Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_15.3195.476ON76273232290.0
YOR140W (SFL1)5.476ON76673027350.0
Skud_15.3035.476ON74873426400.0
Suva_8.1915.476ON75873824770.0
NDAI0C013805.476ON7671334391e-44
ZYRO0D11286g5.476ON7171404257e-43
TDEL0A034005.476ON8101364188e-42
NCAS0H022805.476ON6571334042e-40
KNAG0B040405.476ON8521534045e-40
Kwal_55.212545.476ON8531303922e-38
CAGL0I07183g5.476ON7711343902e-38
KLTH0F14982g5.476ON8281333823e-37
SAKL0G03586g5.476ON8531323573e-34
AFR136C5.476ON6951333553e-34
Ecym_23125.476ON7561303564e-34
KLLA0E03191g5.476ON7701353564e-34
TPHA0A052505.77ON6011382145e-17
Kpol_1062.85.77ON4331382044e-16
KLLA0A05368g5.77ON4121311902e-14
Skud_7.2086.209ON836641871e-13
KAFR0C022506.209ON613781852e-13
KNAG0K004705.77ON4141401822e-13
SAKL0H02354g5.77ON3851301812e-13
NDAI0D034304.385ON597801833e-13
KAFR0B044105.77ON465711814e-13
TPHA0H011305.77ON4391321787e-13
SAKL0A04576g6.209ON557781798e-13
CAGL0F08195g5.77ON3251321759e-13
YGL073W (HSF1)6.209ON833641809e-13
KLTH0H00814g5.77ON3901401761e-12
Smik_16.585.77ON4531361761e-12
Smik_7.2096.209ON837641781e-12
TDEL0E051706.209ON546841771e-12
KNAG0F020206.209ON771841781e-12
Suva_7.5445.77ON4691361761e-12
TDEL0G010105.77ON3981341742e-12
ZYRO0G08734g6.209ON572851752e-12
Suva_7.1976.209ON846641763e-12
NDAI0B009405.77ON5261241743e-12
YGR249W (MGA1)5.77ON4561361733e-12
TBLA0A020006.209ON627931727e-12
Kwal_56.240366.209ON567781709e-12
NCAS0A064504.385ON6091371701e-11
NCAS0E038705.77ON3931301681e-11
TBLA0G02700singletonON445971691e-11
Kpol_1033.466.209ON717641701e-11
Ecym_55735.77ON5721341691e-11
KLLA0D03322g6.209ON677831691e-11
YHR206W (SKN7)4.385ON622741691e-11
KLTH0H04290g6.209ON569781692e-11
Skud_8.2734.385ON623731682e-11
Smik_8.2964.385ON625731672e-11
KNAG0M001804.385ON615711663e-11
Skud_7.5825.77ON4521361635e-11
NCAS0D037806.209ON760641655e-11
AEL216C5.77ON4501341635e-11
KAFR0B069904.385ON545641646e-11
Ecym_22086.209ON529641629e-11
KLTH0D17182g4.385ON464641601e-10
Kpol_1050.795.77ON4331401601e-10
AFL085C6.209ON569841611e-10
ZYRO0C11506g5.77ON334681581e-10
Suva_15.4124.385ON617641611e-10
CAGL0H03443g6.209ON706641611e-10
Kwal_47.167704.385ON461641582e-10
Kpol_265.24.385ON549691582e-10
NDAI0I011106.209ON905641592e-10
TDEL0D003204.385ON547641573e-10
KLLA0A10219g4.385ON475641573e-10
SAKL0B12408g4.385ON465641563e-10
TBLA0A107004.385ON587641574e-10
CAGL0F09097g4.385ON630641574e-10
ADL388W4.385ON482731547e-10
TPHA0E028806.209ON718641557e-10
ZYRO0G00484g4.385ON647641548e-10
TPHA0C001504.385ON510641531e-09
Ecym_74744.385ON496731503e-09
TBLA0E049804.385ON791651476e-09
Suva_12.2414.385ON349761207e-06
Skud_10.3734.385ON346751143e-05
YJR147W (HMS2)4.385ON358701000.002
Smik_10.4424.385ON347125920.017
TPHA0L019802.639ON55637742.9
TPHA0C037102.353ON81270725.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_15.319
         (762 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_15.319 Chr15 (548397..550685) [2289 bp, 762 aa] {ON} YOR140...  1248   0.0  
YOR140W Chr15 (586981..589281) [2301 bp, 766 aa] {ON}  SFL1Trans...  1058   0.0  
Skud_15.303 Chr15 (541019..543265) [2247 bp, 748 aa] {ON} YOR140...  1021   0.0  
Suva_8.191 Chr8 (342114..344390) [2277 bp, 758 aa] {ON} YOR140W ...   958   0.0  
NDAI0C01380 Chr3 complement(287185..289488) [2304 bp, 767 aa] {O...   173   1e-44
ZYRO0D11286g Chr4 (952637..954790) [2154 bp, 717 aa] {ON} some s...   168   7e-43
TDEL0A03400 Chr1 (605729..608161) [2433 bp, 810 aa] {ON} Anc_5.4...   165   8e-42
NCAS0H02280 Chr8 (447781..449754) [1974 bp, 657 aa] {ON} Anc_5.476    160   2e-40
KNAG0B04040 Chr2 complement(773334..775892) [2559 bp, 852 aa] {O...   160   5e-40
Kwal_55.21254 s55 complement(752205..754766) [2562 bp, 853 aa] {...   155   2e-38
CAGL0I07183g Chr9 complement(690080..692395) [2316 bp, 771 aa] {...   154   2e-38
KLTH0F14982g Chr6 complement(1224825..1227311) [2487 bp, 828 aa]...   151   3e-37
SAKL0G03586g Chr7 (297103..299664) [2562 bp, 853 aa] {ON} some s...   142   3e-34
AFR136C Chr6 complement(682887..684974) [2088 bp, 695 aa] {ON} S...   141   3e-34
Ecym_2312 Chr2 complement(607441..609711) [2271 bp, 756 aa] {ON}...   141   4e-34
KLLA0E03191g Chr5 (296592..298904) [2313 bp, 770 aa] {ON} some s...   141   4e-34
TPHA0A05250 Chr1 (1183602..1185407) [1806 bp, 601 aa] {ON} Anc_5...    87   5e-17
Kpol_1062.8 s1062 complement(17211..18512) [1302 bp, 433 aa] {ON...    83   4e-16
KLLA0A05368g Chr1 complement(490032..491270) [1239 bp, 412 aa] {...    78   2e-14
Skud_7.208 Chr7 (371946..374456) [2511 bp, 836 aa] {ON} YGL073W ...    77   1e-13
KAFR0C02250 Chr3 (445113..446954) [1842 bp, 613 aa] {ON} Anc_6.2...    76   2e-13
KNAG0K00470 Chr11 complement(79664..80908) [1245 bp, 414 aa] {ON...    75   2e-13
SAKL0H02354g Chr8 complement(236815..237972) [1158 bp, 385 aa] {...    74   2e-13
NDAI0D03430 Chr4 (809977..811770) [1794 bp, 597 aa] {ON} Anc_4.385     75   3e-13
KAFR0B04410 Chr2 (916555..917952) [1398 bp, 465 aa] {ON} Anc_5.7...    74   4e-13
TPHA0H01130 Chr8 (250116..251435) [1320 bp, 439 aa] {ON} Anc_5.7...    73   7e-13
SAKL0A04576g Chr1 complement(422093..423766) [1674 bp, 557 aa] {...    74   8e-13
CAGL0F08195g Chr6 (813050..814027) [978 bp, 325 aa] {ON} some si...    72   9e-13
YGL073W Chr7 (368753..371254) [2502 bp, 833 aa] {ON}  HSF1Trimer...    74   9e-13
KLTH0H00814g Chr8 complement(90962..92134) [1173 bp, 390 aa] {ON...    72   1e-12
Smik_16.58 Chr16 complement(107370..108731) [1362 bp, 453 aa] {O...    72   1e-12
Smik_7.209 Chr7 (363136..365649) [2514 bp, 837 aa] {ON} YGL073W ...    73   1e-12
TDEL0E05170 Chr5 (951579..953219) [1641 bp, 546 aa] {ON} Anc_6.2...    73   1e-12
KNAG0F02020 Chr6 complement(384620..386935) [2316 bp, 771 aa] {O...    73   1e-12
Suva_7.544 Chr7 (943366..944775) [1410 bp, 469 aa] {ON} YGR249W ...    72   1e-12
TDEL0G01010 Chr7 complement(209613..210809) [1197 bp, 398 aa] {O...    72   2e-12
ZYRO0G08734g Chr7 (704684..706402) [1719 bp, 572 aa] {ON} simila...    72   2e-12
Suva_7.197 Chr7 (361661..364201) [2541 bp, 846 aa] {ON} YGL073W ...    72   3e-12
NDAI0B00940 Chr2 complement(218385..219965) [1581 bp, 526 aa] {O...    72   3e-12
YGR249W Chr7 (988049..989419) [1371 bp, 456 aa] {ON}  MGA1Protei...    71   3e-12
TBLA0A02000 Chr1 (482464..484347) [1884 bp, 627 aa] {ON} Anc_6.2...    71   7e-12
Kwal_56.24036 s56 (822498..824201) [1704 bp, 567 aa] {ON} YGL073...    70   9e-12
NCAS0A06450 Chr1 (1273459..1275288) [1830 bp, 609 aa] {ON} Anc_4...    70   1e-11
NCAS0E03870 Chr5 (759876..761057) [1182 bp, 393 aa] {ON} Anc_5.77      69   1e-11
TBLA0G02700 Chr7 (710230..711567) [1338 bp, 445 aa] {ON}               70   1e-11
Kpol_1033.46 s1033 (115581..117734) [2154 bp, 717 aa] {ON} (1155...    70   1e-11
Ecym_5573 Chr5 (1172938..1174656) [1719 bp, 572 aa] {ON} similar...    70   1e-11
KLLA0D03322g Chr4 complement(276591..278624) [2034 bp, 677 aa] {...    70   1e-11
YHR206W Chr8 (512732..514600) [1869 bp, 622 aa] {ON}  SKN7Nuclea...    70   1e-11
KLTH0H04290g Chr8 complement(387890..389599) [1710 bp, 569 aa] {...    70   2e-11
Skud_8.273 Chr8 (481627..483498) [1872 bp, 623 aa] {ON} YHR206W ...    69   2e-11
Smik_8.296 Chr8 (487452..489329) [1878 bp, 625 aa] {ON} YHR206W ...    69   2e-11
KNAG0M00180 Chr13 complement(22500..24347) [1848 bp, 615 aa] {ON...    69   3e-11
Skud_7.582 Chr7 (962776..964134) [1359 bp, 452 aa] {ON} YGR249W ...    67   5e-11
NCAS0D03780 Chr4 (702461..704743) [2283 bp, 760 aa] {ON} Anc_6.209     68   5e-11
AEL216C Chr5 complement(228433..229785) [1353 bp, 450 aa] {ON} S...    67   5e-11
KAFR0B06990 Chr2 (1455520..1457157) [1638 bp, 545 aa] {ON} Anc_4...    68   6e-11
Ecym_2208 Chr2 complement(410156..411745) [1590 bp, 529 aa] {ON}...    67   9e-11
KLTH0D17182g Chr4 complement(1424948..1426342) [1395 bp, 464 aa]...    66   1e-10
Kpol_1050.79 s1050 (171402..172703) [1302 bp, 433 aa] {ON} (1714...    66   1e-10
AFL085C Chr6 complement(279712..281421) [1710 bp, 569 aa] {ON} S...    67   1e-10
ZYRO0C11506g Chr3 (891756..892760) [1005 bp, 334 aa] {ON} some s...    65   1e-10
Suva_15.412 Chr15 (719438..721291) [1854 bp, 617 aa] {ON} YHR206...    67   1e-10
CAGL0H03443g Chr8 (320888..323008) [2121 bp, 706 aa] {ON} weakly...    67   1e-10
Kwal_47.16770 s47 (103208..104593) [1386 bp, 461 aa] {ON} YHR206...    65   2e-10
Kpol_265.2 s265 (9842..11491) [1650 bp, 549 aa] {ON} (9842..1149...    65   2e-10
NDAI0I01110 Chr9 complement(267274..269991) [2718 bp, 905 aa] {O...    66   2e-10
TDEL0D00320 Chr4 complement(53243..54886) [1644 bp, 547 aa] {ON}...    65   3e-10
KLLA0A10219g Chr1 (896931..898358) [1428 bp, 475 aa] {ON} simila...    65   3e-10
SAKL0B12408g Chr2 (1065161..1066558) [1398 bp, 465 aa] {ON} simi...    65   3e-10
TBLA0A10700 Chr1 (2646036..2647799) [1764 bp, 587 aa] {ON} Anc_4...    65   4e-10
CAGL0F09097g Chr6 (898706..900598) [1893 bp, 630 aa] {ON} simila...    65   4e-10
ADL388W Chr4 (30355..31803) [1449 bp, 482 aa] {ON} Syntenic homo...    64   7e-10
TPHA0E02880 Chr5 complement(603237..605393) [2157 bp, 718 aa] {O...    64   7e-10
ZYRO0G00484g Chr7 complement(35793..37736) [1944 bp, 647 aa] {ON...    64   8e-10
TPHA0C00150 Chr3 complement(15029..16561) [1533 bp, 510 aa] {ON}...    64   1e-09
Ecym_7474 Chr7 (967242..968732) [1491 bp, 496 aa] {ON} similar t...    62   3e-09
TBLA0E04980 Chr5 (1275927..1278302) [2376 bp, 791 aa] {ON} Anc_4...    61   6e-09
Suva_12.241 Chr12 (384063..385112) [1050 bp, 349 aa] {ON} YJR147...    51   7e-06
Skud_10.373 Chr10 (662167..663207) [1041 bp, 346 aa] {ON} YJR147...    49   3e-05
YJR147W Chr10 (704196..705272) [1077 bp, 358 aa] {ON}  HMS2Prote...    43   0.002
Smik_10.442 Chr10 (693234..694277) [1044 bp, 347 aa] {ON} YJR147...    40   0.017
TPHA0L01980 Chr12 (414853..416523) [1671 bp, 556 aa] {ON} Anc_2....    33   2.9  
TPHA0C03710 Chr3 complement(809578..812016) [2439 bp, 812 aa] {O...    32   5.2  

>Smik_15.319 Chr15 (548397..550685) [2289 bp, 762 aa] {ON} YOR140W
           (REAL)
          Length = 762

 Score = 1248 bits (3229), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 623/732 (85%), Positives = 623/732 (85%)

Query: 31  EIANPAAEGSDVSEDVKKHGSKMLVGPRPPQNAIFIHKLYQILEDDSLHDLIWWSPSGLS 90
           EIANPAAEGSDVSEDVKKHGSKMLVGPRPPQNAIFIHKLYQILEDDSLHDLIWWSPSGLS
Sbjct: 31  EIANPAAEGSDVSEDVKKHGSKMLVGPRPPQNAIFIHKLYQILEDDSLHDLIWWSPSGLS 90

Query: 91  FMIKPVERFSKALATYFKHTNITSFVRQLNIYGFHKVSHDHSSNDTNGGDEANTNDDSSG 150
           FMIKPVERFSKALATYFKHTNITSFVRQLNIYGFHKVSHDHSSNDTNGGDEANTNDDSSG
Sbjct: 91  FMIKPVERFSKALATYFKHTNITSFVRQLNIYGFHKVSHDHSSNDTNGGDEANTNDDSSG 150

Query: 151 NKNTSGDENNGVSVQEKERSNPTKIWEFKHSSGIFKKGDIEGLKHXXXXXXXXXXXXXXX 210
           NKNTSGDENNGVSVQEKERSNPTKIWEFKHSSGIFKKGDIEGLKH               
Sbjct: 151 NKNTSGDENNGVSVQEKERSNPTKIWEFKHSSGIFKKGDIEGLKHIKRRASSRNSSSINS 210

Query: 211 XXXXXXQNYDTDSGVRARPXXXXXXXXXXXAFGNFVPQIPSANNTIPECFNNSHVTYENL 270
                 QNYDTDSGVRARP           AFGNFVPQIPSANNTIPECFNNSHVTYENL
Sbjct: 211 RKNSSNQNYDTDSGVRARPSSVQDPSTSSSAFGNFVPQIPSANNTIPECFNNSHVTYENL 270

Query: 271 SHGALEYNNPDMQEQSKPPSFQDEALKHLKDINVDMVKIIESMQHFISLQHSFCSQSFTF 330
           SHGALEYNNPDMQEQSKPPSFQDEALKHLKDINVDMVKIIESMQHFISLQHSFCSQSFTF
Sbjct: 271 SHGALEYNNPDMQEQSKPPSFQDEALKHLKDINVDMVKIIESMQHFISLQHSFCSQSFTF 330

Query: 331 KNVSKKKSENIVKEHQKQLKAFENDMLTFKQHVMSRAHRTIDSLYXXXXXXXXXXXXXXX 390
           KNVSKKKSENIVKEHQKQLKAFENDMLTFKQHVMSRAHRTIDSLY               
Sbjct: 331 KNVSKKKSENIVKEHQKQLKAFENDMLTFKQHVMSRAHRTIDSLYAINSNAIATAPAPAP 390

Query: 391 XXXXXXXXKSQYDVMVPPGNQYVPQKSSSSTNIPSRFNTSSVPPSQLFVXXXXXXXXXXX 450
                   KSQYDVMVPPGNQYVPQKSSSSTNIPSRFNTSSVPPSQLFV           
Sbjct: 391 ASISAYAPKSQYDVMVPPGNQYVPQKSSSSTNIPSRFNTSSVPPSQLFVQYQSQPQAQPQ 450

Query: 451 XXMTYAKQPTHMPNFVHXXXXXXXXXXXYADTFSTPQMMHNPFASKNTNKPGNTRRTNSV 510
             MTYAKQPTHMPNFVH           YADTFSTPQMMHNPFASKNTNKPGNTRRTNSV
Sbjct: 451 QYMTYAKQPTHMPNFVHQPIPIQQLPPQYADTFSTPQMMHNPFASKNTNKPGNTRRTNSV 510

Query: 511 LMDPLTPAASVGVQAPLNYPIMNINPPGRDYNKSVPQNMAPSPIYPINEPTTRLYSQPKM 570
           LMDPLTPAASVGVQAPLNYPIMNINPPGRDYNKSVPQNMAPSPIYPINEPTTRLYSQPKM
Sbjct: 511 LMDPLTPAASVGVQAPLNYPIMNINPPGRDYNKSVPQNMAPSPIYPINEPTTRLYSQPKM 570

Query: 571 RSLGSTSSLPNDRKNSPLKLTPRPSLNEDSLYPKPRNXXXXXXXXXXXXXXXXXVANNPA 630
           RSLGSTSSLPNDRKNSPLKLTPRPSLNEDSLYPKPRN                 VANNPA
Sbjct: 571 RSLGSTSSLPNDRKNSPLKLTPRPSLNEDSLYPKPRNSLKSSTSGTSLSSSLTLVANNPA 630

Query: 631 PIRYSQQGLLRSLSKAANCAPDPTTPLDSSVLTGPIPKNMDNLPAVSSNLINSPMNVDHG 690
           PIRYSQQGLLRSLSKAANCAPDPTTPLDSSVLTGPIPKNMDNLPAVSSNLINSPMNVDHG
Sbjct: 631 PIRYSQQGLLRSLSKAANCAPDPTTPLDSSVLTGPIPKNMDNLPAVSSNLINSPMNVDHG 690

Query: 691 XXXXXXXXXXXXXVPQPSFSATVAAKETDEADNSKRNGSAVYSLLNREDNGASSTDFKTE 750
                        VPQPSFSATVAAKETDEADNSKRNGSAVYSLLNREDNGASSTDFKTE
Sbjct: 691 SSISHAESISSIEVPQPSFSATVAAKETDEADNSKRNGSAVYSLLNREDNGASSTDFKTE 750

Query: 751 EKATPVLKKVKM 762
           EKATPVLKKVKM
Sbjct: 751 EKATPVLKKVKM 762

>YOR140W Chr15 (586981..589281) [2301 bp, 766 aa] {ON}
           SFL1Transcriptional repressor and activator; involved in
           repression of flocculation-related genes, and activation
           of stress responsive genes; negatively regulated by
           cAMP-dependent protein kinase A subunit Tpk2p
          Length = 766

 Score = 1058 bits (2735), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 535/730 (73%), Positives = 568/730 (77%), Gaps = 12/730 (1%)

Query: 41  DVSEDVKKHGSKMLVGPRPPQNAIFIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFS 100
           D +EDVKKHGSKMLVGPRPPQNAIFIHKLYQILED+SLHDLIWW+PSGLSFMIKPVERFS
Sbjct: 41  DGAEDVKKHGSKMLVGPRPPQNAIFIHKLYQILEDESLHDLIWWTPSGLSFMIKPVERFS 100

Query: 101 KALATYFKHTNITSFVRQLNIYGFHKVSHDHSSNDTNGGDEANTNDDS------SGNKNT 154
           KALATYFKHTNITSFVRQLNIYGFHKVSHDHSSND N GD+ANTNDDS      SGNKN+
Sbjct: 101 KALATYFKHTNITSFVRQLNIYGFHKVSHDHSSNDANSGDDANTNDDSNTHDDNSGNKNS 160

Query: 155 SGDENNGVSVQEKERSNPTKIWEFKHSSGIFKKGDIEGLKHXXXXXXXXXXXXXXXXXXX 214
           SGDEN G  VQEKE+SNPTKIWEFKHSSGIFKKGDIEGLKH                   
Sbjct: 161 SGDENTGGGVQEKEKSNPTKIWEFKHSSGIFKKGDIEGLKHIKRRASSRNNSSINSRKNS 220

Query: 215 XXQNYDTDSGVRARPXXXXXXXXXXXAFGNFVPQIPSANNTIPECFNNSHVTYENLSHGA 274
             QNYD DSG R RP           +FGNFVPQIP ANN+IPE FNNSHVTYEN +H  
Sbjct: 221 SNQNYDIDSGARVRPSSIQDPSTSSNSFGNFVPQIPGANNSIPEYFNNSHVTYENANHAP 280

Query: 275 LEYNNPDMQEQSKPPSFQDEALKHLKDINVDMVKIIESMQHFISLQHSFCSQSFTFKNVS 334
           LE NNP+MQEQ++PP+FQDE LKHLK+IN DMVKIIESMQHFISLQHSFCSQSFTFKNVS
Sbjct: 281 LESNNPEMQEQNRPPNFQDETLKHLKEINFDMVKIIESMQHFISLQHSFCSQSFTFKNVS 340

Query: 335 KKKSENIVKEHQKQLKAFENDMLTFKQHVMSRAHRTIDSLYXXXXXXXXXXXXXXXXXXX 394
           KKKSENIVK+HQKQL+AFE+DMLTFKQHVMSRAHRTIDSL                    
Sbjct: 341 KKKSENIVKDHQKQLQAFESDMLTFKQHVMSRAHRTIDSLCAVNAAATAASVAPAPAPTS 400

Query: 395 XXXX--KSQYDVMVPPGNQYVPQKSSSSTNIPSRFNTSSVPPSQLFVXXXXXXXXXXXXX 452
                 KSQY++MVPPGNQYVPQKSSS+TNIPSRFNT+SVPPSQLFV             
Sbjct: 401 TSAYAPKSQYEMMVPPGNQYVPQKSSSTTNIPSRFNTASVPPSQLFVQYQPQSQQH---- 456

Query: 453 MTYAKQPTHMPNFVHXXXXXXXXXXXYADTFSTPQMMHNPFASKNTNKPGNTRRTNSVLM 512
           +TYAKQP H+PNF++           YADTFSTPQMMHNPFASKN NKPGNT+RTNSVLM
Sbjct: 457 VTYAKQPAHVPNFINQPIPIQQLPPQYADTFSTPQMMHNPFASKNNNKPGNTKRTNSVLM 516

Query: 513 DPLTPAASVGVQAPLNYPIMNINPPGRDYNKSVPQNMAPSPIYPINEPTTRLYSQPKMRS 572
           DPLTPAASVGVQ PLNYPIMNINP  RDYNK VPQNMAPSPIYPINEPTTRLYSQPKMRS
Sbjct: 517 DPLTPAASVGVQGPLNYPIMNINPSVRDYNKPVPQNMAPSPIYPINEPTTRLYSQPKMRS 576

Query: 573 LGSTSSLPNDRKNSPLKLTPRPSLNEDSLYPKPRNXXXXXXXXXXXXXXXXXVANNPAPI 632
           LGSTSSLPNDR+NSPLKLTPR SLNEDSLYPKPRN                 VANNPAPI
Sbjct: 577 LGSTSSLPNDRRNSPLKLTPRSSLNEDSLYPKPRNSLKSSISGTSLSSSFTLVANNPAPI 636

Query: 633 RYSQQGLLRSLSKAANCAPDPTTPLDSSVLTGPIPKNMDNLPAVSSNLINSPMNVDHGXX 692
           RYSQQGLLRSL+KAANCAPD  TPLDSSVLTGP PKNMDNLPAVSSNLINSPMNV+H   
Sbjct: 637 RYSQQGLLRSLNKAANCAPDSVTPLDSSVLTGPPPKNMDNLPAVSSNLINSPMNVEHSSS 696

Query: 693 XXXXXXXXXXXVPQPSFSATVAAKETDEADNSKRNGSAVYSLLNREDNGASSTDFKTEEK 752
                      +PQPS   T   K T EADNSKR GS VYSLLN+ED+  SS D KTE+K
Sbjct: 697 LSQAEPAPQIELPQPSLPTTSTTKNTGEADNSKRKGSGVYSLLNQEDSSTSSADPKTEDK 756

Query: 753 ATPVLKKVKM 762
           A P LKKVKM
Sbjct: 757 AAPALKKVKM 766

>Skud_15.303 Chr15 (541019..543265) [2247 bp, 748 aa] {ON} YOR140W
           (REAL)
          Length = 748

 Score = 1021 bits (2640), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 510/734 (69%), Positives = 562/734 (76%), Gaps = 12/734 (1%)

Query: 37  AEGSDVSEDVKKHGSKMLVGPRPPQNAIFIHKLYQILEDDSLHDLIWWSPSGLSFMIKPV 96
            EG D SEDVKKHGSKMLVGPRPPQNAIFIHKLYQILEDDSLHDLIWWS SGLSFMIKPV
Sbjct: 19  VEGGDASEDVKKHGSKMLVGPRPPQNAIFIHKLYQILEDDSLHDLIWWSSSGLSFMIKPV 78

Query: 97  ERFSKALATYFKHTNITSFVRQLNIYGFHKVSHDHSSNDTNGGDEANTND------DSSG 150
           ERFSKALATYFKHTNITSFVRQLNIYGFHKVSHDH+SN+ N GD+ANTND      D  G
Sbjct: 79  ERFSKALATYFKHTNITSFVRQLNIYGFHKVSHDHNSNEINSGDDANTNDVNSTNDDGGG 138

Query: 151 NKNTSGDENNGVSVQEKER--SNPTKIWEFKHSSGIFKKGDIEGLKHXXXXXXXXXXXXX 208
           +KN+SG+ENNG +VQEKE+  SNPTKIWEFKHSSGIFKKGDIEGLKH             
Sbjct: 139 SKNSSGEENNGATVQEKEKEKSNPTKIWEFKHSSGIFKKGDIEGLKHIKRRASSRNNSSI 198

Query: 209 XXXXXXXXQNYDTDSGVRARPXXXXXXXXXXXAFGNFVPQIPSANNTIPECFNNSHVTYE 268
                   QNYD DSGVRARP            F N+VPQI  ANN IPECFNNSHV YE
Sbjct: 199 NSRKNSSNQNYDADSGVRARPSSIQDPTATSNGFCNYVPQISGANNPIPECFNNSHVPYE 258

Query: 269 NLSHGALEYNNPDMQEQSKPPSFQDEALKHLKDINVDMVKIIESMQHFISLQHSFCSQSF 328
           N +HG +E+NNP+ QEQ++P SFQDE L HLK+INVDM+KIIESMQHFISLQH+FCS+SF
Sbjct: 259 NATHGPMEFNNPETQEQARPSSFQDETLTHLKEINVDMIKIIESMQHFISLQHNFCSKSF 318

Query: 329 TFKNVSKKKSENIVKEHQKQLKAFENDMLTFKQHVMSRAHRTIDSLYXXXXXXXXXXXXX 388
           TFKNVSKKKSENI+K+HQKQLK FENDMLTFKQHVMSRAHRT+DSL+             
Sbjct: 319 TFKNVSKKKSENIMKDHQKQLKTFENDMLTFKQHVMSRAHRTMDSLHAATATATAPALAS 378

Query: 389 XXXXXXXXXXKSQYDVMVPPGNQYVPQKSSSSTNIPSRFNTSSVPPSQLFVXXXXXXXXX 448
                     KSQYD+MVPPGNQYVPQKSSSSTNIPSRFNTSSVPPSQ FV         
Sbjct: 379 SSACAP----KSQYDMMVPPGNQYVPQKSSSSTNIPSRFNTSSVPPSQFFVQYQPQPQLQ 434

Query: 449 XXXXMTYAKQPTHMPNFVHXXXXXXXXXXXYADTFSTPQMMHNPFASKNTNKPGNTRRTN 508
               M Y+KQP HMPNF++           YADTF+TPQMMHNPFASKN +KPGNT+RTN
Sbjct: 435 PQQHMAYSKQPAHMPNFINQPIPIQQLPPQYADTFNTPQMMHNPFASKNGHKPGNTKRTN 494

Query: 509 SVLMDPLTPAASVGVQAPLNYPIMNINPPGRDYNKSVPQNMAPSPIYPINEPTTRLYSQP 568
           SVLMDPLTPA SVG+Q  LNYPIMNINP  RDYNKSVPQNMAPSPIYPINEPTTR+YSQP
Sbjct: 495 SVLMDPLTPATSVGIQGTLNYPIMNINPTVRDYNKSVPQNMAPSPIYPINEPTTRMYSQP 554

Query: 569 KMRSLGSTSSLPNDRKNSPLKLTPRPSLNEDSLYPKPRNXXXXXXXXXXXXXXXXXVANN 628
           KMRSLGSTSSLPNDR+NSPLKLTPR SLNEDSLY KP+N                 V+NN
Sbjct: 555 KMRSLGSTSSLPNDRRNSPLKLTPRSSLNEDSLYSKPKNSLKSSISGTSLSSSFTLVSNN 614

Query: 629 PAPIRYSQQGLLRSLSKAANCAPDPTTPLDSSVLTGPIPKNMDNLPAVSSNLINSPMNVD 688
           PAPIRYSQQGLLRSL+KAANC PD   PLDS+VLTGP PKNMDNLPA+SSNLINSPMNV+
Sbjct: 615 PAPIRYSQQGLLRSLNKAANCPPDSVIPLDSTVLTGPTPKNMDNLPAISSNLINSPMNVE 674

Query: 689 HGXXXXXXXXXXXXXVPQPSFSATVAAKETDEADNSKRNGSAVYSLLNREDNGASSTDFK 748
           HG             +PQPS   T A K+ DE DN+KR+GS VYSLLN+E++ +S+ D +
Sbjct: 675 HGTSLSHPEPTPGIELPQPSLPTTNATKKIDETDNTKRSGSGVYSLLNQEESRSSNADPR 734

Query: 749 TEEKATPVLKKVKM 762
            +E+  P  KKV+M
Sbjct: 735 AKEETAPPSKKVRM 748

>Suva_8.191 Chr8 (342114..344390) [2277 bp, 758 aa] {ON} YOR140W
           (REAL)
          Length = 758

 Score =  958 bits (2477), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 485/738 (65%), Positives = 540/738 (73%), Gaps = 26/738 (3%)

Query: 38  EGSDVSEDVKKHGSKMLVGPRPPQNAIFIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVE 97
           EGS+V EDVKKHGSK LVGPRPPQNAIFIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVE
Sbjct: 34  EGSEVPEDVKKHGSKTLVGPRPPQNAIFIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVE 93

Query: 98  RFSKALATYFKHTNITSFVRQLNIYGFHKVSHDHSSNDTNGGDEANTNDDS------SGN 151
           RFSKALATYFKHTNITSFVRQLNIYGFHKVSHDH+SNDTN GD+ NTNDD+       GN
Sbjct: 94  RFSKALATYFKHTNITSFVRQLNIYGFHKVSHDHTSNDTNSGDDGNTNDDANATDDNGGN 153

Query: 152 KNTSGDENNGVSVQEKERSNPTKIWEFKHSSGIFKKGDIEGLKHXXXXXXXXXXXXXXXX 211
           KN+SGDE  G   QEKE+SNPTKIWEFKHSSGIFKKGDIE LKH                
Sbjct: 154 KNSSGDETTGAGAQEKEKSNPTKIWEFKHSSGIFKKGDIESLKHIKRRASSRNNSSINSR 213

Query: 212 XXXXXQNYDTDSGVRARPXXXXXXXXXXXAFGNFVPQIPSANNTIPECFNNSHVTYENLS 271
                QNYD +S +RARP           AF N+VPQI  A+++IPECF  SHV YEN +
Sbjct: 214 KNSSNQNYDIESTIRARPASIQDPVSASSAFSNYVPQISGASSSIPECF--SHVPYENAN 271

Query: 272 HGALEYNNPDMQEQSKPPSFQDEALKHLKDINVDMVKIIESMQHFISLQHSFCSQSFTFK 331
           HG LE+NNPD QE SKP SFQDE L HLKDIN DM+KIIESMQHFISLQH+FCSQSFTFK
Sbjct: 272 HGPLEFNNPDTQETSKPLSFQDETLTHLKDINFDMIKIIESMQHFISLQHNFCSQSFTFK 331

Query: 332 NVSKKKSENIVKEHQKQLKAFENDMLTFKQHVMSRAHRTIDSLYXXXXXXXXXXXXXXXX 391
           NVSKKKSENI+K+HQ QLK FE+DMLTFKQHVMSRAHRTID+L+                
Sbjct: 332 NVSKKKSENIIKDHQNQLKVFESDMLTFKQHVMSRAHRTIDALH-------STAAATATG 384

Query: 392 XXXXXXXKSQYDVMVPPGNQYVPQKSSSSTNIPSRFNTSSVPPSQLFVX-------XXXX 444
                  KSQY++MVPP NQ+ PQKSS S +IPSRFNTSSVPPSQ F+            
Sbjct: 385 PTLVPAHKSQYEIMVPPNNQFGPQKSSLSASIPSRFNTSSVPPSQFFIQYQPQPQPQQQQ 444

Query: 445 XXXXXXXXMTYAKQPTHMPNFVHXXXXXXXXXXXYADTFSTPQMMHNPFASKNTNKPGNT 504
                   M Y KQP HM NF++           YA+TF+TPQMMHNPFASKN++KPGNT
Sbjct: 445 QQQQQQQHMAYPKQPPHMQNFINQPIPIQQLPPQYAETFNTPQMMHNPFASKNSHKPGNT 504

Query: 505 RRTNSVLMDPLTPAASVGVQAPLNYPIMNINPPGRDYNKSVPQNMAPSPIYPINEPTTRL 564
           +RTNSVLMDPLTPAA    Q PLNYPIMN+NP  RDYNK VPQN APSPIYP+NEPTTRL
Sbjct: 505 KRTNSVLMDPLTPAA----QGPLNYPIMNVNPSARDYNKCVPQNRAPSPIYPMNEPTTRL 560

Query: 565 YSQPKMRSLGSTSSLPNDRKNSPLKLTPRPSLNEDSLYPKPRNXXXXXXXXXXXXXXXXX 624
           YSQPKMR+LGSTSSLPNDR+NSPLKLTPR SLNEDSLYPKPRN                 
Sbjct: 561 YSQPKMRTLGSTSSLPNDRRNSPLKLTPRSSLNEDSLYPKPRNSLKSSISGTSISSSFTL 620

Query: 625 VANNPAPIRYSQQGLLRSLSKAANCAPDPTTPLDSSVLTGPIPKNMDNLPAVSSNLINSP 684
           V+NNPAPIRYSQQGLLRSL+KAANCAPD  TPLD S+L GP PKN+DNLP VSSNLINSP
Sbjct: 621 VSNNPAPIRYSQQGLLRSLNKAANCAPDSATPLDPSLLAGPTPKNIDNLPIVSSNLINSP 680

Query: 685 MNVDHGXXXXXXXXXXXXXVPQPSFSATVAAKETDEADNSKRNGSAVYSLLNREDNGASS 744
           MNV+HG             +PQPS   T   K  DE D  +R GS VYSLLN++D+ +++
Sbjct: 681 MNVEHGTSLSHPQPTPQMELPQPSLPTTNVTKGNDETDTIRRTGSGVYSLLNKDDSSSAN 740

Query: 745 TDFKTEEKATPVLKKVKM 762
            + K + + TP  KK ++
Sbjct: 741 ANSKAKGETTPASKKARL 758

>NDAI0C01380 Chr3 complement(287185..289488) [2304 bp, 767 aa] {ON}
           Anc_5.476
          Length = 767

 Score =  173 bits (439), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 95/133 (71%), Gaps = 9/133 (6%)

Query: 62  NAIFIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFSKALATYFKHTNITSFVRQLNI 121
           N IFIHKLY ILED  L DLIWWS  G SF+I+P ERFSKALATYFKHTNITSFVRQLNI
Sbjct: 77  NTIFIHKLYNILEDKDLEDLIWWSNDGKSFLIRPTERFSKALATYFKHTNITSFVRQLNI 136

Query: 122 YGFHKVSHDHSSNDTNGGDEANTNDDSSGNKNTSGDENNGVSVQEKERSNPTKIWEFKHS 181
           YGFHKVS+DH   +    D+  TN  +  N     D NN ++  E+      KIWEFKHS
Sbjct: 137 YGFHKVSNDHQYINNKTEDDTTTNVTNHANT----DVNNNITDNEQ-----VKIWEFKHS 187

Query: 182 SGIFKKGDIEGLK 194
           +GIF+KGD+E LK
Sbjct: 188 AGIFRKGDVESLK 200

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 55/100 (55%), Gaps = 6/100 (6%)

Query: 277 YNNPDMQEQSKPPSFQDEALKH-LKDINVDMVKIIESMQHFISLQHSFCSQSFTFKNVSK 335
           Y N D   +   P +  E+++  +K  N+DM+K+I+ MQ F+SL +   +   +  ++  
Sbjct: 344 YTNTDQGYEQPDPQYTHESVEQTMKAANMDMIKLIDYMQKFVSLLNKNTNGIISEPSIGT 403

Query: 336 KKSENIVKEHQKQLKAFENDMLTFKQHVMSRAHRTIDSLY 375
              +N   E ++Q   F++++  FK+ ++SR    I+++Y
Sbjct: 404 SLKDN---EMKQQWDEFQSEITNFKRSILSRLQ--INAMY 438

 Score = 33.1 bits (74), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 22/32 (68%), Gaps = 1/32 (3%)

Query: 487 QMMHNPFASKNTNKPGNTRRTNSVLMDPLTPA 518
           QMM NPF S N +   +++R  SVL+DPLTP 
Sbjct: 557 QMMQNPFNS-NASSRYSSKRHRSVLLDPLTPV 587

>ZYRO0D11286g Chr4 (952637..954790) [2154 bp, 717 aa] {ON} some
           similarities with uniprot|P20134 Saccharomyces
           cerevisiae YOR140W SFL1 Transcription factor with
           domains homologous to Hsf1p and to myc oncoprotein
           required for normal cell surface assembly and
           flocculence
          Length = 717

 Score =  168 bits (425), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 105/140 (75%), Gaps = 14/140 (10%)

Query: 59  PPQNAIFIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFSKALATYFKHTNITSFVRQ 118
           P Q+ +FIHKLY ILEDD L DLIWWSPSGLSF+I+P+E+FS+ALATYFKHTNI SFVRQ
Sbjct: 73  PLQSTVFIHKLYNILEDDDLKDLIWWSPSGLSFLIRPIEKFSRALATYFKHTNIASFVRQ 132

Query: 119 LNIYGFHKVSHDH---SSNDTNGGDEANTNDDSSGNKNTSGDENNGVSVQEKERSNPTKI 175
           LN+YGFHKVS+DH   S +D+      N ++ S  N N++ D      VQE       KI
Sbjct: 133 LNMYGFHKVSNDHGKSSEHDSASNSRTNNSNSSDNNNNSNAD------VQED-----IKI 181

Query: 176 WEFKHSSGIFKKGDIEGLKH 195
           W+F+HS+G+FK+GDIEGLK+
Sbjct: 182 WKFRHSTGLFKRGDIEGLKY 201

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 56/124 (45%), Gaps = 27/124 (21%)

Query: 250 PSANNTIPECFNNSHVTYENLSHGALEYNNPDMQEQSKPPSFQDEALKHLKDINVDMVKI 309
           P+ NN+ P  F  S     + S+  L Y    +Q +       DEAL +LK +N+DMV +
Sbjct: 350 PAPNNSDP--FLESRYAELSQSYNVLRYEYNSLQYR------HDEALGYLKGVNMDMVHV 401

Query: 310 IESMQHFISLQHSFCSQSFTFKNVSKKKSENIVKEHQKQLKAFENDMLTFKQHVMSRAHR 369
           +E ++  +++Q S                    +   ++    E ++L FK  +MSR HR
Sbjct: 402 LELLESLVTIQTS-------------------SEPSPQEFSGLEQELLRFKALLMSRVHR 442

Query: 370 TIDS 373
             D+
Sbjct: 443 NSDA 446

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 32/59 (54%), Gaps = 7/59 (11%)

Query: 481 DTFSTPQMMH-NPFASKNTNKPGNTRRTNSVLMDPLTPAAS--VGVQAPLNYPIMNINP 536
           D FS P+MM  NPF S        ++R  S+LMDPL PA +  +G+      P MN +P
Sbjct: 525 DHFSGPRMMMMNPFESTGNG----SKRNMSILMDPLAPAPNLMLGMSPSHPQPFMNSSP 579

>TDEL0A03400 Chr1 (605729..608161) [2433 bp, 810 aa] {ON} Anc_5.476
           YOR140W
          Length = 810

 Score =  165 bits (418), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 93/136 (68%), Gaps = 20/136 (14%)

Query: 59  PPQNAIFIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFSKALATYFKHTNITSFVRQ 118
           P QN +FIHKLY ILEDD L DLIWWSPSG SF+I+P ERFS+ALATYFKHTNI SFVRQ
Sbjct: 46  PLQNTVFIHKLYNILEDDDLKDLIWWSPSGTSFLIRPTERFSRALATYFKHTNIASFVRQ 105

Query: 119 LNIYGFHKVSHDHSSNDTNGGDEANTNDDSSGNKNTSGDENNGVSVQEKERSNPTKIWEF 178
           LN+YGFHKVS+DH+        +   + ++           +GV           KIWEF
Sbjct: 106 LNMYGFHKVSNDHNKGIQQQQQQQQPSSEAG---------QDGV-----------KIWEF 145

Query: 179 KHSSGIFKKGDIEGLK 194
           +HS GIFK+GDIEGLK
Sbjct: 146 RHSMGIFKRGDIEGLK 161

 Score = 48.1 bits (113), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 50/83 (60%), Gaps = 2/83 (2%)

Query: 293 DEALKHLKDINVDMVKIIESMQHFISLQHSFCSQSFTFKNVSKKKSE-NIVKEHQKQLKA 351
           DE L+ L+ +N DMVK+++ +Q F++LQ    S+ +   ++    S+ +  ++HQ+++  
Sbjct: 309 DELLEQLRVLNTDMVKLLDFLQKFVTLQ-KLSSEVYHEASLKDDPSKLHQFQKHQQEMSY 367

Query: 352 FENDMLTFKQHVMSRAHRTIDSL 374
            E ++L FK ++M R  + + S 
Sbjct: 368 LEQEILRFKANLMQRLTKKLGSC 390

 Score = 34.3 bits (77), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 24/36 (66%), Gaps = 2/36 (5%)

Query: 483 FSTPQMMHNPFASKNTNKPGNTRRTNSVLMDPLTPA 518
           F+ P+MM NPF +  T +  + +R  S+LMDPL+ A
Sbjct: 533 FAGPRMMMNPFET--TGQTSSVKRNMSILMDPLSSA 566

>NCAS0H02280 Chr8 (447781..449754) [1974 bp, 657 aa] {ON} Anc_5.476
          Length = 657

 Score =  160 bits (404), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 96/133 (72%), Gaps = 13/133 (9%)

Query: 62  NAIFIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFSKALATYFKHTNITSFVRQLNI 121
           N IFIHKLY ILED  L DLIWWS SG SF IKP E+FSKALATYFKHTNITSFVRQLNI
Sbjct: 47  NTIFIHKLYNILEDKDLEDLIWWSSSGQSFFIKPTEKFSKALATYFKHTNITSFVRQLNI 106

Query: 122 YGFHKVSHDHSSNDTNGGDEANTNDDSSGNKNTSGDENNGVSVQEKERSNPTKIWEFKHS 181
           YGFHKVS+DH   +         N+++S + ++ G E      +E   +   KIWEFKHS
Sbjct: 107 YGFHKVSNDHQYINY-------PNNNNSNDNDSKGKE------REDLTNETIKIWEFKHS 153

Query: 182 SGIFKKGDIEGLK 194
           +GIFKKGD+EGLK
Sbjct: 154 AGIFKKGDVEGLK 166

 Score = 39.3 bits (90), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 20/41 (48%), Positives = 26/41 (63%), Gaps = 2/41 (4%)

Query: 487 QMMHNPFASKNTNKPGNTRRTNSVLMDPLTPAASVGVQAPL 527
           Q+M NPF  + TN   +T+R  SVL+DPLTP  SV    P+
Sbjct: 478 QIMQNPF--ERTNNSISTKRNQSVLLDPLTPVVSVSSNNPM 516

 Score = 37.0 bits (84), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 51/112 (45%), Gaps = 21/112 (18%)

Query: 266 TYENLSHGAL-----EYNNPDMQEQSKPPSFQDEALKHLKDINVDMVKIIESMQHFISLQ 320
           TY+N     L     +YN  D  E S    F    +  L+ IN DM K+I  M++F++L 
Sbjct: 274 TYQNNRRKQLNMSPNQYNEED--ESSTHGKFSVSEIDDLRSINQDMAKLIGFMEYFVTLH 331

Query: 321 HSFCSQSFTFKNVSKKKSENIVKEHQKQ-LKAFENDMLTFKQHVMSRAHRTI 371
                 S  +K         I  + QKQ  + F+N++  FK +V+ R H  +
Sbjct: 332 ----LDSGKYK---------IDDDPQKQNWENFQNELANFKNNVIKRLHTKL 370

>KNAG0B04040 Chr2 complement(773334..775892) [2559 bp, 852 aa] {ON}
           Anc_5.476 YOR140W
          Length = 852

 Score =  160 bits (404), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 86/153 (56%), Positives = 103/153 (67%), Gaps = 26/153 (16%)

Query: 61  QNAIFIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFSKALATYFKHTNITSFVRQLN 120
           QN +FIHKLY ILEDD+L DLIWW+P+G+SF I+P E FSK LATYFKHTNITSFVRQLN
Sbjct: 61  QNTVFIHKLYHILEDDALRDLIWWAPNGMSFYIRPNETFSKTLATYFKHTNITSFVRQLN 120

Query: 121 IYGFHKVSHDHSSNDTNGGDEANTNDDSSGNKNTSG------DEN-----NGVSVQEK-- 167
           IYGFHKV++    NDT     A +ND   G  N+ G      D N      GV V+ +  
Sbjct: 121 IYGFHKVTN---WNDT-AAFAAVSND---GRNNSLGALPGGPDMNTHSPSTGVVVKSEPH 173

Query: 168 ------ERSNPTKIWEFKHSSGIFKKGDIEGLK 194
                   S+P KIWEFKHS+ +F++GDIEGLK
Sbjct: 174 TKSGPGATSSPVKIWEFKHSANLFRRGDIEGLK 206

>Kwal_55.21254 s55 complement(752205..754766) [2562 bp, 853 aa] {ON}
           YOR140W (SFL1) - 1:1 [contig 130] FULL
          Length = 853

 Score =  155 bits (392), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 71/130 (54%), Positives = 89/130 (68%), Gaps = 13/130 (10%)

Query: 65  FIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFSKALATYFKHTNITSFVRQLNIYGF 124
           FIHKLY +LED+ +H+LIWWSPS  SF+I+P ERFSKALATYFKHTN+ SFVRQLN+YGF
Sbjct: 60  FIHKLYSMLEDEEMHELIWWSPSQTSFLIRPTERFSKALATYFKHTNVASFVRQLNMYGF 119

Query: 125 HKVSHDHSSNDTNGGDEANTNDDSSGNKNTSGDENNGVSVQEKERSNPTKIWEFKHSSGI 184
           HKV+ DH ++    G  A    + +G K   G   +          N T +WEFKHSS  
Sbjct: 120 HKVN-DHKAHGAKSG--AANKGEEAGLKTRGGQPTD----------NSTSVWEFKHSSAA 166

Query: 185 FKKGDIEGLK 194
           F++GD+E LK
Sbjct: 167 FRRGDMESLK 176

>CAGL0I07183g Chr9 complement(690080..692395) [2316 bp, 771 aa] {ON}
           some similarities with uniprot|P20134 Saccharomyces
           cerevisiae YOR140w SFL1
          Length = 771

 Score =  154 bits (390), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 94/134 (70%), Gaps = 14/134 (10%)

Query: 62  NAIFIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFSKALATYFKHTNITSFVRQLNI 121
           N +FI+KLY +LE+  L DLIWW+ +G SF+I+P E FS+ LA YFKHTNITSFVRQLNI
Sbjct: 8   NTVFINKLYDLLENKDLDDLIWWAANGESFLIRPSESFSQNLAHYFKHTNITSFVRQLNI 67

Query: 122 YGFHKVSHDHSSNDTNGGDEANTNDDSSG-NKNTSGDENNGVSVQEKERSNPTKIWEFKH 180
           YGFHK+S+DH  N      + ++ D+++G + N SGDEN              K+WEFKH
Sbjct: 68  YGFHKISNDHFHNLKREKKQKSSTDNNTGVSNNNSGDEN-------------IKVWEFKH 114

Query: 181 SSGIFKKGDIEGLK 194
           S G+FKKGD+E LK
Sbjct: 115 SGGLFKKGDLENLK 128

>KLTH0F14982g Chr6 complement(1224825..1227311) [2487 bp, 828 aa]
           {ON} some similarities with uniprot|P20134 Saccharomyces
           cerevisiae YOR140W SFL1 Transcription factor with
           domains homologous to Hsf1p and to myc oncoprotein
           required for normal cell surface assembly and
           flocculence
          Length = 828

 Score =  151 bits (382), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 70/133 (52%), Positives = 88/133 (66%), Gaps = 19/133 (14%)

Query: 62  NAIFIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFSKALATYFKHTNITSFVRQLNI 121
           N  FIHKLY +LED  + +LIWWSP   SF+I+P ERF KALATYFKHTN+ SFVRQLN+
Sbjct: 71  NTAFIHKLYSMLEDPEMDELIWWSPPQTSFLIRPTERFGKALATYFKHTNVASFVRQLNM 130

Query: 122 YGFHKVSHDHSSNDTNGGDEANTNDDSSGNKNTSGDENNGVSVQEKERSNPTKIWEFKHS 181
           YGFHKV +DH ++  +    A T+D +S ++NT                  T IWEFKHS
Sbjct: 131 YGFHKV-NDHKTHAASKNGAAKTDDPASKSENT------------------TSIWEFKHS 171

Query: 182 SGIFKKGDIEGLK 194
           S  F++GD+E LK
Sbjct: 172 SSAFRRGDMESLK 184

 Score = 33.9 bits (76), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 21/40 (52%), Positives = 26/40 (65%), Gaps = 3/40 (7%)

Query: 480 ADTFSTPQMMHNPFASK-NTNKPGNTRRTNSVLMDPLTPA 518
           A++ S P +M NPF  K +T+  GN  R  SVLMDPL PA
Sbjct: 575 ANSGSMPYLMMNPFEKKTSTSSSGN--RNMSVLMDPLAPA 612

>SAKL0G03586g Chr7 (297103..299664) [2562 bp, 853 aa] {ON} some
           similarities with uniprot|P20134 Saccharomyces
           cerevisiae YOR140W SFL1 Transcription factor with
           domains homologous to Hsf1p and to myc oncoprotein
           required for normal cell surface assembly and
           flocculence
          Length = 853

 Score =  142 bits (357), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 87/132 (65%), Gaps = 27/132 (20%)

Query: 65  FIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFSKALATYFKHTNITSFVRQLNIYGF 124
           FIHKLY +LED  + DLIWWSP+  SF+IKP E+FSKALAT+FKHTN+ SFVRQLN+YGF
Sbjct: 45  FIHKLYSMLEDQEMKDLIWWSPTQDSFLIKPNEKFSKALATFFKHTNVASFVRQLNMYGF 104

Query: 125 HKVSHDHSSNDTN--GGDEANTNDDSSGNKNTSGDENNGVSVQEKERSNPTKIWEFKHSS 182
           HKV +D++   T+    D A+TN+DS                          +WEFKHSS
Sbjct: 105 HKV-NDNTGKQTDKYSTDSASTNEDS------------------------INLWEFKHSS 139

Query: 183 GIFKKGDIEGLK 194
             F+KGD+EGLK
Sbjct: 140 SAFRKGDMEGLK 151

 Score = 33.9 bits (76), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 22/37 (59%)

Query: 479 YADTFSTPQMMHNPFASKNTNKPGNTRRTNSVLMDPL 515
           Y+ +  TP +M NPFA + ++      R  SVLMDPL
Sbjct: 541 YSGSSGTPYLMMNPFAKRKSSASSARNRHMSVLMDPL 577

>AFR136C Chr6 complement(682887..684974) [2088 bp, 695 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR140W
           (SFL1)
          Length = 695

 Score =  141 bits (355), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 85/133 (63%), Gaps = 27/133 (20%)

Query: 62  NAIFIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFSKALATYFKHTNITSFVRQLNI 121
           N  FIHKLY +LEDD++ DLIWWS S  SF+IKP E+FSKALAT+FKHTN+ SFVRQLN+
Sbjct: 24  NTAFIHKLYSMLEDDNMKDLIWWSASQNSFLIKPNEKFSKALATFFKHTNVASFVRQLNM 83

Query: 122 YGFHKVSHDHSSNDTNGGDEANTNDDSSGNKNTSGDENNGVSVQEKERSNPTKIWEFKHS 181
           YGFHKVS DH                 S  K TS DE+  ++           +WEF+HS
Sbjct: 84  YGFHKVS-DH---------------KPSSAKGTSQDEDEAIN-----------LWEFRHS 116

Query: 182 SGIFKKGDIEGLK 194
            G F+KGD E LK
Sbjct: 117 MGCFRKGDKESLK 129

>Ecym_2312 Chr2 complement(607441..609711) [2271 bp, 756 aa] {ON}
           similar to Ashbya gossypii AFR136C
          Length = 756

 Score =  141 bits (356), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 70/130 (53%), Positives = 87/130 (66%), Gaps = 20/130 (15%)

Query: 65  FIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFSKALATYFKHTNITSFVRQLNIYGF 124
           FIHKLY +LED+ + DLIWWS S  SF+IKP E+FSKALAT+FKHTN+ SFVRQLN+YGF
Sbjct: 73  FIHKLYSMLEDEEMKDLIWWSESENSFLIKPNEKFSKALATFFKHTNVASFVRQLNMYGF 132

Query: 125 HKVSHDHSSNDTNGGDEANTNDDSSGNKNTSGDENNGVSVQEKERSNPTKIWEFKHSSGI 184
           HKVS DH SN     ++++  D + GN +   D  N              +WEF+HS G 
Sbjct: 133 HKVS-DHKSN-----EKSSETDGAHGNGDIEEDSIN--------------LWEFRHSLGC 172

Query: 185 FKKGDIEGLK 194
           F+KGD E LK
Sbjct: 173 FRKGDKESLK 182

 Score = 33.1 bits (74), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 34/69 (49%), Gaps = 4/69 (5%)

Query: 486 PQMMHNPFASKNTNKPGNTRRTNSVLMDPLTP----AASVGVQAPLNYPIMNINPPGRDY 541
           P +M NPFA + + +    +R  SV MDPL P    +AS      +N P+   +  G   
Sbjct: 472 PYLMMNPFAKRKSTESLPKKRHMSVFMDPLAPVPQQSASTSAPTNINEPLSGPHILGGTS 531

Query: 542 NKSVPQNMA 550
           +  VP N++
Sbjct: 532 SPFVPTNLS 540

>KLLA0E03191g Chr5 (296592..298904) [2313 bp, 770 aa] {ON} some
           similarities with uniprot|P20134 Saccharomyces
           cerevisiae YOR140W SFL1 Transcription factor with
           domains homologous to Hsf1p and to myc oncoprotein
           required for normal cell surface assembly and
           flocculence
          Length = 770

 Score =  141 bits (356), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 85/135 (62%), Gaps = 27/135 (20%)

Query: 60  PQNAIFIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFSKALATYFKHTNITSFVRQL 119
           PQN  FIHKLY +LEDD L +LIWWSPS  SF+I+P ERFSKAL+ +FKHTN+ SFVRQL
Sbjct: 83  PQNPHFIHKLYSMLEDDDLKNLIWWSPSCDSFLIRPTERFSKALSAFFKHTNVASFVRQL 142

Query: 120 NIYGFHKVSHDHSSNDTNGGDEANTNDDSSGNKNTSGDENNGVSVQEKERSNPTKIWEFK 179
           N+YGF KVS DH S        ANT+D    + N                     +WEFK
Sbjct: 143 NMYGFQKVS-DHKSTWA-----ANTDDSDEPSIN---------------------LWEFK 175

Query: 180 HSSGIFKKGDIEGLK 194
           HSSG F+KGD E LK
Sbjct: 176 HSSGYFRKGDTESLK 190

>TPHA0A05250 Chr1 (1183602..1185407) [1806 bp, 601 aa] {ON} Anc_5.77
           YGR249W
          Length = 601

 Score = 87.0 bits (214), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 72/138 (52%), Gaps = 13/138 (9%)

Query: 64  IFIHKLYQILEDDSLHDLIWWSPSGLS-FMIKPVER-FS-KALATYFKHTNITSFVRQLN 120
           +FIH+LY IL+   L + I W P     F IKP    FS K L  YFKH N TSFVRQL 
Sbjct: 3   VFIHQLYSILDQSDLREWIHWIPDADGVFAIKPFHHNFSQKVLQKYFKHKNFTSFVRQLY 62

Query: 121 IYGFHKVSHDHSSNDTNGGDEANTNDDSSGNKNTSGDEN----NGVSVQEKERSNPTK-- 174
           +YGFHK+S + +  D+     +NT   S  N  ++ D N    N +S + K  S   K  
Sbjct: 63  MYGFHKLSPNKNVIDSKASLTSNTGKTSQTNSTSAKDSNSRKSNSLSDKSKGNSENAKNG 122

Query: 175 ----IWEFKHSSGIFKKG 188
                W F H SG+F KG
Sbjct: 123 KEDIEWYFTHPSGLFHKG 140

>Kpol_1062.8 s1062 complement(17211..18512) [1302 bp, 433 aa] {ON}
           complement(17211..18512) [1302 nt, 434 aa]
          Length = 433

 Score = 83.2 bits (204), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 78/138 (56%), Gaps = 10/138 (7%)

Query: 65  FIHKLYQILEDDSLHDLIWWSPSGLS-FMIKP--VERFSKALATYFKHTNITSFVRQLNI 121
           F+H+LY IL    L D I+WS    S F IKP   +  S+ L +YFKH N++SFVRQL++
Sbjct: 6   FLHQLYSILHQPDLTDWIYWSEDDSSIFAIKPYSTQFSSQILKSYFKHGNVSSFVRQLHM 65

Query: 122 YGFHKVSH-DHSSNDTNGGDEANTNDDSSGNKNTSGDENNGVS---VQEKERSNPTKIWE 177
           YGFHK+SH +   ND NG +    N  ++GN +      + +S      ++RS    IW 
Sbjct: 66  YGFHKLSHLNKQGNDKNGNNTDPQNTTNNGNNSGIDPSESDISFPPTLPQDRS--LTIWY 123

Query: 178 FKHSSGIFKK-GDIEGLK 194
           F H SG F K  DI  L+
Sbjct: 124 FTHPSGYFHKNADILNLE 141

>KLLA0A05368g Chr1 complement(490032..491270) [1239 bp, 412 aa] {ON}
           weakly similar to uniprot|P53050 Saccharomyces
           cerevisiae YGR249W
          Length = 412

 Score = 77.8 bits (190), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 52/131 (39%), Positives = 65/131 (49%), Gaps = 19/131 (14%)

Query: 65  FIHKLYQILEDDSLHDLIWWSPSGLS-FMIKP-VERFS-KALATYFKHTNITSFVRQLNI 121
           FIH+L+ IL  D L + I WS    S F+IKP    FS K L  +FKH N++SFVRQL++
Sbjct: 6   FIHQLHHILMQDELIEWIRWSEDDESMFIIKPNAPNFSSKVLKRFFKHGNVSSFVRQLHM 65

Query: 122 YGFHKVSHDHSSNDTNGGDEANTNDDSSGNKNTSGDENNGVSVQEKERSNPTKIWEFKHS 181
           YGFHK+ H  SS     G +         N   +   NN  S  E E       W+F H 
Sbjct: 66  YGFHKLPHSASSTLAASGAD---------NNGATASTNNATSKSEIE-------WKFTHH 109

Query: 182 SGIFKKGDIEG 192
           S  F K   E 
Sbjct: 110 SHDFCKSASEA 120

>Skud_7.208 Chr7 (371946..374456) [2511 bp, 836 aa] {ON} YGL073W
           (REAL)
          Length = 836

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 45/64 (70%), Gaps = 1/64 (1%)

Query: 65  FIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERF-SKALATYFKHTNITSFVRQLNIYG 123
           F++KL+ +L DDS   LI W+P G SF++   E F  + L  YFKH+N  SFVRQLN+YG
Sbjct: 176 FVNKLWSMLNDDSNAKLIQWAPDGKSFIVTNREEFVHEILPKYFKHSNFASFVRQLNMYG 235

Query: 124 FHKV 127
           +HKV
Sbjct: 236 WHKV 239

>KAFR0C02250 Chr3 (445113..446954) [1842 bp, 613 aa] {ON} Anc_6.209
           YGL073W
          Length = 613

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 38/78 (48%), Positives = 51/78 (65%), Gaps = 1/78 (1%)

Query: 65  FIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERF-SKALATYFKHTNITSFVRQLNIYG 123
           F++KL+ +L D+S  DLI WS  G SF++   E+F  + L  YFKH+N  SFVRQLN+YG
Sbjct: 152 FVNKLWSMLNDNSNLDLIQWSNDGKSFVVTNREQFVHEILPKYFKHSNFASFVRQLNMYG 211

Query: 124 FHKVSHDHSSNDTNGGDE 141
           +HKV    S +  N  DE
Sbjct: 212 WHKVQDVKSGSIQNSSDE 229

>KNAG0K00470 Chr11 complement(79664..80908) [1245 bp, 414 aa] {ON}
           Anc_5.77 YGR249W
          Length = 414

 Score = 74.7 bits (182), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 50/140 (35%), Positives = 73/140 (52%), Gaps = 13/140 (9%)

Query: 61  QNAIFIHKLYQILEDDSLHDLIWWSPS-GLSFMIKPVER-FSK-ALATYFKHTNITSFVR 117
           Q   F+HKL+ IL++  + +LI WS     +F +KP +  F+   L  YFKH N++SFVR
Sbjct: 2   QIKTFVHKLHSILQEPGISNLIAWSDKYDGAFCLKPYDADFANLVLKRYFKHGNVSSFVR 61

Query: 118 QLNIYGFHK---------VSHDHSSNDTNGGDEANTNDDSSGNKN-TSGDENNGVSVQEK 167
           QL++YGFHK         +S   SS+  N     +T  + +GN N  S  E+      ++
Sbjct: 62  QLHMYGFHKIPVLDVKNTISPLPSSDSINNTSTNSTGPEFTGNNNENSSLESMAQETDQR 121

Query: 168 ERSNPTKIWEFKHSSGIFKK 187
                + IW F H SG F K
Sbjct: 122 RTDKASTIWYFSHPSGNFYK 141

>SAKL0H02354g Chr8 complement(236815..237972) [1158 bp, 385 aa] {ON}
           some similarities with uniprot|P53050 Saccharomyces
           cerevisiae YGR249W
          Length = 385

 Score = 74.3 bits (181), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 65/130 (50%), Gaps = 28/130 (21%)

Query: 61  QNAIFIHKLYQILEDDSLHDLIWWSP-SGLSFMIKPV--ERFSKALATYFKHTNITSFVR 117
           Q   FIH+L+ IL+ + L   I+WS  S   F +KP   E  S+ L  YFKH N++SFVR
Sbjct: 2   QTKTFIHQLHGILQQEDLDQWIYWSSKSQTVFALKPYDPEFSSQVLKRYFKHGNVSSFVR 61

Query: 118 QLNIYGFHKVSHDHSSNDTNGGDEANTNDDSSGNKNTSGDENNGVSVQEKERSNPTKIWE 177
           QL++YGFHK++   SSN       ANT              NN  SV          IW 
Sbjct: 62  QLHMYGFHKIA---SSNAPQSQIAANTT------------ANNKDSV----------IWN 96

Query: 178 FKHSSGIFKK 187
           F H SG F +
Sbjct: 97  FTHPSGNFHR 106

>NDAI0D03430 Chr4 (809977..811770) [1794 bp, 597 aa] {ON} Anc_4.385
          Length = 597

 Score = 75.1 bits (183), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 52/80 (65%), Gaps = 8/80 (10%)

Query: 49  HGSKMLVGPRPPQNAIFIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFS-KALATYF 107
           HGSK         N  F+ KLY+ILE ++  +L+ W+P G SF++    +F+ + L T+F
Sbjct: 74  HGSK-------AANNDFVRKLYKILETNTFPNLVRWTPEGTSFVVLDTGKFTTQILPTHF 126

Query: 108 KHTNITSFVRQLNIYGFHKV 127
           KH+N +SFVRQLN Y FHKV
Sbjct: 127 KHSNFSSFVRQLNKYDFHKV 146

>KAFR0B04410 Chr2 (916555..917952) [1398 bp, 465 aa] {ON} Anc_5.77
           YGR249W
          Length = 465

 Score = 74.3 bits (181), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 39/71 (54%), Positives = 53/71 (74%), Gaps = 4/71 (5%)

Query: 65  FIHKLYQILEDDSLHDLIWWSP-SGLSFMIKPVE-RFS-KALATYFKHTNITSFVRQLNI 121
           FIH+L+ IL++  LH+LI WSP     F++KP +  FS + L  YFKH NI+SFVRQL++
Sbjct: 6   FIHQLHSILQEPDLHNLICWSPMENNIFLLKPHDPNFSTQVLKRYFKHGNISSFVRQLHM 65

Query: 122 YGFHKV-SHDH 131
           YGFHK+ SH+H
Sbjct: 66  YGFHKLPSHNH 76

>TPHA0H01130 Chr8 (250116..251435) [1320 bp, 439 aa] {ON} Anc_5.77
           YGR249W
          Length = 439

 Score = 73.2 bits (178), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 47/132 (35%), Positives = 71/132 (53%), Gaps = 9/132 (6%)

Query: 65  FIHKLYQILEDDSLHDLIWWSPSG-LSFMIKP-VERFS-KALATYFKHTNITSFVRQLNI 121
           F+H+L+ IL  ++L++ I+W+      F IKP   +FS K L  YFKH N++SFVRQL++
Sbjct: 6   FLHQLFSILAQENLNEWIYWTEDDDAVFAIKPYASQFSAKILKGYFKHGNVSSFVRQLHM 65

Query: 122 YGFHKVSHDHSSNDTN----GGDEANTNDDSSGNKNT--SGDENNGVSVQEKERSNPTKI 175
           YGFHK+S+ ++ +       G D + T  D      +   G     +S     +     I
Sbjct: 66  YGFHKLSNSNNRSKCQVSFLGVDNSLTASDPKIEPESPEFGKYKEKMSRPALPQDRAKTI 125

Query: 176 WEFKHSSGIFKK 187
           W F H SG+F K
Sbjct: 126 WYFTHPSGVFHK 137

>SAKL0A04576g Chr1 complement(422093..423766) [1674 bp, 557 aa] {ON}
           similar to uniprot|P10961 Saccharomyces cerevisiae
           YGL073W HSF1 Trimeric heat shock transcription factor
           activates multiple genes in response to hyperthermia
           recognizes variable heat shock elements
          Length = 557

 Score = 73.6 bits (179), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 49/78 (62%), Gaps = 1/78 (1%)

Query: 65  FIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERF-SKALATYFKHTNITSFVRQLNIYG 123
           F++KL+ ++ D S   LI WS  G SF++   E+F  + L  YFKH+N  SFVRQLN+YG
Sbjct: 166 FVNKLWSMVNDTSNQKLIHWSKDGKSFIVTKREQFVHEILPKYFKHSNFASFVRQLNMYG 225

Query: 124 FHKVSHDHSSNDTNGGDE 141
           +HKV    S +  N  DE
Sbjct: 226 WHKVQDVRSGSIQNNSDE 243

>CAGL0F08195g Chr6 (813050..814027) [978 bp, 325 aa] {ON} some
           similarities with uniprot|P53050 Saccharomyces
           cerevisiae YGR249w MGA1
          Length = 325

 Score = 72.0 bits (175), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 47/132 (35%), Positives = 69/132 (52%), Gaps = 27/132 (20%)

Query: 61  QNAIFIHKLYQILEDDSLHDLIWWSPS--GLSFMIKPV--ERFSKALATYFKHTNITSFV 116
           Q+  F+H+L+ IL D +L  +I W+    G  F++KP   E     L  YFKH N++SFV
Sbjct: 2   QHKTFVHQLHSILSDPTLTGIINWNDDEIGTVFLLKPYHPEFCDNVLKRYFKHGNVSSFV 61

Query: 117 RQLNIYGFHKVSHDHSSNDTNGGDEANTN-DDSSGNKNTSGDENNGVSVQEKERSNPTKI 175
           RQL++YGFHKV          G +  N++ ++  GNK  S  E + +            I
Sbjct: 62  RQLHMYGFHKV----------GNNSVNSHINNIEGNKIVSKKEPHFI------------I 99

Query: 176 WEFKHSSGIFKK 187
           W+F H SG F +
Sbjct: 100 WKFSHPSGNFHR 111

>YGL073W Chr7 (368753..371254) [2502 bp, 833 aa] {ON}  HSF1Trimeric
           heat shock transcription factor, activates multiple
           genes in response to stresses that include hyperthermia;
           recognizes variable heat shock elements (HSEs)
           consisting of inverted NGAAN repeats;
           posttranslationally regulated
          Length = 833

 Score = 73.9 bits (180), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 33/64 (51%), Positives = 44/64 (68%), Gaps = 1/64 (1%)

Query: 65  FIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERF-SKALATYFKHTNITSFVRQLNIYG 123
           F++KL+ +L DDS   LI W+  G SF++   E F  + L  YFKH+N  SFVRQLN+YG
Sbjct: 175 FVNKLWSMLNDDSNTKLIQWAEDGKSFIVTNREEFVHQILPKYFKHSNFASFVRQLNMYG 234

Query: 124 FHKV 127
           +HKV
Sbjct: 235 WHKV 238

>KLTH0H00814g Chr8 complement(90962..92134) [1173 bp, 390 aa] {ON}
           some similarities with uniprot|P53050 Saccharomyces
           cerevisiae YGR249W MGA1 Protein similar to heat shock
           transcription factor; multicopy suppressor of
           pseudohyphal growth defects of ammonium permease mutants
          Length = 390

 Score = 72.4 bits (176), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 45/140 (32%), Positives = 67/140 (47%), Gaps = 14/140 (10%)

Query: 61  QNAIFIHKLYQILEDDSLHDLIWWSP----SGLSFMIKPVER-FSK-ALATYFKHTNITS 114
           QN  FIH+L+ IL+   L   I W P     G+ F ++P +  FS   L  YFKH N++S
Sbjct: 2   QNKTFIHQLHAILQQPELERWIRWEPDEQLRGV-FSLRPHDAAFSTNVLKRYFKHGNVSS 60

Query: 115 FVRQLNIYGFHKVSHDHSSNDTNGGDEANTNDDSSGNKNTSGD-------ENNGVSVQEK 167
           FVRQL++YGFHK++   +   T     A +   S+G+    G             +    
Sbjct: 61  FVRQLHMYGFHKLAAPTAPTSTEPASPATSPAASAGSSVAGGGTSSADGSAGAAATTAGT 120

Query: 168 ERSNPTKIWEFKHSSGIFKK 187
           +      +W+F H SG F +
Sbjct: 121 KSGKSAVVWQFSHPSGAFCR 140

>Smik_16.58 Chr16 complement(107370..108731) [1362 bp, 453 aa] {ON}
           YGR249W (REAL)
          Length = 453

 Score = 72.4 bits (176), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 49/136 (36%), Positives = 70/136 (51%), Gaps = 31/136 (22%)

Query: 61  QNAIFIHKLYQILEDDSLHDLIWWSPS-GLSFMIKPVE-RFSK-ALATYFKHTNITSFVR 117
           Q   F+H+L+ IL +  ++  I+WSP+  + F +KP +  FS   L  YFKH N+ SFVR
Sbjct: 2   QPKTFVHQLHSILLEPEVNKWIYWSPTDNMVFFLKPYDPNFSTHVLKRYFKHGNVNSFVR 61

Query: 118 QLNIYGFHKVSHDHSSNDTNGGDEANTNDDSSGNKNTSGDENNGVSVQEKERSNPTKIWE 177
           QL++YGFHK+SH          D+ +TN+   GN            V+E         W+
Sbjct: 62  QLHMYGFHKLSHP-------SPDQVSTNN---GN------------VKELVE------WK 93

Query: 178 FKHSSGIFKKGDIEGL 193
           F H SG F K    G+
Sbjct: 94  FTHPSGFFFKEANAGV 109

>Smik_7.209 Chr7 (363136..365649) [2514 bp, 837 aa] {ON} YGL073W
           (REAL)
          Length = 837

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 33/64 (51%), Positives = 44/64 (68%), Gaps = 1/64 (1%)

Query: 65  FIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERF-SKALATYFKHTNITSFVRQLNIYG 123
           F++KL+ +L DDS   LI W+  G SF++   E F  + L  YFKH+N  SFVRQLN+YG
Sbjct: 176 FVNKLWSMLNDDSNTKLIQWAKDGKSFIVTNREEFVHQILPKYFKHSNFASFVRQLNMYG 235

Query: 124 FHKV 127
           +HKV
Sbjct: 236 WHKV 239

>TDEL0E05170 Chr5 (951579..953219) [1641 bp, 546 aa] {ON} Anc_6.209
           YGL073W
          Length = 546

 Score = 72.8 bits (177), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 53/84 (63%), Gaps = 7/84 (8%)

Query: 65  FIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERF-SKALATYFKHTNITSFVRQLNIYG 123
           F++K++ +L D+S  +LI WS  G SF++   E F  + L  YFKH+N+ SFVRQLN+YG
Sbjct: 120 FVNKVWSMLNDESNVNLIQWSKDGKSFIVVNREEFVHQILPKYFKHSNLASFVRQLNMYG 179

Query: 124 FHKVSHDHSSNDTNGGDEANTNDD 147
           +HKV       D   G   N++DD
Sbjct: 180 WHKVQ------DVKSGSIQNSSDD 197

>KNAG0F02020 Chr6 complement(384620..386935) [2316 bp, 771 aa] {ON}
           Anc_6.209 YGL073W
          Length = 771

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 50/84 (59%), Gaps = 7/84 (8%)

Query: 65  FIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERF-SKALATYFKHTNITSFVRQLNIYG 123
           F++KL+ +L D +  DLI W+  G SF++   E+F    L  YFKH+N  SFVRQLN+YG
Sbjct: 169 FVNKLWSMLNDQANLDLIRWADDGKSFIVTNREKFVHDILPKYFKHSNFASFVRQLNMYG 228

Query: 124 FHKVSHDHSSNDTNGGDEANTNDD 147
           +HKV       D   G   N+ DD
Sbjct: 229 WHKVQ------DVKSGSIQNSTDD 246

>Suva_7.544 Chr7 (943366..944775) [1410 bp, 469 aa] {ON} YGR249W
           (REAL)
          Length = 469

 Score = 72.4 bits (176), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 46/136 (33%), Positives = 66/136 (48%), Gaps = 31/136 (22%)

Query: 61  QNAIFIHKLYQILEDDSLHDLIWWSPS-GLSFMIKPVE-RFSK-ALATYFKHTNITSFVR 117
           Q   F+H+L+ IL +  ++  I+WSP+  + F +KP +  FS   L  YFKH N+ SFVR
Sbjct: 2   QPKTFVHQLHSILLEPEVNQWIYWSPTDSMVFFLKPYDPNFSTHVLKRYFKHGNVNSFVR 61

Query: 118 QLNIYGFHKVSHDHSSNDTNGGDEANTNDDSSGNKNTSGDENNGVSVQEKERSNPTKIWE 177
           QL++YGFHK+SH                      + TS +  N   + E         W+
Sbjct: 62  QLHMYGFHKLSHP-------------------SPEQTSANNGNTKELVE---------WK 93

Query: 178 FKHSSGIFKKGDIEGL 193
           F H SG F K    G+
Sbjct: 94  FTHPSGFFFKEANAGV 109

>TDEL0G01010 Chr7 complement(209613..210809) [1197 bp, 398 aa] {ON}
           Anc_5.77 YGR249W
          Length = 398

 Score = 71.6 bits (174), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 48/134 (35%), Positives = 68/134 (50%), Gaps = 30/134 (22%)

Query: 65  FIHKLYQILEDDSLHDLI-WWSPSGLSFMIKPVER-FSK-ALATYFKHTNITSFVRQLNI 121
           FIH+LY IL++  L + I W+      F++KP +  FSK  L  YFKH N++SFVRQL++
Sbjct: 6   FIHQLYAILQESQLQEWISWFKDDDSVFVLKPHDGGFSKYVLRRYFKHGNVSSFVRQLHM 65

Query: 122 YGFHKVSHDHSSNDTNGGDEANTNDDSSGNKNTSGDENNGVSVQEKERSNPTKIWEFKHS 181
           YGFHK+     +N   G  E  +  D  G++ T+                    W F H 
Sbjct: 66  YGFHKI-----TNPQEGLGEGRS--DEQGDRATTR-------------------WFFAHP 99

Query: 182 SGIFKK-GDIEGLK 194
            G F+K  D+  LK
Sbjct: 100 LGYFRKDADLASLK 113

>ZYRO0G08734g Chr7 (704684..706402) [1719 bp, 572 aa] {ON} similar
           to uniprot|P10961 Saccharomyces cerevisiae YGL073W HSF1
           Trimeric heat shock transcription factor activates
           multiple genes in response to hyperthermia recognizes
           variable heat shock elements
          Length = 572

 Score = 72.0 bits (175), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 53/85 (62%), Gaps = 7/85 (8%)

Query: 64  IFIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERF-SKALATYFKHTNITSFVRQLNIY 122
           +F++K++ +L D+S  +LI W+  G SF++   E F  + L  YFKH+N  SFVRQLN+Y
Sbjct: 112 LFVNKVWSMLNDESNGNLIRWAEDGKSFVVVNREEFVHQVLPKYFKHSNFASFVRQLNMY 171

Query: 123 GFHKVSHDHSSNDTNGGDEANTNDD 147
           G+HKV       D   G   N++DD
Sbjct: 172 GWHKVQ------DVKSGSIQNSSDD 190

>Suva_7.197 Chr7 (361661..364201) [2541 bp, 846 aa] {ON} YGL073W
           (REAL)
          Length = 846

 Score = 72.4 bits (176), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 33/64 (51%), Positives = 44/64 (68%), Gaps = 1/64 (1%)

Query: 65  FIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERF-SKALATYFKHTNITSFVRQLNIYG 123
           F++KL+ +L DDS   LI W+  G SF++   E F  + L  YFKH+N  SFVRQLN+YG
Sbjct: 176 FVNKLWSMLNDDSNTKLIQWALDGKSFIVTNREEFVHEILPKYFKHSNFASFVRQLNMYG 235

Query: 124 FHKV 127
           +HKV
Sbjct: 236 WHKV 239

>NDAI0B00940 Chr2 complement(218385..219965) [1581 bp, 526 aa] {ON}
           Anc_5.77 YGR249W
          Length = 526

 Score = 71.6 bits (174), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 66/124 (53%), Gaps = 28/124 (22%)

Query: 65  FIHKLYQILEDDSLHDLI-WWSPSGLSFMIKPVE-RFS-KALATYFKHTNITSFVRQLNI 121
           F+++L+ IL+   LH  I W+S     F++KP +  FS K L  YFKH NI+SFVRQL++
Sbjct: 6   FVNQLHLILQQKGLHQWIRWYSIEKSIFLLKPYDPNFSEKVLKKYFKHGNISSFVRQLHM 65

Query: 122 YGFHKVSHDHSSNDTNGGDEANTNDDSSGNKNTSGDENNGVSVQEKERSNPTKIWEFKHS 181
           YGFHK+S               +ND  +   N++ + NN ++           IW F H 
Sbjct: 66  YGFHKIS---------------SNDLPNSILNSNPNPNNRINT----------IWYFAHP 100

Query: 182 SGIF 185
           SG F
Sbjct: 101 SGFF 104

>YGR249W Chr7 (988049..989419) [1371 bp, 456 aa] {ON}  MGA1Protein
           similar to heat shock transcription factor; multicopy
           suppressor of pseudohyphal growth defects of ammonium
           permease mutants
          Length = 456

 Score = 71.2 bits (173), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 50/136 (36%), Positives = 69/136 (50%), Gaps = 31/136 (22%)

Query: 61  QNAIFIHKLYQILEDDSLHDLIWWSPS-GLSFMIKPVE-RFSK-ALATYFKHTNITSFVR 117
           Q   F+H+L+ IL +  ++  I+WSP+    F +KP +  FS   L  YFKH N+ SFVR
Sbjct: 2   QPKTFVHQLHAILLEPEVNKWIYWSPTDNTVFFLKPYDPNFSTHVLKRYFKHGNVNSFVR 61

Query: 118 QLNIYGFHKVSHDHSSNDTNGGDEANTNDDSSGNKNTSGDENNGVSVQEKERSNPTKIWE 177
           QL++YGFHK+SH              + D SS         NNG +V+E         W+
Sbjct: 62  QLHMYGFHKLSHP-------------SPDQSSA--------NNG-NVKELVE------WK 93

Query: 178 FKHSSGIFKKGDIEGL 193
           F H SG F K    G+
Sbjct: 94  FTHPSGFFFKEANAGI 109

>TBLA0A02000 Chr1 (482464..484347) [1884 bp, 627 aa] {ON} Anc_6.209
           YGL073W
          Length = 627

 Score = 70.9 bits (172), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 53/93 (56%), Gaps = 7/93 (7%)

Query: 52  KMLVGPRPPQNAIFIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERF-SKALATYFKHT 110
           ++L   RP     F++KL+ +L D    D+I WS  G SF++   E+F    L  YFKH+
Sbjct: 154 RVLAKTRPA----FVNKLWNMLNDPINQDMIRWSDDGKSFLVVNREKFVHHVLPNYFKHS 209

Query: 111 NITSFVRQLNIYGFHKVSHDHSS--NDTNGGDE 141
           N  SFVRQLN+YG+HKV    S   N  N  DE
Sbjct: 210 NFASFVRQLNMYGWHKVQDIRSGSMNMANNNDE 242

>Kwal_56.24036 s56 (822498..824201) [1704 bp, 567 aa] {ON} YGL073W
           (HSF1) - heat shock transcription factor [contig 166]
           FULL
          Length = 567

 Score = 70.1 bits (170), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 35/78 (44%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 65  FIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERF-SKALATYFKHTNITSFVRQLNIYG 123
           F++KL+ ++ D +   LI WS  G SF+I   E F  + L  YFKH+N  SFVRQLN+YG
Sbjct: 160 FVNKLWSMVNDSANQKLIHWSSDGKSFIITNREHFVHEILPKYFKHSNFASFVRQLNMYG 219

Query: 124 FHKVSHDHSSNDTNGGDE 141
           +HKV    S +     DE
Sbjct: 220 WHKVQDVRSGSIQGNSDE 237

>NCAS0A06450 Chr1 (1273459..1275288) [1830 bp, 609 aa] {ON}
           Anc_4.385
          Length = 609

 Score = 70.1 bits (170), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 46/137 (33%), Positives = 65/137 (47%), Gaps = 42/137 (30%)

Query: 58  RPPQNAIFIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFSK-ALATYFKHTNITSFV 116
           RPP N  F+ KLY ILE ++  D++ W+ +G +F++    +F++  L  +FKH+N  SFV
Sbjct: 50  RPPANE-FVRKLYTILEKNAYPDIVRWTENGDTFVVLDTGKFTEDILPNHFKHSNFASFV 108

Query: 117 RQLNIYGFHKVSHDHSSNDTNGGDEANTNDDSSGNKNTSGDENNGVSVQEKERSNPTKIW 176
           RQLN Y FHK+                                    V + ERS     W
Sbjct: 109 RQLNKYDFHKIKK---------------------------------KVTDVERS-----W 130

Query: 177 EFKHSSGIFKKGDIEGL 193
           EFKH S  F++   EGL
Sbjct: 131 EFKHPS--FRRHFDEGL 145

>NCAS0E03870 Chr5 (759876..761057) [1182 bp, 393 aa] {ON} Anc_5.77
          Length = 393

 Score = 69.3 bits (168), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 48/130 (36%), Positives = 66/130 (50%), Gaps = 34/130 (26%)

Query: 61  QNAIFIHKLYQILEDDSLHDLIWWSP-SGLSFMIKPVE-RFS-KALATYFKHTNITSFVR 117
           Q+  FIH+L+ IL++ +L D I WS      F++KP +  FS K L  YFKH NI+SFVR
Sbjct: 2   QHRNFIHQLHSILQEPTLDDWITWSSFDNNVFILKPYDPNFSDKVLKKYFKHGNISSFVR 61

Query: 118 QLNIYGFHKVSHDHSSNDTNGGDEANTNDDSSGNKNTSGDENNGVSVQEKERSNPTKIWE 177
           QL++YGFHK++  H++N     D+  T                              IW 
Sbjct: 62  QLHMYGFHKIATVHNNN-NVVNDKVQT------------------------------IWH 90

Query: 178 FKHSSGIFKK 187
           FKH SG F +
Sbjct: 91  FKHPSGNFTR 100

>TBLA0G02700 Chr7 (710230..711567) [1338 bp, 445 aa] {ON} 
          Length = 445

 Score = 69.7 bits (169), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 58/97 (59%), Gaps = 9/97 (9%)

Query: 52  KMLVGPRPPQNAIFIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFSK-ALATYFKHT 110
           ++L   RP     F++KL+ +L++    D+I W+  G SF++   E+F    L  YFKH+
Sbjct: 112 RVLAKTRPA----FVNKLWNMLKEPINQDMIRWNDDGKSFLVVNREKFVHHVLPNYFKHS 167

Query: 111 NITSFVRQLNIYGFHKVSHDHSSNDTNGGDEANTNDD 147
           N  SFVRQLN+YG+HKV  D  S   N    ANTND+
Sbjct: 168 NFASFVRQLNMYGWHKV-QDIRSGSMNM---ANTNDE 200

>Kpol_1033.46 s1033 (115581..117734) [2154 bp, 717 aa] {ON}
           (115581..117734) [2154 nt, 718 aa]
          Length = 717

 Score = 70.1 bits (170), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 44/64 (68%), Gaps = 1/64 (1%)

Query: 65  FIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFSKA-LATYFKHTNITSFVRQLNIYG 123
           F++K++ ++ DD+  +LI WS  GLS +I   E   +  L  YFKH+N  SFVRQLN+YG
Sbjct: 186 FVNKVWNMVNDDNNAELIRWSSDGLSIVINNREELVREILPKYFKHSNFASFVRQLNMYG 245

Query: 124 FHKV 127
           +HKV
Sbjct: 246 WHKV 249

>Ecym_5573 Chr5 (1172938..1174656) [1719 bp, 572 aa] {ON} similar to
           Ashbya gossypii AEL216C
          Length = 572

 Score = 69.7 bits (169), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 45/134 (33%), Positives = 67/134 (50%), Gaps = 10/134 (7%)

Query: 61  QNAIFIHKLYQILEDDSLHDLIWWSPSG-LSFMIKPV--ERFSKALATYFKHTNITSFVR 117
           Q   FIH+L+ +L D SL   I WS      F +KP   E   K L   FKH N++SFVR
Sbjct: 2   QPKTFIHQLHHMLNDKSLESWIRWSAEDDHIFCLKPYDPEFPGKVLKKNFKHGNVSSFVR 61

Query: 118 QLNIYGFHKVSHD----HSSNDTNGGDEANTNDDSSGNKNTSGDENNGVSVQEKERSNPT 173
           QL++YGFHK+       H++ +   G     +  ++G+  +  +E     ++  + S   
Sbjct: 62  QLHMYGFHKLQTGPNGMHTTVNAGAGAGLPASAATAGSTTSMDNEPPTHIIKSNKES--- 118

Query: 174 KIWEFKHSSGIFKK 187
            +W F H SG F K
Sbjct: 119 MVWYFTHPSGYFYK 132

>KLLA0D03322g Chr4 complement(276591..278624) [2034 bp, 677 aa] {ON}
           similar to uniprot|P10961 Saccharomyces cerevisiae
           YGL073W HSF1 Trimeric heat shock transcription factor
           activates multiple genes in response to hyperthermia
           recognizes variable heat shock elements
          Length = 677

 Score = 69.7 bits (169), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 38/83 (45%), Positives = 51/83 (61%), Gaps = 2/83 (2%)

Query: 46  VKKHGSKMLVGPRPPQNAIFIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERF-SKALA 104
           V KH SK  +     + A F++KL+ ++ D S    I WS SG S ++   ERF  + L 
Sbjct: 179 VDKHHSKKKLSTTRARPA-FVNKLWSMVNDKSNEKFIHWSTSGESIVVPNRERFVQEVLP 237

Query: 105 TYFKHTNITSFVRQLNIYGFHKV 127
            YFKH+N  SFVRQLN+YG+HKV
Sbjct: 238 KYFKHSNFASFVRQLNMYGWHKV 260

>YHR206W Chr8 (512732..514600) [1869 bp, 622 aa] {ON}  SKN7Nuclear
           response regulator and transcription factor; physically
           interacts with the Tup1-Cyc8 complex and recruits Tup1p
           to its targets; part of a branched two-component
           signaling system; required for optimal induction of
           heat-shock genes in response to oxidative stress;
           involved in osmoregulation
          Length = 622

 Score = 69.7 bits (169), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 48/74 (64%), Gaps = 2/74 (2%)

Query: 55  VGPRPPQNAIFIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFSK-ALATYFKHTNIT 113
            G + P N  F+ KL++ILE++   D++ W+ +G SF++    +F+   L  +FKH+N  
Sbjct: 78  AGAKAPANE-FVRKLFRILENNEYPDIVTWTENGKSFVVLDTGKFTTHILPNHFKHSNFA 136

Query: 114 SFVRQLNIYGFHKV 127
           SFVRQLN Y FHKV
Sbjct: 137 SFVRQLNKYDFHKV 150

>KLTH0H04290g Chr8 complement(387890..389599) [1710 bp, 569 aa] {ON}
           similar to uniprot|P10961 Saccharomyces cerevisiae
           YGL073W HSF1 Trimeric heat shock transcription factor
           activates multiple genes in response to hyperthermia
           recognizes variable heat shock elements
          Length = 569

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 35/78 (44%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 65  FIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERF-SKALATYFKHTNITSFVRQLNIYG 123
           F++KL+ ++ D +   LI WS  G SF+I   E F  + L  YFKH+N  SFVRQLN+YG
Sbjct: 161 FVNKLWSMVNDSANQKLIHWSADGKSFVITNREHFVHEILPKYFKHSNFASFVRQLNMYG 220

Query: 124 FHKVSHDHSSNDTNGGDE 141
           +HKV    S +     DE
Sbjct: 221 WHKVQDVRSGSIHGNSDE 238

>Skud_8.273 Chr8 (481627..483498) [1872 bp, 623 aa] {ON} YHR206W
           (REAL)
          Length = 623

 Score = 69.3 bits (168), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 48/73 (65%), Gaps = 2/73 (2%)

Query: 56  GPRPPQNAIFIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFSK-ALATYFKHTNITS 114
           G + P N  F+ KL++ILE++   D++ W+ +G SF++    +F+   L  +FKH+N  S
Sbjct: 79  GAKAPANE-FVRKLFRILENNEYPDIVTWTENGKSFVVLDTGKFTTHILPNHFKHSNFAS 137

Query: 115 FVRQLNIYGFHKV 127
           FVRQLN Y FHKV
Sbjct: 138 FVRQLNKYDFHKV 150

>Smik_8.296 Chr8 (487452..489329) [1878 bp, 625 aa] {ON} YHR206W
           (REAL)
          Length = 625

 Score = 68.9 bits (167), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 48/73 (65%), Gaps = 2/73 (2%)

Query: 56  GPRPPQNAIFIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFSK-ALATYFKHTNITS 114
           G + P N  F+ KL++ILE++   D++ W+ +G SF++    +F+   L  +FKH+N  S
Sbjct: 80  GSKAPANE-FVRKLFRILENNEYPDIVTWTENGKSFVVLDTGKFTTHILPNHFKHSNFAS 138

Query: 115 FVRQLNIYGFHKV 127
           FVRQLN Y FHKV
Sbjct: 139 FVRQLNKYDFHKV 151

>KNAG0M00180 Chr13 complement(22500..24347) [1848 bp, 615 aa] {ON}
           Anc_4.385 YJR147W
          Length = 615

 Score = 68.6 bits (166), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 47/71 (66%), Gaps = 2/71 (2%)

Query: 58  RPPQNAIFIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFS-KALATYFKHTNITSFV 116
           RPP N  F+ KL++ILE +   +++ W+  G SF++    +F+ + L  +FKH+N  SFV
Sbjct: 72  RPPSNE-FVRKLFKILESNIYSNIVRWTEEGDSFVVLDTGKFTTQILPNHFKHSNFASFV 130

Query: 117 RQLNIYGFHKV 127
           RQLN Y FHKV
Sbjct: 131 RQLNKYDFHKV 141

>Skud_7.582 Chr7 (962776..964134) [1359 bp, 452 aa] {ON} YGR249W
           (REAL)
          Length = 452

 Score = 67.4 bits (163), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 64/136 (47%), Gaps = 31/136 (22%)

Query: 61  QNAIFIHKLYQILEDDSLHDLIWWSPS-GLSFMIKPVE-RFS-KALATYFKHTNITSFVR 117
           Q   F+H+L+ IL +  ++  I+WS +  + F +KP +  FS + L  YFKH N+ SFVR
Sbjct: 2   QPKTFVHQLHSILLEPEVNKWIYWSSTDNVVFFLKPYDPNFSTQVLKRYFKHGNVNSFVR 61

Query: 118 QLNIYGFHKVSHDHSSNDTNGGDEANTNDDSSGNKNTSGDENNGVSVQEKERSNPTKIWE 177
           QL++YGFHK+SH                      +  S    N   + E         W+
Sbjct: 62  QLHMYGFHKLSHP-------------------SPEQASASNGNAKELVE---------WK 93

Query: 178 FKHSSGIFKKGDIEGL 193
           F H SG F K    G+
Sbjct: 94  FTHPSGFFFKEANAGI 109

>NCAS0D03780 Chr4 (702461..704743) [2283 bp, 760 aa] {ON} Anc_6.209
          Length = 760

 Score = 68.2 bits (165), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 44/64 (68%), Gaps = 1/64 (1%)

Query: 65  FIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERF-SKALATYFKHTNITSFVRQLNIYG 123
           F++KL+ ++ D++ H LI WS  G SF++     F  + L  YFKH+N  SFVRQLN+YG
Sbjct: 197 FVNKLWSMVNDEANHPLIQWSDDGKSFVVTNRGSFVHEILPKYFKHSNFASFVRQLNMYG 256

Query: 124 FHKV 127
           +HK+
Sbjct: 257 WHKI 260

>AEL216C Chr5 complement(228433..229785) [1353 bp, 450 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR249W
           (MGA1)
          Length = 450

 Score = 67.4 bits (163), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 45/134 (33%), Positives = 62/134 (46%), Gaps = 21/134 (15%)

Query: 61  QNAIFIHKLYQILEDDSLHDLIWWSPSG-LSFMIKPV--ERFSKALATYFKHTNITSFVR 117
           Q   FIH+L+ +L D SL   I WS      F +KP   E     L   FKH N++SFVR
Sbjct: 2   QPKTFIHQLHHMLSDRSLETWIRWSAEDDHIFCLKPYDPEFPGTVLKKNFKHGNVSSFVR 61

Query: 118 QLNIYGFHKVSHDHSSNDTNGGDEANTNDDSSGNKNTSGDENNGVSVQEKERSNPTKIWE 177
           QL++YGFHK+             +      SSG    +GD      + +  +   + +W 
Sbjct: 62  QLHLYGFHKL-------------QTGPGAASSG---PAGDNEPPTHIIKSNKE--SMVWY 103

Query: 178 FKHSSGIFKKGDIE 191
           F H SG F KG  +
Sbjct: 104 FTHPSGYFYKGACQ 117

>KAFR0B06990 Chr2 (1455520..1457157) [1638 bp, 545 aa] {ON}
           Anc_4.385 YJR147W
          Length = 545

 Score = 67.8 bits (164), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 43/64 (67%), Gaps = 1/64 (1%)

Query: 65  FIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFS-KALATYFKHTNITSFVRQLNIYG 123
           F+ KLY ILE++   D++ W+  G SF++    +F+ K L  +FKH+N  SFVRQLN Y 
Sbjct: 61  FVRKLYNILENNEYPDIVRWTARGDSFVVLDTGKFTTKILPNHFKHSNFASFVRQLNKYD 120

Query: 124 FHKV 127
           FHK+
Sbjct: 121 FHKI 124

>Ecym_2208 Chr2 complement(410156..411745) [1590 bp, 529 aa] {ON}
           similar to Ashbya gossypii AFL085C
          Length = 529

 Score = 67.0 bits (162), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 44/64 (68%), Gaps = 1/64 (1%)

Query: 65  FIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFS-KALATYFKHTNITSFVRQLNIYG 123
           F++KL+ ++ D +   LI W+  G SF++   E+F  + L  YFKH+N  SFVRQLN+YG
Sbjct: 214 FVNKLWSMVNDPTNQALIHWNDDGKSFIVTQREQFVHEILPKYFKHSNFASFVRQLNMYG 273

Query: 124 FHKV 127
           +HKV
Sbjct: 274 WHKV 277

>KLTH0D17182g Chr4 complement(1424948..1426342) [1395 bp, 464 aa]
           {ON} similar to uniprot|P38889 Saccharomyces cerevisiae
           YHR206W
          Length = 464

 Score = 66.2 bits (160), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 43/64 (67%), Gaps = 1/64 (1%)

Query: 65  FIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFS-KALATYFKHTNITSFVRQLNIYG 123
           F+ KL++ILE    +D+I W+  G SF++     F+ K L  +FKH+N +SFVRQLN Y 
Sbjct: 30  FVRKLFKILEGAEYNDIIRWTEDGDSFVVLNTNEFTTKILPQHFKHSNFSSFVRQLNKYD 89

Query: 124 FHKV 127
           FHK+
Sbjct: 90  FHKI 93

>Kpol_1050.79 s1050 (171402..172703) [1302 bp, 433 aa] {ON}
           (171402..172703) [1302 nt, 434 aa]
          Length = 433

 Score = 66.2 bits (160), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 47/140 (33%), Positives = 65/140 (46%), Gaps = 29/140 (20%)

Query: 65  FIHKLYQILEDDSLHDLI-WWSPSGLSFMIKPV--ERFSKALATYFKHTNITSFVRQLNI 121
           F+H+L+ +L      + I W +     F+I P   E   K L  YFKH N +SFVRQL++
Sbjct: 4   FVHQLFSMLNQPDYKEWIHWLNDEDSIFVITPYNQEFGDKVLKKYFKHGNFSSFVRQLHM 63

Query: 122 YGFHKVSHDHSSNDTNGGDEANTNDDSSGNKN-TSGDE-NNGVSVQEKERSNP------- 172
           YGF K+                 NDDS+GN + T G+E NN V ++     NP       
Sbjct: 64  YGFQKL-------------PIKNNDDSNGNVSITRGNELNNNVDIEFFNNDNPMYHIPSR 110

Query: 173 ----TKIWEFKHSSGIFKKG 188
               +  W F H SG F + 
Sbjct: 111 PKRGSTTWHFTHPSGFFHRN 130

>AFL085C Chr6 complement(279712..281421) [1710 bp, 569 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL073W
           (HSF1)
          Length = 569

 Score = 66.6 bits (161), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 35/84 (41%), Positives = 49/84 (58%), Gaps = 7/84 (8%)

Query: 65  FIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERF-SKALATYFKHTNITSFVRQLNIYG 123
           F++KL+ ++ D     LI WS  G SF++   E+F  + L  YFKH+N  SFVRQLN+YG
Sbjct: 160 FVNKLWSMVNDPVNQSLIHWSHDGKSFIVTQREQFVHEILPKYFKHSNFASFVRQLNMYG 219

Query: 124 FHKVSHDHSSNDTNGGDEANTNDD 147
           +HKV       D   G   + +DD
Sbjct: 220 WHKV------QDVKSGSIQSNSDD 237

>ZYRO0C11506g Chr3 (891756..892760) [1005 bp, 334 aa] {ON} some
           similarities with uniprot|P53050 Saccharomyces
           cerevisiae YGR249W
          Length = 334

 Score = 65.5 bits (158), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 49/68 (72%), Gaps = 5/68 (7%)

Query: 65  FIHKLYQILEDDSLHDLIWWS--PSGLSFMIKPVERF--SKALATYFKHTNITSFVRQLN 120
           FIH+L+ IL D +L + I WS    G+ F+++P +++  +  L  YFKH N++SFVRQL+
Sbjct: 6   FIHQLHAILNDATLAEWIRWSDDQDGV-FVLRPYDKWFSTLVLKRYFKHGNVSSFVRQLH 64

Query: 121 IYGFHKVS 128
           +YGFHK+S
Sbjct: 65  MYGFHKLS 72

>Suva_15.412 Chr15 (719438..721291) [1854 bp, 617 aa] {ON} YHR206W
           (REAL)
          Length = 617

 Score = 66.6 bits (161), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 44/64 (68%), Gaps = 1/64 (1%)

Query: 65  FIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFSK-ALATYFKHTNITSFVRQLNIYG 123
           F+ KL++ILE++   D++ W+ +G SF++    +F+   L  +FKH+N  SFVRQLN Y 
Sbjct: 87  FVRKLFRILENNEYPDIVTWTENGKSFVVLDTGKFTTHILPNHFKHSNFASFVRQLNKYD 146

Query: 124 FHKV 127
           FHKV
Sbjct: 147 FHKV 150

>CAGL0H03443g Chr8 (320888..323008) [2121 bp, 706 aa] {ON} weakly
           similar to uniprot|P10961 Saccharomyces cerevisiae
           YGL073w HSF1
          Length = 706

 Score = 66.6 bits (161), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 43/64 (67%), Gaps = 1/64 (1%)

Query: 65  FIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERF-SKALATYFKHTNITSFVRQLNIYG 123
           F++K++ ++ D     LI WS  GLS ++   E+F  + L  YFKH+N  SFVRQLN+YG
Sbjct: 230 FVNKVWSMINDPVNSHLIQWSEDGLSLIVVNREKFVHEILPKYFKHSNFASFVRQLNMYG 289

Query: 124 FHKV 127
           +HKV
Sbjct: 290 WHKV 293

>Kwal_47.16770 s47 (103208..104593) [1386 bp, 461 aa] {ON} YHR206W
           (SKN7) - transcription factor involved in oxidative
           stress response [contig 376] FULL
          Length = 461

 Score = 65.5 bits (158), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 42/64 (65%), Gaps = 1/64 (1%)

Query: 65  FIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFS-KALATYFKHTNITSFVRQLNIYG 123
           F+ KL++ILE     D+I W+  G SF++     F+ K L  +FKH+N +SFVRQLN Y 
Sbjct: 29  FVRKLFKILEGGEYTDIIRWTADGDSFVVLNTNEFTTKILPQHFKHSNFSSFVRQLNKYD 88

Query: 124 FHKV 127
           FHK+
Sbjct: 89  FHKI 92

>Kpol_265.2 s265 (9842..11491) [1650 bp, 549 aa] {ON} (9842..11491)
           [1650 nt, 550 aa]
          Length = 549

 Score = 65.5 bits (158), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 44/69 (63%), Gaps = 1/69 (1%)

Query: 60  PQNAIFIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERF-SKALATYFKHTNITSFVRQ 118
           PQ+  F+ K+Y ILE     D++ W+ +G SF++     F S+ L  +FKH+N  SFVRQ
Sbjct: 82  PQSNEFVRKIYGILERGDYPDIVRWTENGDSFVVLDTGSFTSQILPNHFKHSNFASFVRQ 141

Query: 119 LNIYGFHKV 127
           LN Y FHKV
Sbjct: 142 LNKYDFHKV 150

>NDAI0I01110 Chr9 complement(267274..269991) [2718 bp, 905 aa] {ON}
           Anc_6.209
          Length = 905

 Score = 65.9 bits (159), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 43/64 (67%), Gaps = 1/64 (1%)

Query: 65  FIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERF-SKALATYFKHTNITSFVRQLNIYG 123
           F++K++ ++ D     LI WS  G SF+++  E F  + L  YFKH+N  SFVRQLN+YG
Sbjct: 266 FVNKVWSMINDPVNKGLINWSDDGRSFIVQNRENFVHEVLPKYFKHSNFASFVRQLNMYG 325

Query: 124 FHKV 127
           +HKV
Sbjct: 326 WHKV 329

>TDEL0D00320 Chr4 complement(53243..54886) [1644 bp, 547 aa] {ON}
           Anc_4.385 YJR147W
          Length = 547

 Score = 65.1 bits (157), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 42/64 (65%), Gaps = 1/64 (1%)

Query: 65  FIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFS-KALATYFKHTNITSFVRQLNIYG 123
           F+ KLY ILE     D++ W+ +G SF++    +F+ + L  +FKH+N  SFVRQLN Y 
Sbjct: 34  FVRKLYGILERCEYPDIVRWTETGESFVVLDTGKFTTQILPNHFKHSNFASFVRQLNKYD 93

Query: 124 FHKV 127
           FHKV
Sbjct: 94  FHKV 97

>KLLA0A10219g Chr1 (896931..898358) [1428 bp, 475 aa] {ON} similar
           to uniprot|Q75BF2 Ashbya gossypii ADL388W ADL388Wp and
           some similarites with YHR206W uniprot|P38889
           Saccharomyces cerevisiae
          Length = 475

 Score = 65.1 bits (157), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 41/64 (64%), Gaps = 1/64 (1%)

Query: 65  FIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFS-KALATYFKHTNITSFVRQLNIYG 123
           F+ KL+ ILE +    +I WSP G +F++    +F+   L  +FKH+N  SFVRQLN Y 
Sbjct: 43  FVRKLFLILESEEYTSIISWSPDGKNFIVLDTNKFTTDILPKHFKHSNFASFVRQLNKYD 102

Query: 124 FHKV 127
           FHKV
Sbjct: 103 FHKV 106

>SAKL0B12408g Chr2 (1065161..1066558) [1398 bp, 465 aa] {ON} similar
           to uniprot|Q75BF2 Ashbya gossypii ADL388W ADL388Wp and
           weakly similar to YHR206W uniprot|P38889 Saccharomyces
           cerevisiae
          Length = 465

 Score = 64.7 bits (156), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 41/64 (64%), Gaps = 1/64 (1%)

Query: 65  FIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFS-KALATYFKHTNITSFVRQLNIYG 123
           F+ KL+ ILE     D++ W+ +G SF++     F+ K L  +FKH+N  SFVRQLN Y 
Sbjct: 26  FVRKLFNILEGGEYTDIVCWTETGDSFVVLNTNDFTTKILPKHFKHSNFASFVRQLNKYD 85

Query: 124 FHKV 127
           FHKV
Sbjct: 86  FHKV 89

>TBLA0A10700 Chr1 (2646036..2647799) [1764 bp, 587 aa] {ON}
           Anc_4.385 YJR147W
          Length = 587

 Score = 65.1 bits (157), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 41/64 (64%), Gaps = 1/64 (1%)

Query: 65  FIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERF-SKALATYFKHTNITSFVRQLNIYG 123
           F+  +Y ILE +   D+I WS  G SF++    +F S+ L  +FKH+N  SFVRQLN Y 
Sbjct: 67  FVRIIYGILEREDYPDIITWSEKGDSFLVLDTGKFTSQILPNHFKHSNFASFVRQLNKYD 126

Query: 124 FHKV 127
           FHKV
Sbjct: 127 FHKV 130

>CAGL0F09097g Chr6 (898706..900598) [1893 bp, 630 aa] {ON} similar
           to uniprot|P38889 Saccharomyces cerevisiae YHR206w SKN7
           transcription factor
          Length = 630

 Score = 65.1 bits (157), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 28/64 (43%), Positives = 43/64 (67%), Gaps = 1/64 (1%)

Query: 65  FIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFS-KALATYFKHTNITSFVRQLNIYG 123
           F+ KL+ ILE +   +++ WS +G SF++    +F+ + L  +FKH+N  SFVRQLN Y 
Sbjct: 77  FVRKLFNILESNQYSNIVRWSNTGDSFVVLDTGKFTTQILPNHFKHSNFASFVRQLNKYD 136

Query: 124 FHKV 127
           FHK+
Sbjct: 137 FHKI 140

>ADL388W Chr4 (30355..31803) [1449 bp, 482 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YHR206W (SKN7) and YJR147W
           (HMS2)
          Length = 482

 Score = 63.9 bits (154), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 43/73 (58%), Gaps = 2/73 (2%)

Query: 56  GPRPPQNAIFIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFSK-ALATYFKHTNITS 114
           G R   N  F+ KL+ ILE     D+I W+  G SF++     F+   L  +FKH+N +S
Sbjct: 30  GSRAAYND-FVRKLFAILESGEYTDIISWTKEGNSFVVVDTNEFTTNILPKHFKHSNFSS 88

Query: 115 FVRQLNIYGFHKV 127
           FVRQLN Y FHKV
Sbjct: 89  FVRQLNKYDFHKV 101

>TPHA0E02880 Chr5 complement(603237..605393) [2157 bp, 718 aa] {ON}
           Anc_6.209 YGL073W
          Length = 718

 Score = 64.3 bits (155), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 28/64 (43%), Positives = 42/64 (65%), Gaps = 1/64 (1%)

Query: 65  FIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFSKA-LATYFKHTNITSFVRQLNIYG 123
           F++K++ ++ D S + LI W+  G SF +   E   +  L  YFKH+N  SFVRQLN+YG
Sbjct: 171 FVNKVWNMINDPSNNQLIQWADDGKSFFVTNKEDLIREILPKYFKHSNFASFVRQLNMYG 230

Query: 124 FHKV 127
           +HK+
Sbjct: 231 WHKI 234

>ZYRO0G00484g Chr7 complement(35793..37736) [1944 bp, 647 aa] {ON}
           similar to uniprot|P38889 Saccharomyces cerevisiae
           YHR206W
          Length = 647

 Score = 63.9 bits (154), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 41/64 (64%), Gaps = 1/64 (1%)

Query: 65  FIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFS-KALATYFKHTNITSFVRQLNIYG 123
           F+ KL+ ILE     D++ W+  G SF++    +F+ + L  +FKH+N  SFVRQLN Y 
Sbjct: 44  FVRKLFGILERCEYPDIVRWTEKGESFVVLDTGKFTTQILPNHFKHSNFASFVRQLNKYD 103

Query: 124 FHKV 127
           FHKV
Sbjct: 104 FHKV 107

>TPHA0C00150 Chr3 complement(15029..16561) [1533 bp, 510 aa] {ON}
           Anc_4.385 YJR147W
          Length = 510

 Score = 63.5 bits (153), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 42/64 (65%), Gaps = 1/64 (1%)

Query: 65  FIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERF-SKALATYFKHTNITSFVRQLNIYG 123
           F+ K+Y ILE     +++ W+ +G SF++    +F S+ L  +FKH+N  SFVRQLN Y 
Sbjct: 51  FVRKIYSILEGGEYPEIVTWTEAGDSFVVVDTGKFTSQILPNHFKHSNFASFVRQLNKYD 110

Query: 124 FHKV 127
           FHKV
Sbjct: 111 FHKV 114

>Ecym_7474 Chr7 (967242..968732) [1491 bp, 496 aa] {ON} similar to
           Ashbya gossypii ADL388W
          Length = 496

 Score = 62.4 bits (150), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 43/73 (58%), Gaps = 2/73 (2%)

Query: 56  GPRPPQNAIFIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFSK-ALATYFKHTNITS 114
           G R   N  F+ KL+ ILE     ++I W+  G SF++     F+   L  +FKH+N +S
Sbjct: 35  GTRAAYND-FVRKLFAILESGEYTNIISWTKDGNSFVVVDTNEFTTNILPKHFKHSNFSS 93

Query: 115 FVRQLNIYGFHKV 127
           FVRQLN Y FHKV
Sbjct: 94  FVRQLNKYDFHKV 106

>TBLA0E04980 Chr5 (1275927..1278302) [2376 bp, 791 aa] {ON}
           Anc_4.385 YJR147W
          Length = 791

 Score = 61.2 bits (147), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 27/65 (41%), Positives = 40/65 (61%), Gaps = 1/65 (1%)

Query: 64  IFIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERF-SKALATYFKHTNITSFVRQLNIY 122
           +F+  L+ ILED+   ++I W+  G  F++     F S  L  +F H+N  SFVRQLN +
Sbjct: 34  LFVKTLFNILEDEKYQNIIKWTEKGDRFVVIDAGLFTSDILPIHFNHSNFASFVRQLNKF 93

Query: 123 GFHKV 127
           GFHK+
Sbjct: 94  GFHKI 98

>Suva_12.241 Chr12 (384063..385112) [1050 bp, 349 aa] {ON} YJR147W
           (REAL)
          Length = 349

 Score = 50.8 bits (120), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 44/76 (57%), Gaps = 2/76 (2%)

Query: 64  IFIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFSKALATYFKHT--NITSFVRQLNI 121
           +F+ KL+Q+L+ ++  ++I W P G  F+I   ++F+K +   F  +  +  SFVRQL+ 
Sbjct: 6   VFVSKLFQLLQSNAYSEIIQWLPDGTRFVIWNTDQFAKVILKRFFPSLPSFASFVRQLSK 65

Query: 122 YGFHKVSHDHSSNDTN 137
           Y F K+   H    +N
Sbjct: 66  YEFQKMERLHGKEFSN 81

>Skud_10.373 Chr10 (662167..663207) [1041 bp, 346 aa] {ON} YJR147W
           (REAL)
          Length = 346

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 42/75 (56%), Gaps = 1/75 (1%)

Query: 64  IFIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFSKA-LATYFKHTNITSFVRQLNIY 122
           +F+ KL+ +L+ ++   +I WS  G  F+I   E+F+K  L  +F  ++ T+FV+QL+ Y
Sbjct: 6   VFVSKLFHLLQSNAYSSIIQWSSDGSRFIIWDPEQFTKVILERFFSLSSYTAFVKQLSKY 65

Query: 123 GFHKVSHDHSSNDTN 137
            F K    H     N
Sbjct: 66  SFQKTKRPHCEEFFN 80

>YJR147W Chr10 (704196..705272) [1077 bp, 358 aa] {ON}  HMS2Protein
           with similarity to heat shock transcription factors;
           overexpression suppresses the pseudohyphal filamentation
           defect of a diploid mep1 mep2 homozygous null mutant
          Length = 358

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 39/70 (55%), Gaps = 1/70 (1%)

Query: 58  RPPQNAIFIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFSKA-LATYFKHTNITSFV 116
           R  Q  +F+ KLY +L+ ++  ++I WS  G   +I   ++F+K  L  +F      +FV
Sbjct: 6   RMEQPDVFVSKLYHLLQGNAYSNIIQWSTDGSKLVIWNPDQFTKVILERFFGIHTFAAFV 65

Query: 117 RQLNIYGFHK 126
           +QL+ Y F K
Sbjct: 66  KQLSKYNFQK 75

>Smik_10.442 Chr10 (693234..694277) [1044 bp, 347 aa] {ON} YJR147W
           (REAL)
          Length = 347

 Score = 40.0 bits (92), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 31/125 (24%), Positives = 51/125 (40%), Gaps = 16/125 (12%)

Query: 65  FIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFSKA-LATYFKHTNITSFVRQLNIYG 123
           F+  L++IL+ ++   +I WS  G  F+I   ++F+K  L  +F   +  +F +QL+ Y 
Sbjct: 7   FLSILFEILQGNAYSSIIQWSADGSKFIIWNPDQFTKVILERFFSIASFAAFAKQLSKYK 66

Query: 124 FHK--------VSHDHSSND-------TNGGDEANTNDDSSGNKNTSGDENNGVSVQEKE 168
           F K         SH H   D          G  A+T +          D     S+  K 
Sbjct: 67  FQKTKRPRCVEFSHVHFQRDNVASLLLVKAGKSASTVNKPDKQCGFHWDSFKANSILSKA 126

Query: 169 RSNPT 173
              P+
Sbjct: 127 IGKPS 131

>TPHA0L01980 Chr12 (414853..416523) [1671 bp, 556 aa] {ON} Anc_2.639
           YMR068W
          Length = 556

 Score = 33.1 bits (74), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 22/37 (59%), Gaps = 2/37 (5%)

Query: 550 APSPIYPINEPTTRLYSQPKMRSLGSTSSLPNDRKNS 586
            PSPIY +N PT  LYSQ  +  L + S + N R+ S
Sbjct: 228 GPSPIYSLNSPTVSLYSQANV--LNNLSRISNGRRAS 262

>TPHA0C03710 Chr3 complement(809578..812016) [2439 bp, 812 aa] {ON}
           Anc_2.353 YMR160W
          Length = 812

 Score = 32.3 bits (72), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 37/70 (52%), Gaps = 5/70 (7%)

Query: 102 ALATY-FKHTNITSFVRQLN--IYGFHKVSHDHSSNDTNGGDEANTNDDSSGNKNTSGDE 158
            LAT+  K  N+  F +Q N  I  F      +   D N   +   N+D++ NKNT+ +E
Sbjct: 329 VLATHILKRHNVLDFNKQTNVGILAFESNLEGYRFWDHNS--DLKQNEDTTSNKNTATNE 386

Query: 159 NNGVSVQEKE 168
           +N +S Q+KE
Sbjct: 387 SNNISEQDKE 396

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.127    0.368 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 76,870,103
Number of extensions: 3488179
Number of successful extensions: 23748
Number of sequences better than 10.0: 248
Number of HSP's gapped: 23445
Number of HSP's successfully gapped: 285
Length of query: 762
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 645
Effective length of database: 40,065,477
Effective search space: 25842232665
Effective search space used: 25842232665
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 70 (31.6 bits)