (2%)

Query: 16  MKSSSVSLVVEATSNMNSEDKLSKVQLYEDLCRYEDTLKKLVESVDRFKPDIDVARDLIK 75
           M +SSV    E     N+E +LSK Q+Y D+C +E+TL KLV SVD+F PD+ +A  LI+
Sbjct: 1   MSTSSVHKNPEVERPTNAESRLSKAQIYSDICEFEETLGKLVASVDKFNPDLKIAESLIE 60

Query: 76  IDESLFNNVDLLSEYDNIDRNLRKIDKDSEELDSKTKRILEIMNECHDELGALPMLEQVE 135
           +D+ L   ++ L  YD ID   +++D+   E D +  RILE + EC  +L ALPMLEQVE
Sbjct: 61  VDKRLSKTLESLPRYDEIDLRAKELDQKHLETDERMVRILETLTECSTDLNALPMLEQVE 120

Query: 136 FEKNTILQQRSKINSTALLDYATKLSKFTRIPPTFDKGSIGPNNFIWPAEDALRRGMLAM 195
           FE+ T+L+QR K+ +  LLDYA KL+KFT +PPTFDKG++GPNNF+WPAEDA+RRGMLA+
Sbjct: 121 FERQTMLKQREKVFTNVLLDYAMKLAKFTHVPPTFDKGAVGPNNFVWPAEDAMRRGMLAI 180

Query: 196 ASLHSKELTRVPGXXXXXXXXXXXVLVSSPSQNGLDNEHKTAKEEVPSTDSFIFNGTANK 255
           ASL + E  + P                S  Q  ++       E +   DSF FNGT  K
Sbjct: 181 ASLQASEDAKKPETGAAQTAEETTKQPQSSPQLKVE-------EPMQRRDSFEFNGTGTK 233

Query: 256 NSE 258
           + E
Sbjct: 234 SPE 236

>TPHA0F02590 Chr6 (565725..566645) [921 bp, 306 aa] {ON} Anc_6.65
           YOR174W
          Length = 306

 Score =  226 bits (576), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 105/182 (57%), Positives = 142/182 (78%), Gaps = 2/182 (1%)

Query: 29  SNMNSE--DKLSKVQLYEDLCRYEDTLKKLVESVDRFKPDIDVARDLIKIDESLFNNVDL 86
           SNMN+   D L+ V +Y D+  YEDTL KLV S+D F+PD++VA+ LI++D+ L+ N+  
Sbjct: 47  SNMNTAAVDSLANVAIYNDIKNYEDTLIKLVSSIDNFRPDVEVAKTLIEVDKRLYKNLGS 106

Query: 87  LSEYDNIDRNLRKIDKDSEELDSKTKRILEIMNECHDELGALPMLEQVEFEKNTILQQRS 146
             EYD ID  + KI  DSE+LD +TK IL+I+N+  + L +LPMLE++ FE++ + +++ 
Sbjct: 107 FKEYDEIDTKISKIKDDSEKLDLQTKHILDILNDSRNMLNSLPMLEEIYFERDVMHEKQK 166

Query: 147 KINSTALLDYATKLSKFTRIPPTFDKGSIGPNNFIWPAEDALRRGMLAMASLHSKELTRV 206
           KINS  LLDYATK+SKFT+IPPTF+KGSIGPNNFIWPAEDALRRGMLA+AS+H  ELT++
Sbjct: 167 KINSKILLDYATKISKFTKIPPTFNKGSIGPNNFIWPAEDALRRGMLAVASIHRSELTKL 226

Query: 207 PG 208
           P 
Sbjct: 227 PN 228

>KLTH0G15444g Chr7 complement(1353833..1354624) [792 bp, 263 aa]
           {ON} some similarities with uniprot|Q12343 Saccharomyces
           cerevisiae YOR174W MED4 Member of RNA Polymerase II
           transcriptional regulation mediator Stoichiometric
           member of mediator complex
          Length = 263

 Score =  221 bits (563), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 98/169 (57%), Positives = 133/169 (78%)

Query: 34  EDKLSKVQLYEDLCRYEDTLKKLVESVDRFKPDIDVARDLIKIDESLFNNVDLLSEYDNI 93
           E+ LSK+Q+Y D+C +EDTL KLV SVDRF PD+++AR LI+ D+ L+ +++ L +YD I
Sbjct: 19  ENPLSKLQVYNDICEFEDTLGKLVASVDRFNPDLELARALIEADKQLYKSLECLPKYDEI 78

Query: 94  DRNLRKIDKDSEELDSKTKRILEIMNECHDELGALPMLEQVEFEKNTILQQRSKINSTAL 153
           D   + +D++  + D KT RILE + EC  +L ALPMLEQVEFE+ T+L+QR K+ +  L
Sbjct: 79  DTRAKTLDEEHRDTDEKTIRILETLTECGSDLNALPMLEQVEFERETMLKQREKVFTDVL 138

Query: 154 LDYATKLSKFTRIPPTFDKGSIGPNNFIWPAEDALRRGMLAMASLHSKE 202
           LDYA KL+KFT +PPTFDKG++GPNNF+WPAEDA+RRGMLA+ASL + E
Sbjct: 139 LDYAMKLAKFTHVPPTFDKGTVGPNNFVWPAEDAMRRGMLAIASLRASE 187

>Ecym_3124 Chr3 complement(232769..233593) [825 bp, 274 aa] {ON}
           similar to Ashbya gossypii AGR270W
          Length = 274

 Score =  204 bits (520), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 114/251 (45%), Positives = 162/251 (64%), Gaps = 18/251 (7%)

Query: 29  SNMNSEDKLSKVQLYEDLCRYEDTLKKLVESVDRFKPDIDVARDLIKIDESLFNNVDLLS 88
           SN +  + + +V LY+DLC++E+ L+KLV SVD+F PD+  A+DLI  D  L++ ++ L 
Sbjct: 14  SNNDELNHVQQVTLYKDLCQFEEDLQKLVVSVDKFSPDLQAAQDLINSDLKLYSTLEQLP 73

Query: 89  EYDNIDRNLRKIDKDSEELDSKTKRILEIMNECHDELGALPMLEQVEFEKNTILQQRSKI 148
            YD+ID  L+++D +S+E+D +T +IL I+++C++ L  LPM+EQVEFE   + +Q+ KI
Sbjct: 74  LYDSIDIQLKQLDNESQEIDERTGKILSILDKCYNNLNKLPMVEQVEFEMKMMKKQKEKI 133

Query: 149 NSTALLDYATKLSKFTRIPPTFDKGSIGPNNFIWPAEDALRRGMLAMASLHSKELTRVPG 208
            S  LL+YA KL+KFTR+PPTF+K +IGPNNFIWPAEDA+RRGMLAMASL S+ELTR+P 
Sbjct: 134 KSGVLLEYAMKLAKFTRVPPTFNKDAIGPNNFIWPAEDAIRRGMLAMASLKSEELTRIPV 193

Query: 209 XXXXXXXXXXXVLVSSPSQNGLDNEH----KTAKEEVPS------TDSFIFNGTA-NKNS 257
                           P Q G   E      T   + PS      ++SF F G A N+ S
Sbjct: 194 ELNSEEP-------QEPPQKGQSQEEDEVTPTHSSDTPSSKPDSKSESFEFTGKAKNQQS 246

Query: 258 EEVGDAKDKEE 268
            +  +    EE
Sbjct: 247 TQYSETGAHEE 257

>TDEL0G04060 Chr7 complement(741796..742458) [663 bp, 220 aa] {ON}
           Anc_6.65 YOR174W
          Length = 220

 Score =  201 bits (511), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 88/164 (53%), Positives = 126/164 (76%), Gaps = 3/164 (1%)

Query: 41  QLYEDLCRYEDTLKKLVESVDRFKPDIDVARDLIKIDESLFNNVDLLSEYDNIDRNLRKI 100
           Q+Y DL RYE+ L +LVESVD+F+PD+  AR+L++ D +L  ++D    YD +D+ L+++
Sbjct: 3   QVYGDLTRYEEALGRLVESVDQFRPDLSCARELVEADRALGKSLDKFGLYDEVDKELQRL 62

Query: 101 DKDSEELDSKTKRILEIMNECHDELGALPMLEQVEFEKNTILQQRSKINSTALLDYATKL 160
           D++SE L+  T R LE ++EC+  L ALPMLEQV+FE+  +L+QR ++NS  LL+YATKL
Sbjct: 63  DRESERLNRHTARTLETLDECYRALSALPMLEQVKFEQRKVLEQRGRVNSAVLLEYATKL 122

Query: 161 SKFTRIPPTFDKGSIGPNNFIWPAEDALRRGMLAMASLHSKELT 204
           SKFT+ P      ++GPNNF+WPAEDALRRG LA+A+LHS+E+T
Sbjct: 123 SKFTKAPAGV---AVGPNNFVWPAEDALRRGQLAVAALHSEEIT 163

>KLLA0F20185g Chr6 complement(1882094..1882951) [858 bp, 285 aa]
           {ON} similar to uniprot|Q12343 Saccharomyces cerevisiae
           YOR174W MED4 Member of RNA Polymerase II transcriptional
           regulation mediator Stoichiometric member of mediator
           complex
          Length = 285

 Score =  202 bits (513), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 92/169 (54%), Positives = 128/169 (75%)

Query: 35  DKLSKVQLYEDLCRYEDTLKKLVESVDRFKPDIDVARDLIKIDESLFNNVDLLSEYDNID 94
           ++L  V +Y+DL RYE+T+++L +SVD FKPD+ +   +I+ D+ L+  ++   EY  I+
Sbjct: 30  EELQSVGIYQDLERYEETIQQLSKSVDTFKPDLSLIDKVIECDKKLYETLEEFDEYYKIE 89

Query: 95  RNLRKIDKDSEELDSKTKRILEIMNECHDELGALPMLEQVEFEKNTILQQRSKINSTALL 154
             L ++DK+ + +D+KT+ ILE +N C++ L  LPMLEQVEFE+  +L+QR KI+S  +L
Sbjct: 90  EELSRLDKEQKNIDNKTREILETLNTCYNSLNELPMLEQVEFEQKVMLKQREKIHSKVVL 149

Query: 155 DYATKLSKFTRIPPTFDKGSIGPNNFIWPAEDALRRGMLAMASLHSKEL 203
           DYA KL+KFTR PPTFDK  IGPNNFIWPAED+LR+GMLAMASL  KEL
Sbjct: 150 DYAMKLAKFTRFPPTFDKSMIGPNNFIWPAEDSLRKGMLAMASLKKKEL 198

>TPHA0M01050 Chr13 complement(205757..208390) [2634 bp, 877 aa] {ON}
           Anc_3.265 YBR055C
          Length = 877

 Score = 33.9 bits (76), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 34/54 (62%), Gaps = 6/54 (11%)

Query: 36  KLSKVQLYEDLCRYEDTLKKL---VESVDRFKPDIDVARDLIKIDESLFNNVDL 86
           KL + Q+Y DL +YE+  K+L   +ES+  F+P + +A  L +I+ES  N V L
Sbjct: 649 KLQRSQIYRDLGQYEEACKQLKLDIESLP-FEPKLSIA--LSEINESYLNKVTL 699

>ZYRO0F17908g Chr6 (1483368..1484906) [1539 bp, 512 aa] {ON} similar
           to uniprot|P17967 Saccharomyces cerevisiae YCL043C PDI1
           Protein disulfide isomerase and similar to
           uniprot|P32474 Saccharomyces cerevisiae YDR518w
          Length = 512

 Score = 32.7 bits (73), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 43/83 (51%), Gaps = 8/83 (9%)

Query: 6   TKAVDFSMGHMKSSSVSLVVEATSNMNSEDKLSKVQLYEDLCRYEDTLKKLVESVDRFKP 65
           +KA+++  G    S ++ +V+ +        L  VQ+++D   +E+ LK+ V+ V  F  
Sbjct: 112 SKALEYEGGRTAESIINYMVKQS--------LPSVQVFDDEKAFEELLKESVQPVVVFNG 163

Query: 66  DIDVARDLIKIDESLFNNVDLLS 88
           D ++ +   K+ +SLFN     S
Sbjct: 164 DKNLNQTFHKVADSLFNEFTFAS 186

>KNAG0E02480 Chr5 (492142..493623) [1482 bp, 493 aa] {ON} Anc_2.467
           YMR094W
          Length = 493

 Score = 32.3 bits (72), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 56/136 (41%), Gaps = 26/136 (19%)

Query: 81  FNNV-----DLLSEYDNIDRNLRKIDKDSEELDSKTKRILEIMNECHDELGALPMLEQVE 135
           F NV     DLLS       N+ K  K + +L    KR+L  +   +      P LE  E
Sbjct: 25  FTNVKPDDPDLLS-------NVFKAMKSTGDLSLDKKRLLRKLYPRYK-----PYLEMFE 72

Query: 136 FEKNTILQQRSKINSTALLDYATKLSKFTRIPPTFDKGSIGPNNFIWPAEDAL------R 189
           ++   I+   + +  ++ L Y   +    R+  + D G +GP ++I+  ED L      R
Sbjct: 73  YDPELIV---TWLQYSSWLRYDAVILDCLRLNHSLDAGIMGPFDWIYMGEDTLKIGYFQR 129

Query: 190 RGMLAMASLHSKELTR 205
            G L        E TR
Sbjct: 130 TGFLLQVWYSKLEYTR 145

>Kpol_1045.6 s1045 (8627..10063) [1437 bp, 478 aa] {ON}
           (8627..10063) [1437 nt, 479 aa]
          Length = 478

 Score = 31.2 bits (69), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 36/59 (61%), Gaps = 9/59 (15%)

Query: 25  VEATSNMNSEDKLSKVQLYEDLCRYEDTLKKLVESVDRFKPDIDVARDLIKID-ESLFN 82
           ++  + + S ++L K++L++DL RYEDT K+     D  KP   + +D+ + D ESL N
Sbjct: 103 LKMAAELKSLEELKKIKLFDDLARYEDTYKE-----DDIKP---ILKDITEKDVESLSN 153

>NCAS0H02640 Chr8 complement(521008..522954) [1947 bp, 648 aa] {ON}
           Anc_5.543 YML013W
          Length = 648

 Score = 31.2 bits (69), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 38/167 (22%), Positives = 73/167 (43%), Gaps = 29/167 (17%)

Query: 21  VSLVVEATSNMNSEDKLSKVQLYEDLCRYEDTLKKLVESVDRFKPD----------IDVA 70
           V  V+    N+N    LS++++     R++ TLK +    DRF+PD          +++A
Sbjct: 345 VGNVINGDGNVNKLSLLSRIKVNSS-KRFQTTLKAVF---DRFRPDMVVSRTERNELELA 400

Query: 71  RDLIKIDESLFNNVDLLSEYDNIDRNLRKIDKDSEELDSKTKRI------LEIMNECHDE 124
           R + +  E  + N     +    ++ + + +K  +EL+ K K+I      L+ +NEC   
Sbjct: 401 RKIRQSQEEAYQNSLRKDQIKEQEKTIIREEKRLQELEEKMKKIKETYGKLKWLNEC--- 457

Query: 125 LGALPMLEQVEFEKNTILQQRSKINSTALLDYATKLSKFTRIPPTFD 171
                 L  +E +KN +L   S      +     + ++  R+   FD
Sbjct: 458 ------LLILEGDKNDLLNSSSHSTEVKMATLQIRTAQGKRLIKKFD 498

>NCAS0F03960 Chr6 (795002..795562) [561 bp, 186 aa] {ON} Anc_3.565
           YGL242C
          Length = 186

 Score = 29.6 bits (65), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 38/96 (39%), Gaps = 25/96 (26%)

Query: 76  IDESLFNNVDLLSEYDNIDRNLRKIDKDSEELDSKTKRILEIMNECHDELGALPMLEQVE 135
           +D S  NNVDLL +  N             +LD+  K+I +++N   D LG         
Sbjct: 13  LDASRRNNVDLLEQAFN-------------DLDNDPKKIADLINTAKDPLG--------- 50

Query: 136 FEKNTILQQRSKINSTALLDYATKLSKFTRIPPTFD 171
              NT L   SK  S  +LD    L     I P  D
Sbjct: 51  ---NTALHLASKYGSWEVLDKILDLDGDIEIDPQND 83

>Suva_13.199 Chr13 complement(322643..325165) [2523 bp, 840 aa] {ON}
           YMR031C (REAL)
          Length = 840

 Score = 30.4 bits (67), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 45/86 (52%), Gaps = 13/86 (15%)

Query: 85  DLLSEYDNIDRNLRKIDKDSEE-LDSKTKRILEIMNECHDELGALPMLEQVEFEKNTILQ 143
           +L  E   +D++L +  KD E+ + +  K   E++   H++L      E  E E  T+L+
Sbjct: 513 ELKDEKARLDQDLEEWGKDCEQDISNARKEQEELLKPYHEDL------ENAEKEHTTLLE 566

Query: 144 QRSKINS------TALLDYATKLSKF 163
           +R  IN+       A++D+ TK+S +
Sbjct: 567 ERDAINTEISRLQGAIVDHKTKISNY 592

>ZYRO0A06490g Chr1 (518601..518707,518772..519669) [1005 bp, 334 aa]
           {ON} similar to uniprot|P38813 Saccharomyces cerevisiae
           YHR101C BIG1 Integral membrane protein of the
           endoplasmic reticulum required for normal content of
           cell wall beta-1 6-glucan
          Length = 334

 Score = 29.6 bits (65), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 14/63 (22%), Positives = 34/63 (53%)

Query: 15  HMKSSSVSLVVEATSNMNSEDKLSKVQLYEDLCRYEDTLKKLVESVDRFKPDIDVARDLI 74
           +++ SS +L  E    M  +      +  +++CR +  L    ++++ F+P ID+ + +I
Sbjct: 100 YLRKSSTALAFEQVELMPDDTFEQLTEYVQEICRIDKLLYVEGDNLESFQPYIDIEKRII 159

Query: 75  KID 77
           +I+
Sbjct: 160 RIE 162

>CAGL0F09229g Chr6 complement(908186..910693) [2508 bp, 835 aa] {ON}
           weakly similar to uniprot|P39961 Saccharomyces
           cerevisiae YER184c
          Length = 835

 Score = 29.6 bits (65), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 43/84 (51%), Gaps = 3/84 (3%)

Query: 84  VDLLSEYDNIDRNLRKIDKDSEELDSKTKRILEIMNECHDELGALPM-LEQVEFEKNTIL 142
           +DLL++ +N   +L  +D D++EL       +E   +C   +G+L   L+ VE   + +L
Sbjct: 499 IDLLNKMENFFVSLTGVDVDTDELTEFMTYFIETKMKCLIAMGSLIYRLKGVEVSGSELL 558

Query: 143 QQRSKINSTALLDYATKLSKFTRI 166
            +  KI+ T +  Y   L+   R+
Sbjct: 559 DKCLKISLTNI--YQCSLTGLRRV 580

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.129    0.351 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 28,844,104
Number of extensions: 1303011
Number of successful extensions: 5760
Number of sequences better than 10.0: 191
Number of HSP's gapped: 5947
Number of HSP's successfully gapped: 196
Length of query: 288
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 180
Effective length of database: 41,097,471
Effective search space: 7397544780
Effective search space used: 7397544780
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 65 (29.6 bits)