Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_15.3185.475ON67265133030.0
YOR138C (RUP1)5.475ON67165228010.0
Skud_15.3025.475ON67865527750.0
Suva_8.1905.475ON66665126230.0
Kpol_543.95.475ON64265014510.0
TDEL0A033905.475ON62265514330.0
TPHA0J027805.475ON63166514040.0
KAFR0E025405.475ON65967413680.0
NCAS0H022705.475ON69668513611e-179
SAKL0G03564g5.475ON60564513001e-171
NDAI0C013905.475ON70955710901e-139
Kwal_55.212675.475ON60465010631e-136
TBLA0A025405.475ON67869810651e-135
KLTH0F15004g5.475ON59750310551e-135
KNAG0B040505.475ON67367610071e-127
ZYRO0D11264g5.475ON5474939561e-121
CAGL0I07205g5.475ON6036459271e-116
TBLA0B022305.475ON7905198741e-106
KLLA0E03169g5.475ON5445006262e-72
Smik_5.3088.185ON42835930.012
YER143W (DDI1)8.185ON42835860.093
Skud_5.2808.185ON42835840.17
NCAS0I016203.270ON79568840.20
NDAI0C058908.185ON46233810.37
KLTH0F08382g8.402ON65760800.50
KLLA0F18700g3.270ON77073780.88
Ecym_71787.488ON126936780.89
NDAI0C06330na 1ON35569751.6
KLLA0E10341g8.185ON41433751.6
Suva_5.2718.185ON42835751.8
Kpol_1013.697.488ON124436752.2
KAFR0C004103.270ON76952733.5
AGR023C3.270ON78037734.1
Kpol_1028.897.488ON87736734.1
KAFR0B023008.185ON41634724.3
KNAG0A046608.402ON71365724.8
Suva_2.707.488ON138034725.8
NCAS0A039208.185ON47233706.7
Kpol_526.238.185ON42334706.9
Skud_8.332.546ON49352708.2
KNAG0G015808.185ON40634699.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_15.318
         (672 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_15.318 Chr15 complement(545721..547739) [2019 bp, 672 aa] {...  1276   0.0  
YOR138C Chr15 complement(584309..586324) [2016 bp, 671 aa] {ON} ...  1083   0.0  
Skud_15.302 Chr15 complement(538346..540382) [2037 bp, 678 aa] {...  1073   0.0  
Suva_8.190 Chr8 complement(339480..341480) [2001 bp, 666 aa] {ON...  1014   0.0  
Kpol_543.9 s543 complement(22643..24571) [1929 bp, 642 aa] {ON} ...   563   0.0  
TDEL0A03390 Chr1 complement(603062..604930) [1869 bp, 622 aa] {O...   556   0.0  
TPHA0J02780 Chr10 complement(619045..620940) [1896 bp, 631 aa] {...   545   0.0  
KAFR0E02540 Chr5 (519567..521546) [1980 bp, 659 aa] {ON} Anc_5.4...   531   0.0  
NCAS0H02270 Chr8 complement(445144..447234) [2091 bp, 696 aa] {O...   528   e-179
SAKL0G03564g Chr7 complement(294308..296125) [1818 bp, 605 aa] {...   505   e-171
NDAI0C01390 Chr3 (290301..292430) [2130 bp, 709 aa] {ON} Anc_5.4...   424   e-139
Kwal_55.21267 s55 (757685..759499) [1815 bp, 604 aa] {ON} YOR138...   414   e-136
TBLA0A02540 Chr1 (613560..615596) [2037 bp, 678 aa] {ON} Anc_5.4...   414   e-135
KLTH0F15004g Chr6 (1228654..1230447) [1794 bp, 597 aa] {ON} weak...   410   e-135
KNAG0B04050 Chr2 (776430..778451) [2022 bp, 673 aa] {ON} Anc_5.4...   392   e-127
ZYRO0D11264g Chr4 complement(948942..950585) [1644 bp, 547 aa] {...   372   e-121
CAGL0I07205g Chr9 (694434..696245) [1812 bp, 603 aa] {ON} simila...   361   e-116
TBLA0B02230 Chr2 (521358..523730) [2373 bp, 790 aa] {ON} Anc_5.4...   341   e-106
KLLA0E03169g Chr5 complement(292918..294552) [1635 bp, 544 aa] {...   245   2e-72
Smik_5.308 Chr5 (461464..462750) [1287 bp, 428 aa] {ON} YER143W ...    40   0.012
YER143W Chr5 (456319..457605) [1287 bp, 428 aa] {ON}  DDI1DNA da...    38   0.093
Skud_5.280 Chr5 (446952..448238) [1287 bp, 428 aa] {ON} YER143W ...    37   0.17 
NCAS0I01620 Chr9 complement(299269..301656) [2388 bp, 795 aa] {O...    37   0.20 
NDAI0C05890 Chr3 (1349126..1350514) [1389 bp, 462 aa] {ON} Anc_8...    36   0.37 
KLTH0F08382g Chr6 (724794..726767) [1974 bp, 657 aa] {ON} simila...    35   0.50 
KLLA0F18700g Chr6 (1718738..1721050) [2313 bp, 770 aa] {ON} simi...    35   0.88 
Ecym_7178 Chr7 (363600..367409) [3810 bp, 1269 aa] {ON} similar ...    35   0.89 
NDAI0C06330 Chr3 (1470554..1471621) [1068 bp, 355 aa] {ON}             33   1.6  
KLLA0E10341g Chr5 complement(911148..912392) [1245 bp, 414 aa] {...    33   1.6  
Suva_5.271 Chr5 (427633..428919) [1287 bp, 428 aa] {ON} YER143W ...    33   1.8  
Kpol_1013.69 s1013 complement(167435..171169) [3735 bp, 1244 aa]...    33   2.2  
KAFR0C00410 Chr3 complement(85302..87611) [2310 bp, 769 aa] {ON}...    33   3.5  
AGR023C Chr7 complement(756961..759303) [2343 bp, 780 aa] {ON} S...    33   4.1  
Kpol_1028.89 s1028 complement(197927..200560) [2634 bp, 877 aa] ...    33   4.1  
KAFR0B02300 Chr2 (451471..452721) [1251 bp, 416 aa] {ON} Anc_8.1...    32   4.3  
KNAG0A04660 Chr1 (663566..665707) [2142 bp, 713 aa] {ON} Anc_8.4...    32   4.8  
Suva_2.70 Chr2 complement(125732..129874) [4143 bp, 1380 aa] {ON...    32   5.8  
NCAS0A03920 Chr1 complement(793999..795417) [1419 bp, 472 aa] {O...    32   6.7  
Kpol_526.23 s526 (62128..63399) [1272 bp, 423 aa] {ON} (62128..6...    32   6.9  
Skud_8.33 Chr8 (66983..68464) [1482 bp, 493 aa] {ON} YHL012W (REAL)    32   8.2  
KNAG0G01580 Chr7 (352916..354136) [1221 bp, 406 aa] {ON} Anc_8.1...    31   9.1  

>Smik_15.318 Chr15 complement(545721..547739) [2019 bp, 672 aa] {ON}
           YOR138C (REAL)
          Length = 672

 Score = 1276 bits (3303), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 620/651 (95%), Positives = 620/651 (95%)

Query: 1   MMDNQAVKSLLEMGIPHEVAVEALQRTGGNLEAAVNFIFSNELPDQGSMSTENNVELPRI 60
           MMDNQAVKSLLEMGIPHEVAVEALQRTGGNLEAAVNFIFSNELPDQGSMSTENNVELPRI
Sbjct: 1   MMDNQAVKSLLEMGIPHEVAVEALQRTGGNLEAAVNFIFSNELPDQGSMSTENNVELPRI 60

Query: 61  SENRIMAGNSYDVPNNGEQXXXXXXXXXXXXXXXXXXXXXXXRSGSNSTNEYRRAAQEYD 120
           SENRIMAGNSYDVPNNGEQ                       RSGSNSTNEYRRAAQEYD
Sbjct: 61  SENRIMAGNSYDVPNNGEQDVDMPDVGGVDVDYDDDEDITDDRSGSNSTNEYRRAAQEYD 120

Query: 121 HYSVSETSIPPPSYNIVQHNEFKSTMDDPTVVLPLPLNSLIESYFGLFALLVSVYFPHVF 180
           HYSVSETSIPPPSYNIVQHNEFKSTMDDPTVVLPLPLNSLIESYFGLFALLVSVYFPHVF
Sbjct: 121 HYSVSETSIPPPSYNIVQHNEFKSTMDDPTVVLPLPLNSLIESYFGLFALLVSVYFPHVF 180

Query: 181 LKPDFQDLNFRPDWFKGTSFTEPKYRIAYREADDGSTTSDIVLASGPSDELQPHLLWQLQ 240
           LKPDFQDLNFRPDWFKGTSFTEPKYRIAYREADDGSTTSDIVLASGPSDELQPHLLWQLQ
Sbjct: 181 LKPDFQDLNFRPDWFKGTSFTEPKYRIAYREADDGSTTSDIVLASGPSDELQPHLLWQLQ 240

Query: 241 KLISVVNTRMCERAFVSAKLFTLSLEPQLKSKLANSEHLYEVLPAFIKSLAVDLEMCPGI 300
           KLISVVNTRMCERAFVSAKLFTLSLEPQLKSKLANSEHLYEVLPAFIKSLAVDLEMCPGI
Sbjct: 241 KLISVVNTRMCERAFVSAKLFTLSLEPQLKSKLANSEHLYEVLPAFIKSLAVDLEMCPGI 300

Query: 301 RDQETRNLFISSALHTPNKNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLYPXXXXXXXX 360
           RDQETRNLFISSALHTPNKNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLYP        
Sbjct: 301 RDQETRNLFISSALHTPNKNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLYPEEEEEEEE 360

Query: 361 VIRRGGTGQEEERYVEPENTLKEVAPVLTILFNELETNTESVTLPNGVDMPLEFYPQLYT 420
           VIRRGGTGQEEERYVEPENTLKEVAPVLTILFNELETNTESVTLPNGVDMPLEFYPQLYT
Sbjct: 361 VIRRGGTGQEEERYVEPENTLKEVAPVLTILFNELETNTESVTLPNGVDMPLEFYPQLYT 420

Query: 421 KRCKDQLIRHIISKRKQARVRSRYLLEEISALKSYQGKNTFTILESTLAYLQESPDDANN 480
           KRCKDQLIRHIISKRKQARVRSRYLLEEISALKSYQGKNTFTILESTLAYLQESPDDANN
Sbjct: 421 KRCKDQLIRHIISKRKQARVRSRYLLEEISALKSYQGKNTFTILESTLAYLQESPDDANN 480

Query: 481 EAASQIASLKDTLNSMRSAKMEEYKDLASKLHGEWNLSHPETHIINTAKQLGLIENPYVL 540
           EAASQIASLKDTLNSMRSAKMEEYKDLASKLHGEWNLSHPETHIINTAKQLGLIENPYVL
Sbjct: 481 EAASQIASLKDTLNSMRSAKMEEYKDLASKLHGEWNLSHPETHIINTAKQLGLIENPYVL 540

Query: 541 TMAAISPYSYFIRNRNGVWSWIQSNTLGTEFKVNKCSSASVVQEAIRHGTKYASEMPLMF 600
           TMAAISPYSYFIRNRNGVWSWIQSNTLGTEFKVNKCSSASVVQEAIRHGTKYASEMPLMF
Sbjct: 541 TMAAISPYSYFIRNRNGVWSWIQSNTLGTEFKVNKCSSASVVQEAIRHGTKYASEMPLMF 600

Query: 601 IYCEEGKIPTEEVVEKALDSNNGCSKFAKDDQSSLRTLHSQFIDGIDNAEQ 651
           IYCEEGKIPTEEVVEKALDSNNGCSKFAKDDQSSLRTLHSQFIDGIDNAEQ
Sbjct: 601 IYCEEGKIPTEEVVEKALDSNNGCSKFAKDDQSSLRTLHSQFIDGIDNAEQ 651

>YOR138C Chr15 complement(584309..586324) [2016 bp, 671 aa] {ON}
           RUP1Protein involved in regulation of Rsp5p, which is an
           essential HECT ubiquitin ligase; has a WW domain
           consensus motif of PPPSY (residues 131-135) that
           mediates binding of Rsp5p to Ubp2p; contains an UBA
           domain
          Length = 671

 Score = 1083 bits (2801), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 530/652 (81%), Positives = 571/652 (87%), Gaps = 3/652 (0%)

Query: 1   MMDNQAVKSLLEMGIPHEVAVEALQRTGGNLEAAVNFIFSNELPDQGSMSTENNVELPRI 60
           MMDNQAVKSLLEMGIPHEVAV+ALQRTGGNLEAAVNFIFSNELP+Q  M  EN+   PRI
Sbjct: 1   MMDNQAVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIFSNELPEQAEMGEENDGSQPRI 60

Query: 61  SENRIMAGNS-YDVPNNGEQXXXXXXXXXXXXXXXXXXXXXXXRSGSNSTNEYRRAAQEY 119
           SEN+I+AG    DVPNNG+Q                       RSGSNST+  R  AQ Y
Sbjct: 61  SENKIVAGTKPCDVPNNGDQDIDMPDVSGVDVDYDDDEDITDERSGSNSTSGCRVTAQNY 120

Query: 120 DHYSVSETSIPPPSYNIVQHNEFKSTMDDPTVVLPLPLNSLIESYFGLFALLVSVYFPHV 179
           D YS+SETSIPPPSY+IVQHNEFKS + DPTVVLPLPLNSLIESYFGLFALL +VYFPHV
Sbjct: 121 DRYSISETSIPPPSYSIVQHNEFKSNVGDPTVVLPLPLNSLIESYFGLFALLTAVYFPHV 180

Query: 180 FLKPDFQDLNFRPDWFKGTSFTEPKYRIAYREADDGSTTSDIVLASGPSDELQPHLLWQL 239
           FLKPDF+DLN+R DWFKG+SFTEPKYR+AY EA+DGSTTS+IVLASGP++ LQPHLLWQL
Sbjct: 181 FLKPDFKDLNYRADWFKGSSFTEPKYRLAYCEAEDGSTTSEIVLASGPNEGLQPHLLWQL 240

Query: 240 QKLISVVNTRMCERAFVSAKLFTLSLEPQLKSKLANSEHLYEVLPAFIKSLAVDLEMCPG 299
           QKLISVVNTR CERAFVSAK+FT SLEPQL+SKLA+SEHLYEVLPAFIKSLAVDLEMCPG
Sbjct: 241 QKLISVVNTRKCERAFVSAKVFTSSLEPQLRSKLADSEHLYEVLPAFIKSLAVDLEMCPG 300

Query: 300 IRDQETRNLFISSALHTPNKNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLYPXXXXXXX 359
           IRD+ETR+LFISSALHTPNKNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLYP       
Sbjct: 301 IRDRETRSLFISSALHTPNKNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLYPEEEEEEE 360

Query: 360 XVIRRGGTGQEEERYVEPENTLKEVAPVLTILFNELETNTESVTLPNGVDMPLEFYPQLY 419
            VIR  G  QEE RYVEPENTLKEVAPVLTILFNELETNTESV+LPNGVD+PLEFYPQLY
Sbjct: 361 DVIR--GGEQEEARYVEPENTLKEVAPVLTILFNELETNTESVSLPNGVDIPLEFYPQLY 418

Query: 420 TKRCKDQLIRHIISKRKQARVRSRYLLEEISALKSYQGKNTFTILESTLAYLQESPDDAN 479
           TK+CKDQLIRHIISKRKQAR RSR LL+EI+ LKSYQGKN  TILESTLAYLQ  PDDAN
Sbjct: 419 TKQCKDQLIRHIISKRKQARTRSRCLLQEINELKSYQGKNISTILESTLAYLQTIPDDAN 478

Query: 480 NEAASQIASLKDTLNSMRSAKMEEYKDLASKLHGEWNLSHPETHIINTAKQLGLIENPYV 539
           NEAA QIASLKDTLNS R+AKMEEYKDLASKLHGEWNLSHPETHIINTAKQLGLIENPY+
Sbjct: 479 NEAAKQIASLKDTLNSARAAKMEEYKDLASKLHGEWNLSHPETHIINTAKQLGLIENPYI 538

Query: 540 LTMAAISPYSYFIRNRNGVWSWIQSNTLGTEFKVNKCSSASVVQEAIRHGTKYASEMPLM 599
           LTMAA+SPYSYFIR+RNG WSWIQSNTLGTEFKV KCSS SVVQEAI+HGTKYASE PLM
Sbjct: 539 LTMAALSPYSYFIRSRNGAWSWIQSNTLGTEFKVKKCSSPSVVQEAIKHGTKYASETPLM 598

Query: 600 FIYCEEGKIPTEEVVEKALDSNNGCSKFAKDDQSSLRTLHSQFIDGIDNAEQ 651
           FIYCEEGKIPTEEVV +AL SN+GC KFA+DDQ+SL+TL SQF DG+ + EQ
Sbjct: 599 FIYCEEGKIPTEEVVAEALKSNSGCLKFAEDDQNSLKTLRSQFFDGMGDPEQ 650

>Skud_15.302 Chr15 complement(538346..540382) [2037 bp, 678 aa] {ON}
           YOR138C (REAL)
          Length = 678

 Score = 1073 bits (2775), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 519/655 (79%), Positives = 564/655 (86%), Gaps = 4/655 (0%)

Query: 1   MMDNQAVKSLLEMGIPHEVAVEALQRTGGNLEAAVNFIFSNELPDQGSMSTENNVELPRI 60
           MMDNQAVKSLLEMGIPHEVA++AL RTGGNLEAAVNFIFSNELP+Q     E     PRI
Sbjct: 1   MMDNQAVKSLLEMGIPHEVAMDALHRTGGNLEAAVNFIFSNELPEQADTGGEGGAGQPRI 60

Query: 61  SENRIMAG-NSYDVPNNGEQX---XXXXXXXXXXXXXXXXXXXXXXRSGSNSTNEYRRAA 116
           SENR+MAG NSYDVPN+G+Q                           SGS+S+NE   AA
Sbjct: 61  SENRMMAGSNSYDVPNSGDQEDIDMADVAGGEADYDDEDDEDITENHSGSSSSNERGPAA 120

Query: 117 QEYDHYSVSETSIPPPSYNIVQHNEFKSTMDDPTVVLPLPLNSLIESYFGLFALLVSVYF 176
           ++YDHYS+SETSI PPSYNIVQ NEFK  +DDPTVVLPLPLNSLIESYFGLFALLVSVYF
Sbjct: 121 RDYDHYSISETSIAPPSYNIVQQNEFKCAVDDPTVVLPLPLNSLIESYFGLFALLVSVYF 180

Query: 177 PHVFLKPDFQDLNFRPDWFKGTSFTEPKYRIAYREADDGSTTSDIVLASGPSDELQPHLL 236
           PHVFLKPDFQDLN+ PDWFKG+SFT PKYR+AYREADDGS TS+IVLASG SD+LQP LL
Sbjct: 181 PHVFLKPDFQDLNYSPDWFKGSSFTGPKYRLAYREADDGSATSEIVLASGSSDDLQPRLL 240

Query: 237 WQLQKLISVVNTRMCERAFVSAKLFTLSLEPQLKSKLANSEHLYEVLPAFIKSLAVDLEM 296
           WQLQKLISV+NTRMCERAFVSA+LFTLSLEPQLKSKLA+SEHLYEVLP FIKSLAVDLEM
Sbjct: 241 WQLQKLISVINTRMCERAFVSARLFTLSLEPQLKSKLADSEHLYEVLPTFIKSLAVDLEM 300

Query: 297 CPGIRDQETRNLFISSALHTPNKNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLYPXXXX 356
           CPGIRD+ETRNLFISSALHTPNKNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLYP    
Sbjct: 301 CPGIRDRETRNLFISSALHTPNKNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLYPEEEN 360

Query: 357 XXXXVIRRGGTGQEEERYVEPENTLKEVAPVLTILFNELETNTESVTLPNGVDMPLEFYP 416
                 R GG GQE+E + EPENTLKEVAPVLTILFNELETNTES+TLPNGVD+PLEFYP
Sbjct: 361 DEEDATRNGGGGQEDEEFAEPENTLKEVAPVLTILFNELETNTESMTLPNGVDIPLEFYP 420

Query: 417 QLYTKRCKDQLIRHIISKRKQARVRSRYLLEEISALKSYQGKNTFTILESTLAYLQESPD 476
           QLYTKRCKDQLIRH+ISKRKQAR+RSR LL+EI+ LKSYQGKN  T+LESTLAYLQ SP+
Sbjct: 421 QLYTKRCKDQLIRHVISKRKQARIRSRTLLQEINNLKSYQGKNISTVLESTLAYLQASPN 480

Query: 477 DANNEAASQIASLKDTLNSMRSAKMEEYKDLASKLHGEWNLSHPETHIINTAKQLGLIEN 536
           DANN+AA QIASLKDTLNS RSAKMEEYKDLASK+HGEW+LSHPETHII TAKQL LIEN
Sbjct: 481 DANNKAARQIASLKDTLNSTRSAKMEEYKDLASKVHGEWDLSHPETHIIKTAKQLRLIEN 540

Query: 537 PYVLTMAAISPYSYFIRNRNGVWSWIQSNTLGTEFKVNKCSSASVVQEAIRHGTKYASEM 596
           PY+LT+AA+SPYSYF+RNRNGVWSW+QSN LGTEFK+  C S SVVQEAI+HGTKYASE 
Sbjct: 541 PYILTLAALSPYSYFLRNRNGVWSWVQSNALGTEFKIKNCPSPSVVQEAIKHGTKYASET 600

Query: 597 PLMFIYCEEGKIPTEEVVEKALDSNNGCSKFAKDDQSSLRTLHSQFIDGIDNAEQ 651
           PLMFIYCEEGKIPTEE V KAL +N GCSKFAKDD++SLRTL S F D  DN +Q
Sbjct: 601 PLMFIYCEEGKIPTEEEVSKALQNNTGCSKFAKDDENSLRTLRSHFNDDNDNTDQ 655

>Suva_8.190 Chr8 complement(339480..341480) [2001 bp, 666 aa] {ON}
           YOR138C (REAL)
          Length = 666

 Score = 1014 bits (2623), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 500/651 (76%), Positives = 552/651 (84%), Gaps = 17/651 (2%)

Query: 1   MMDNQAVKSLLEMGIPHEVAVEALQRTGGNLEAAVNFIFSNELPDQGSMSTENNVELPRI 60
           MMDNQAVKSLLEMGIPHEVAV+ALQRTGGNLEAAVNFIFSNELP+Q +         PRI
Sbjct: 1   MMDNQAVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIFSNELPEQVATGQ------PRI 54

Query: 61  SENRIM---AGNSYDVPNNGEQXXXXXXXXXXXXXXXXXXXXXXXRSGSNSTNEYRRAAQ 117
           SENR++      +YDVPN+G+Q                          S S++   R   
Sbjct: 55  SENRVVPDAGAGAYDVPNSGDQDIDMPDVVGGGGDGDGDGYDDLTDDRSGSSSSNGRGP- 113

Query: 118 EYDHYSVSETSIPPPSYNIVQHNEFKSTMDDPTVVLPLPLNSLIESYFGLFALLVSVYFP 177
             DHYS+SETS+PPPSY+IVQHN+FKS +DDPTVVLPLPLNSLIESYFGLFALL S+YFP
Sbjct: 114 --DHYSISETSLPPPSYSIVQHNQFKSAVDDPTVVLPLPLNSLIESYFGLFALLASMYFP 171

Query: 178 HVFLKPDFQDLNFRPDWFKGTSFTEPKYRIAYREADDGSTTSDIVLASGPSDELQPHLLW 237
           HVFLKPDFQDLN+RPDWFKG+SF EP+YR+AYRE+ DGSTTS+IV+ASGPS ++QPHLLW
Sbjct: 172 HVFLKPDFQDLNYRPDWFKGSSFAEPRYRLAYRESSDGSTTSEIVVASGPSKDVQPHLLW 231

Query: 238 QLQKLISVVNTRMCERAFVSAKLFTLSLEPQLKSKLANSEHLYEVLPAFIKSLAVDLEMC 297
           QLQKLISVVNT+MCERAFVSAKLFTLSLEPQLK+KLA+SEHLYEVLP FIKSLAVDLEMC
Sbjct: 232 QLQKLISVVNTKMCERAFVSAKLFTLSLEPQLKAKLADSEHLYEVLPTFIKSLAVDLEMC 291

Query: 298 PGIRDQETRNLFISSALHTPNKNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLYPXXXXX 357
           PGIRD+ETRNLFISSALHTP+KNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLYP     
Sbjct: 292 PGIRDRETRNLFISSALHTPDKNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLYPEEEEE 351

Query: 358 XXXVIRRGGTGQEEERYVEPENTLKEVAPVLTILFNELETNTESVTLPNGVDMPLEFYPQ 417
              V+  GG G  +E    PENTLKEVAPVLTILFNELETNTESVTLPNGVD+PLEFYPQ
Sbjct: 352 EGEVVY-GGDGAHQE----PENTLKEVAPVLTILFNELETNTESVTLPNGVDVPLEFYPQ 406

Query: 418 LYTKRCKDQLIRHIISKRKQARVRSRYLLEEISALKSYQGKNTFTILESTLAYLQESPDD 477
           LYTKRCKDQLIRHIISKRKQARV+SR LL+EI+ LKSYQGKN  TILESTLAYLQ    D
Sbjct: 407 LYTKRCKDQLIRHIISKRKQARVKSRSLLQEINNLKSYQGKNISTILESTLAYLQADTKD 466

Query: 478 ANNEAASQIASLKDTLNSMRSAKMEEYKDLASKLHGEWNLSHPETHIINTAKQLGLIENP 537
           A+NEA+ QIASLKDTLNS R+AKMEEYKDLASKLHGEWNLSHPE HIINTAKQLGLIENP
Sbjct: 467 ADNEASKQIASLKDTLNSSRAAKMEEYKDLASKLHGEWNLSHPEIHIINTAKQLGLIENP 526

Query: 538 YVLTMAAISPYSYFIRNRNGVWSWIQSNTLGTEFKVNKCSSASVVQEAIRHGTKYASEMP 597
           Y+L+MA +SPYSYF R+R+G WSWIQSNTLGTEFK+NKCSS SVVQEAIRHGTKYASEMP
Sbjct: 527 YILSMAVLSPYSYFTRDRDGEWSWIQSNTLGTEFKINKCSSPSVVQEAIRHGTKYASEMP 586

Query: 598 LMFIYCEEGKIPTEEVVEKALDSNNGCSKFAKDDQSSLRTLHSQFIDGIDN 648
           LMFIYCEEG+IPT++ V KAL++N GC KFAKDDQS+L TL +QF D   N
Sbjct: 587 LMFIYCEEGRIPTDDEVSKALENNTGCVKFAKDDQSTLNTLRAQFNDSTGN 637

>Kpol_543.9 s543 complement(22643..24571) [1929 bp, 642 aa] {ON}
           complement(22643..24571) [1929 nt, 643 aa]
          Length = 642

 Score =  563 bits (1451), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/650 (43%), Positives = 422/650 (64%), Gaps = 27/650 (4%)

Query: 2   MDNQAVKSLLEMGIPHEVAVEALQRTGGNLEAAVNFIFSNELPDQGSMS---------TE 52
           ++  ++ SL+EMGIP ++A++AL R  GNLEAAVNFIFSNELP +   S           
Sbjct: 4   LNENSINSLIEMGIPRDIAIDALSRANGNLEAAVNFIFSNELPAEAENSDIEIISYKEKA 63

Query: 53  NNVELPRISENRIMAGNSYDVPNNGEQXXXXXXXXXXXXXXXXXXXXXXXRSGSNSTNEY 112
           N+VE+   ++     G+  +V  N +Q                               +Y
Sbjct: 64  NHVEIS--NKESFQPGDLTEVIAN-QQPLQPEFQNYVNDNSENIDSNCYVSDKIVDNMDY 120

Query: 113 RRAAQEYDHYSVSETSIPPPSYNIVQHNEFKSTMDDPTVVLPLPLNSLIESYFGLFALLV 172
             +  +Y   SV++ ++ PPSY IV+H++ KS + DPTV+LPLP NS+IE+YF L++L +
Sbjct: 121 YSSDSDYITNSVTD-NLLPPSYQIVKHSDHKSRLRDPTVILPLPPNSMIENYFALYSLCI 179

Query: 173 SVYFPHVFLKPDFQDLNFRPDWFKGTSFTEPK--YRIAYREADDGSTTSDIVLASGPSDE 230
           + Y PH+ ++PDF+DL+F  DWFKG+SF++PK   +    E    ST     +     D+
Sbjct: 180 TNYLPHIIMRPDFKDLSFTEDWFKGSSFSKPKNVLKSVTDETTSKSTMKICPIEDMNQDD 239

Query: 231 LQPHLLWQLQKLISVVNTRMCERAFVSAKLFTLSLEPQLKSKLANSEHLYEVLPAFIKSL 290
            QP LLWQLQKL S+VN+ M ERA+V AK+F++ L+ Q + +LA ++HL EVLP+FIK L
Sbjct: 240 DQPELLWQLQKLSSIVNSTMSERAYVCAKIFSVILDQQSQIRLAEADHLNEVLPSFIKYL 299

Query: 291 AVDLEMCPGIRDQETRNLFISSALHTPNKNEPPMETFLSLFHFLPEEYDSNLYKMFNVLL 350
            V+LE CPG  + E R LFISSA +TP+ ++ P+ T LSLFHFLP+EYDSNLYKMFNVLL
Sbjct: 300 VVNLESCPGFEEDEIRKLFISSAFYTPSDDQAPITTLLSLFHFLPDEYDSNLYKMFNVLL 359

Query: 351 YPXXXXXXXXVIRRGGTGQEEERYVEPENTLKEVAPVLTILFNELETNTESVTLPNGVDM 410
           YP              +G E E+     N+L +++P+L+I+F+E E  +  ++LP GV++
Sbjct: 360 YPDENDSDYE------SGDESEQ----GNSLGDISPILSIVFDEAEEGSSGISLPEGVEV 409

Query: 411 PLEFYPQLYTKRCKDQLIRHIISKRKQARVRSRYLLEEISALKSYQGKNTFTILESTLAY 470
           PLEF+PQ+YTK CK++LI+HII+KRK A+ +S+ +L +I+++KS+QGK+    + S+L Y
Sbjct: 410 PLEFFPQIYTKDCKNKLIKHIIAKRKDAQFKSKEILNDINSIKSFQGKDILKFINSSLEY 469

Query: 471 LQESPDDANNEAASQIASLKDTLNSMRSAKMEEYKDLASKLHGEWNLSHPETHIINTAKQ 530
           L+   D+ ++    ++  +K+ +  +++ KM EY+DLA KL  EWN+S+PETHI+ T ++
Sbjct: 470 LER--DNKSDNITEELLKIKNDMAIVKTQKMNEYRDLAQKLQNEWNISNPETHIVETGRK 527

Query: 531 LGLIENPYVLTMAAISPYSYFIRNRNGVWSWIQSNTLGTEFKVNKCSSASVVQEAIRHGT 590
           LGLI  PY+L MA +SPYSY+IR R G W+ +Q +T G +F V +CSS   V++ I+  T
Sbjct: 528 LGLIGEPYLLVMAVLSPYSYYIRERTGKWNLVQCSTTGGDFDVRECSSELEVKDTIKQAT 587

Query: 591 KYASEMPLMFIYCEEGKIPTEEVVEKALDSNNGCSKFAKDDQSSLRTLHS 640
           ++ASE PLMF+YC    IP E  + K+ +SN+GC  F K+DQ  L  +++
Sbjct: 588 RHASETPLMFMYCRRDVIPEEYEIRKSFESNSGCLNFFKEDQLVLNKMNN 637

>TDEL0A03390 Chr1 complement(603062..604930) [1869 bp, 622 aa] {ON}
           Anc_5.475 YOR138C
          Length = 622

 Score =  556 bits (1433), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/655 (45%), Positives = 409/655 (62%), Gaps = 67/655 (10%)

Query: 1   MMDNQAVKSLLEMGIPHEVAVEALQRTGGNLEAAVNFIFSNELPDQGSMSTEN--NVELP 58
           M D  AV+SL+EMGI  +VA +AL+RT G++EAA NFIF N+ P Q S + E   ++ELP
Sbjct: 1   MNDTDAVRSLVEMGISKDVAEDALRRTNGDVEAAGNFIFCNDAPAQISENVEQRAHIELP 60

Query: 59  RISENRIMAGNSYDVPNNGEQXXXXXXXXXXXXXXXXXXXXXXXRSGSNSTNEYRRAAQE 118
             S +    G+  +  +N                                       +++
Sbjct: 61  AGSASGFQPGDLNEYISNAPDTE----------------------------------SED 86

Query: 119 YDHYSVSETSIPP-PSYNIVQHNEFKSTMDDPTVVLPLPLNSLIESYFGLFALLVSVYFP 177
           ++   V E S+   PS   ++ +  K  + DPTVVLPLP N L E YF LF L V+ Y P
Sbjct: 87  FEEIDVEEDSVETGPS---LECSGRKGQISDPTVVLPLPPNFLFEGYFALFCLFVANYMP 143

Query: 178 HVFLKPDFQDLNFRPDWFKGTSFTEPKYRIAYREADDGSTTSDIVLASGPSDEL------ 231
           H+  +PDF DLN+  +W++G S+T  +YR+ Y  + +GS    I +   P DEL      
Sbjct: 144 HLLARPDFIDLNYDKNWYRGDSYTNAEYRLKYL-SKNGSDDEQIEIV--PKDELTQEDGD 200

Query: 232 ---QPHLLWQLQKLISVVNTRMCERAFVSAKLFTLSLEPQLKSKLANSEHLYEVLPAFIK 288
              Q  LLWQLQKL SV N+RM +RA+V AK+F +++EPQ++  +A +EHL+EVLP+FIK
Sbjct: 201 YTLQSELLWQLQKLASVANSRMSDRAYVRAKMFAIAVEPQVQRNMAEAEHLHEVLPSFIK 260

Query: 289 SLAVDLEMCPGIRDQETRNLFISSALHTPNKNEP----PMETFLSLFHFLPEEYDSNLYK 344
           S+AVDLEMCP  +D E R  FISSA HTP+ + P     M+T+LSLFHFLPEEY++NLY+
Sbjct: 261 SVAVDLEMCPNFQDNEVRECFISSAFHTPSNSAPQEESTMKTWLSLFHFLPEEYETNLYR 320

Query: 345 MFNVLLYPXXXXXXXXVIRRGGTGQEEERYVEPENTLKEVAPVLTILFNELETNTESVTL 404
           MFN LL+              G G         EN+L E+APV TI+F+E+E  TE+V L
Sbjct: 321 MFNALLFADDSVESDQSDSPDGEG---------ENSLSEIAPVFTIVFDEMEETTEAVPL 371

Query: 405 PNGVDMPLEFYPQLYTKRCKDQLIRHIISKRKQARVRSRYLLEEISALKSYQGKNTFTIL 464
             GV+MPLEFYPQLYTK CKD+LI+HII+KR+Q++  SR +L+EI+ LKS+QGK+    +
Sbjct: 372 AEGVEMPLEFYPQLYTKECKDKLIKHIIAKRRQSQTDSRAILQEITDLKSFQGKDLSKFI 431

Query: 465 ESTLAYLQESPDDANNEAASQIASLKDTLNSMRSAKMEEYKDLASKLHGEWNLSHPETHI 524
            S+L YLQ+  D+ + E    +  LKD + + ++ KM EYK++A +L  EWNLS PE  I
Sbjct: 432 NSSLDYLQK--DEKSPELIKGLLDLKDQITNKKTKKMNEYKEIAHRLQSEWNLSLPEIQI 489

Query: 525 INTAKQLGLIENPYVLTMAAISPYSYFIRNRNGVWSWIQSNTLGTEFKVNKCSSASVVQE 584
           + TAK+LGLI++ Y+LTMA ISPY Y+ RNR+G W ++QS      + V  CSS   +Q+
Sbjct: 490 VKTAKELGLIDDSYLLTMAVISPYMYYTRNRDGQWFFVQSTPYEASYNVRACSSPLEIQD 549

Query: 585 AIRHGTKYASEMPLMFIYCEEGKIPTEEVVEKALDSNNGCSKFAKDDQSSLRTLH 639
           AI+  T+  SE PLMFIYC++G IP ++ V KAL++N GC +FAKDDQ  L  + 
Sbjct: 550 AIKQHTRRPSEAPLMFIYCKKGFIPDDDTVLKALENNQGCHRFAKDDQLQLNKMQ 604

>TPHA0J02780 Chr10 complement(619045..620940) [1896 bp, 631 aa] {ON}
           Anc_5.475 YOR138C
          Length = 631

 Score =  545 bits (1404), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/665 (43%), Positives = 411/665 (61%), Gaps = 69/665 (10%)

Query: 1   MMDNQ-AVKSLLEMGIPHEVAVEALQRTGGNLEAAVNFIFSNELPDQG------------ 47
           M DN+ +VKS+++MGIP +VA++AL R  G+LEAAVNFIFSNELPD              
Sbjct: 1   MNDNKNSVKSIVDMGIPEDVAIDALNRVNGDLEAAVNFIFSNELPDNNMGESVGNEKYTT 60

Query: 48  ----SMSTENNVELPRISENRIMAGNSYDVPNNGEQXXXXXXXXXXXXXXXXXXXXXXXR 103
               ++S +NN +   +SE  +M  ++Y   N  E                         
Sbjct: 61  SEHVNISNDNNFQAGDLSE--VMNVSNYGYDNRFE-----------------------TD 95

Query: 104 SGSNSTNEYRRAAQEYDHYSVSETSIPPPSYNIVQHNEFKSTMDDPTVVLPLPLNSLIES 163
           SG  S++E   +  E     +S  ++  P+YNIV+H   K+++ DPTVV+PLP NS+IES
Sbjct: 96  SGDLSSDEV--SDPEIVENDIS-NNLKLPAYNIVKHEVEKTSLSDPTVVMPLPHNSIIES 152

Query: 164 YFGLFALLVSVYFPHVFLKPDFQDLNFRPDWFKGTSFTEPKYRIAYRE----ADDGSTTS 219
           YFGLF++ +S+Y PH+ LKPDF+DLN+  +W+ G  F  PK+ I         DD  T+ 
Sbjct: 153 YFGLFSMFISIYLPHLLLKPDFKDLNYDNEWYNGLKFVAPKFGIKVHNEESLKDDLHTSI 212

Query: 220 DIVLASGPSDELQPHLLWQLQKLISVVNTRMCERAFVSAKLFTLSLEPQLKSKLANSEHL 279
           + +       + QP LLWQLQKL +++N+ M ER++VS+KLF+L L+   K KL ++EHL
Sbjct: 213 EPLTCVDRDLDDQPKLLWQLQKLSTIMNSTMSERSYVSSKLFSLCLDRNAKMKLQDAEHL 272

Query: 280 YEVLPAFIKSLAVDLEMCPGIRDQETRNLFISSALHTPNKNEPPMETFLSLFHFLPEEYD 339
           YEVLP+FIK L  +LEMCP  R  E RN  ISSA + P+ +EPP++T L+LFHFLP+EY+
Sbjct: 273 YEVLPSFIKYLTSNLEMCPDFRPDEIRNELISSAYYLPSDDEPPVKTLLTLFHFLPDEYE 332

Query: 340 SNLYKMFNVLLYPXXXXXXXXVIRRGGTGQEEERYVEPENTLKEVAPVLTILFNELETNT 399
           SNLYKMFN+LLY                 ++ +  ++  N+L  +AP LTI+F+E++  +
Sbjct: 333 SNLYKMFNILLY--------------ADDEDGDGAIDEGNSLNYLAPNLTIIFDEIDELS 378

Query: 400 ESVTLPNGVDMPLEFYPQLYTKRCKDQLIRHIISKRKQARVRSRYLLEEISALKSYQGKN 459
               LP GV +PLEFYPQLYTK CKDQLI+HII KR+ A+  SR  L+++++LKS+QGK+
Sbjct: 379 SMTPLPEGVSIPLEFYPQLYTKECKDQLIKHIIGKRQDAQKESRQHLKDLNSLKSFQGKD 438

Query: 460 TFTILESTLAYL------QESPDDANNEAASQIASLKDTLNSMRSAKMEEYKDLASKLHG 513
               L STL +L      Q    + N +    +  +K+ L   ++ KM  YKDL  KL+ 
Sbjct: 439 ILKFLNSTLDFLDRDGQRQNGLTEGNGKLMEGLTDIKEQLTKKKTEKMNAYKDLTQKLNT 498

Query: 514 EWNLSHPETHIINTAKQLGLIENPYVLTMAAISPYSYFIRNRNGVWSWIQSNTLGTEFKV 573
            WNLS+PE  II TAK+LGLI+ PY L+MA +SP  Y+I+ R+G W  +Q    G +F +
Sbjct: 499 SWNLSNPEVSIIATAKKLGLIDEPYHLSMAVMSPNLYYIKKRDGTWYLVQITENGDDFDI 558

Query: 574 NKCSSASVVQEAIRHGTKYASEMPLMFIYCEEGKIPTEEVVEKALDSNNGCSKFAKDDQS 633
            KCSS   +Q+ +R  T++ SE PLMF+Y +EG IP ++ V+K L++N GC +F KDDQ 
Sbjct: 559 RKCSSGVEIQDCVRQYTRHGSETPLMFVYTKEGSIPDDDSVQKILEANTGCLQFLKDDQK 618

Query: 634 SLRTL 638
            L  +
Sbjct: 619 LLNEM 623

>KAFR0E02540 Chr5 (519567..521546) [1980 bp, 659 aa] {ON} Anc_5.475
           YOR138C
          Length = 659

 Score =  531 bits (1368), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/674 (43%), Positives = 413/674 (61%), Gaps = 63/674 (9%)

Query: 6   AVKSLLEMGIPHEVAVEALQRTGGNLEAAVNFIFSNEL----------PDQGSMSTENNV 55
           ++ SLLEMGI   VA++ALQ+  GNLEAA+N+IFSN++          P+      E+ V
Sbjct: 7   SLNSLLEMGISKNVAIDALQKFDGNLEAAINYIFSNDMSMESIQTHPQPNNNPFLEEHTV 66

Query: 56  EL---------------PRIS--ENRIMAGNSYDVP----NNGEQXXXXXXXXXXXXXXX 94
           EL               PR    E  ++  +S D       N +Q               
Sbjct: 67  ELSDSKFKPGDLDTVITPRAGGDEKDLIQLSSSDEEEGSLQNPDQTVAGETEKVNIPIDS 126

Query: 95  XXXXXXXXRSGSNSTNEYRRAAQEYDHYSVSETSIPPPSYNIVQHNEFKSTMDDPTVVLP 154
                    +  ++ NE R +   Y++         PP Y+ VQH+E KS + DPT+VLP
Sbjct: 127 QSSSYSSFSTSLSNENELRMSENTYNN---------PPEYSTVQHSERKSDIADPTIVLP 177

Query: 155 LPLNSLIESYFGLFALLVSVYFPHVFLKPDFQDLNFRPDWFKGTSFTEPKYRIAYREADD 214
           LP NSLIE+Y  L+AL ++ +F   FLKPDF+DLN+R +W++ +S  EP YR+ + +AD+
Sbjct: 178 LPPNSLIENYLALYALSIANFFAIDFLKPDFKDLNYRKEWYRSSSIDEPFYRVKFNKADE 237

Query: 215 GSTTSDIVLAS--GPSDELQPHLLWQLQKLISVVNTRMCERAFVSAKLFTLSLEPQLKSK 272
             T ++IV A+    +D  QP LLWQLQKLI+VVN+ + ERA+VSAK+F  S   QL+SK
Sbjct: 238 --TENEIVPAAELTETDHPQPKLLWQLQKLIAVVNSDLSERAYVSAKIFNSSSNQQLQSK 295

Query: 273 LANSEHLYEVLPAFIKSLAVDLEMCPGIRDQETRNLFISSALHTPNKNEPPMETFLSLFH 332
           L ++EHL EVLP FIK+LAVDLE C G +  + + LFISSA + P++NEP  ET+LS FH
Sbjct: 296 LGDAEHLNEVLPYFIKALAVDLESCYGDKSSDIKKLFISSAFYKPSQNEPLQETYLSFFH 355

Query: 333 FLPEEYDSNLYKMFNVLLYPXXXXXXXXVIRRGGTGQEEERYVEPENTLKEVAPVLTILF 392
           FLPEEYD+NLYKMFNVLL P             G   E+    +P+N+L  ++P LTI+F
Sbjct: 356 FLPEEYDTNLYKMFNVLLIPDEDD------EESGESDED----QPDNSLNIISPFLTIVF 405

Query: 393 NELETNTESVTLPN----GVDMPLEFYPQLYTKRCKDQLIRHIISKRKQARVRSRYLLEE 448
           NE++ +T+     +    GVD+P EFYPQLYTK+CKD+LI+HI+SKRK+++ + + +L+E
Sbjct: 406 NEMDESTDDNMTTSASFQGVDIPFEFYPQLYTKKCKDELIKHILSKRKESKSKLKVILQE 465

Query: 449 ISALKSYQGKNTFTILESTLAYLQESPDDANN---EAASQIASLKDTLNSMRSAKMEEYK 505
           I+ALKSY GK+    L ST+ +LQ+  +  +    E A ++  L+  +N  ++   +EYK
Sbjct: 466 INALKSYHGKDILMFLNSTIDFLQKDSNAESTDHLEVAQELNDLRAQINGRKAGLKDEYK 525

Query: 506 DLASKLHGEWNLSHPETHIINTAKQLGLIENPYVLTMAAISPYSYFIRNRNGV--WSWIQ 563
           +L+ KLH EWNLS+P+ HII TAK LGLI+ PY+LT   ISPY YF+R+R  V  W  +Q
Sbjct: 526 ELSQKLHNEWNLSYPDLHIIQTAKTLGLIDTPYLLTTVVISPYFYFMRDRKKVDQWCLVQ 585

Query: 564 SNTLGTEFKVNKCSSASVVQEAIRHGTKYASEMPLMFIYCEEGKIPTEEVVEKALDSNNG 623
           SN LGT+F +        V   I+  TK  +E PLMFIYC+E  I +++ + K ++ N G
Sbjct: 586 SNGLGTDFHITNFLDKENVSTTIKQYTKVPNESPLMFIYCKENYIASQDDIWKLIEENEG 645

Query: 624 CSKFAKDDQSSLRT 637
           CS F K DQ  L +
Sbjct: 646 CSSFIKADQLHLTS 659

>NCAS0H02270 Chr8 complement(445144..447234) [2091 bp, 696 aa] {ON}
           Anc_5.475 YOR138C
          Length = 696

 Score =  528 bits (1361), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 292/685 (42%), Positives = 408/685 (59%), Gaps = 59/685 (8%)

Query: 1   MMDNQAVKSLLEMGIPHEVAVEALQRTGGNLEAAVNFIFSNELP--------------DQ 46
           M +N+ VK+LLEMGIP EVAV+AL RTGGNLE AV FIFSNELP              DQ
Sbjct: 1   MENNETVKTLLEMGIPREVAVDALMRTGGNLEDAVAFIFSNELPQTEQEQPYIPININDQ 60

Query: 47  GSMSTENNV------------ELPRISENRIMAGNSY----DVPNNGEQXXXXXXXXXXX 90
             + +E ++             +P  S N     N+Y     V     Q           
Sbjct: 61  DPLPSEQDLANQDYRSSNTPSSVPG-SNNPFRESNNYLGDEYVEGQEVQRELIDVDSSDD 119

Query: 91  XXXXXXXXXXXXRSGSNSTNEYRRAAQEYDHYSVSETSIP----PPSYNIVQHNEFKSTM 146
                       RS S S ++      E  H   +  S+     PP YN+V     K  +
Sbjct: 120 EDEDEDDGMDGYRSESRSISQQNGNVPESFHIESATNSMSQEMIPPKYNLVAKGPLKDEL 179

Query: 147 DDPTVVLPLPLNSLIESYFGLFALLVSVYFPHVFLKPDFQDLNFRPDWFKGTSFTEPKYR 206
           D PT++LPLPLNS+IE+Y  LFAL   +  P  FLK DF+DLN+  +W+KGTSF  PK+ 
Sbjct: 180 DQPTIILPLPLNSMIENYLSLFALNAVINIPQFFLKTDFKDLNYNKNWYKGTSFEMPKFI 239

Query: 207 IAYREADDGSTTSD------------IVLASGPSDEL---QPHLLWQLQKLISVVNTRMC 251
           + +  ++D +T ++             ++  G SD++   QP LLWQLQKL ++ +  M 
Sbjct: 240 LEFDSSNDTTTINENAERGDQYRKAVDIIPIGTSDKVEKQQPFLLWQLQKLAAINSFSMS 299

Query: 252 ERAFVSAKLFTLSLEPQLKSKLANSEHLYEVLPAFIKSLAVDLEMCPGIRDQET-RNLFI 310
           ERA+ SA++F+L    Q++S L+ S++L +VLP FIKS+  DL++CP   D E+ ++LFI
Sbjct: 300 ERAYASARIFSLVFNGQVRSVLSKSDNLIDVLPLFIKSITTDLQLCPSNSDDESPQDLFI 359

Query: 311 SSALHTPNKNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLYPXXXXXXXXVIRRGGTGQE 370
           +SA H P K++  +ET L+ FHF+PEEY+ NLYKMFNVLLYP               G++
Sbjct: 360 TSAFHLPEKSQSLVETKLAFFHFMPEEYNENLYKMFNVLLYPDDPSE-----NNEDNGEQ 414

Query: 371 EERYVEPENTLKEVAPVLTILFNELETNTESVTLPNGVDMPLEFYPQLYTKRCKDQLIRH 430
           EE Y    N+L + A ++T++FNE +  T  +T  +GV++PL FYPQLY K+CKDQLI+H
Sbjct: 415 EEVY---NNSLNKAAHIITVIFNEADAYTPEMTSNSGVEIPLTFYPQLYFKKCKDQLIKH 471

Query: 431 IISKRKQARVRSRYLLEEISALKSYQGKNTFTILESTLAYLQESPDDANNEAASQIASLK 490
           I+ KR+QA  RS+ LL+EI  LKS++GK+    LES   YLQ+  +         I  ++
Sbjct: 472 ILEKRRQALARSKQLLDEIRQLKSFEGKDISMTLESAKEYLQKEENPMGKNLHETITKIE 531

Query: 491 DTLNSMRSAKMEEYKDLASKLHGEWNLSHPETHIINTAKQLGLIENPYVLTMAAISPYSY 550
             +   +++KMEEYK L+S+LH +WNLSHPE  II TAK LGLI+ PY+LT   ISPY Y
Sbjct: 532 MMIAEKKNSKMEEYKILSSQLHKDWNLSHPELQIIETAKTLGLIDEPYLLTTVIISPYLY 591

Query: 551 FIRNRNGVWSWIQSNTLGTEFKVNKCSSASVVQEAIRHGTKYASEMPLMFIYCEEGKIPT 610
           +IR ++G+W  +Q NTLGT+F+V++  S + VQE I+  T   +E PLMF++C E  IP 
Sbjct: 592 YIRKKDGIWYSVQCNTLGTDFQVSQLESGAAVQEIIKAQTSRPNETPLMFLFCRESIIPD 651

Query: 611 EEVVEKALDSNNGCSKFAKDDQSSL 635
           E+ V KA++ N GC +FAK DQ SL
Sbjct: 652 EDTVRKAMEENLGCLQFAKQDQLSL 676

>SAKL0G03564g Chr7 complement(294308..296125) [1818 bp, 605 aa] {ON}
           similar to uniprot|Q12242 Saccharomyces cerevisiae
           YOR138C RUP1
          Length = 605

 Score =  505 bits (1300), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 274/645 (42%), Positives = 402/645 (62%), Gaps = 63/645 (9%)

Query: 4   NQAVKSLLEMGIPHEVAVEALQRTGGNLEAAVNFIFSNELPDQGSMSTENNVELPRI--- 60
           NQ+++ LL+MGI HEVAV+AL RT G+LEA+VN+IFS EL      +T  +V+L +    
Sbjct: 5   NQSIQPLLDMGISHEVAVDALSRTNGDLEASVNYIFSGEL-----QATTEHVDLTQDDSD 59

Query: 61  SENRIMAGNSYDVPNNGEQXXXXXXXXXXXXXXXXXXXXXXXRSGSNSTNEYRRAAQEYD 120
           SEN I  G   DV  N +                             +T E R       
Sbjct: 60  SENGIKPGMLNDVIPNTDNV---------------------------TTVETREVEN--- 89

Query: 121 HYSVSETSIPPPSYNIVQHNEFKSTMDDPTVVLPLPLNSLIESYFGLFALLVSVYFPHVF 180
             ++ +  + P           K +++DPTVVLPLP N+L+E+YF LF L V + FPH F
Sbjct: 90  --TIPDDVLAPSGIMDSTTQLLKDSLNDPTVVLPLPPNALLENYFALFCLSVGISFPHHF 147

Query: 181 LKPDFQDLNFRPDWFKGTSFTEPKYRIAYREADDGSTTSDIVLASGPSDELQPHLLWQLQ 240
           LKPDFQDLN+  +WFKG  +++P+YR+ +   ++ S      L    S  LQP LLWQ Q
Sbjct: 148 LKPDFQDLNYNRNWFKGY-YSKPEYRLQFSSNNNVSIVPKAQLTIQDSLTLQPELLWQFQ 206

Query: 241 KLISVVNTRMCERAFVSAKLFTLSLEPQLKSKLANSEHLYEVLPAFIKSLAVDLEMCPGI 300
           K I+V+N+ + +R FVSAK+F   LEP +  KL + +HL+EVLP+FIKSLA D+EMC   
Sbjct: 207 KFIAVLNSSISDRKFVSAKIFHKVLEPLVLDKLGSCDHLFEVLPSFIKSLANDVEMCLLK 266

Query: 301 RD-QETRNLFISSALHTPNKNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLYPXXXXXXX 359
            D ++ R LFIS+A H P+K+E  +ET +SL HFLPEEYD+NLY+MFN LLYP       
Sbjct: 267 EDARDIRGLFISTAYHKPSKDEKTIETLVSLLHFLPEEYDTNLYRMFNTLLYP------- 319

Query: 360 XVIRRGGTGQEEERYVEPENTLKEVAPVLTILFNELETNTESVTLPNGVDMPLEFYPQLY 419
                    +E+E   E EN+L  +AP+LT++F+E++ +TE+V+L  GVD+PL+FYPQ+Y
Sbjct: 320 ---------EEDEDGEEVENSLGNLAPMLTVVFDEMDESTENVSLQQGVDVPLKFYPQIY 370

Query: 420 TKRCKDQLIRHIISKRKQARVRSRYLLEEISALKSYQGKNTFTILESTLAYLQESP---- 475
           TK  KD LI H+I+KRK+A+  S  +L++++ LKS+QGK+  + L ST+ +  + P    
Sbjct: 371 TKSSKDSLINHVIAKRKEAQSASHAILQDLNGLKSFQGKHINSFLNSTVDFAAKDPLFQN 430

Query: 476 DDANNEAASQIASLKDTLNSMRSAKMEEYKDLASKLHGEWNLSHPETHIINTAKQLGLIE 535
           D    E    + S+K+ + + ++ KMEEYK+++  +H +WNLSHP+ ++++ AK++GLI+
Sbjct: 431 DKDTEELLKSLVSIKEQITTKKTNKMEEYKNISHMIHNKWNLSHPDLYVVDAAKKMGLID 490

Query: 536 NPYVLTMAAISPYSYFIRNRNGVWSWIQSNTLGTEFKVNKCSSASVVQEAIRHGTKYASE 595
            PY+LT A +SPY Y+IR R+G+W  + S   G++ + +  +    V E+I+  T++ASE
Sbjct: 491 EPYLLTSAILSPYHYYIRKRDGIWYRVISEANGSDLEAS-ITEPHEVSESIKLATRHASE 549

Query: 596 MPLMFIYCEEGKIPTEEVVEKALDSNNGCSKFAKDDQSSLRTLHS 640
            PLMF YC+E KI  E  + K+L+ N G SKF K DQ+ L  L +
Sbjct: 550 TPLMFTYCKESKIGNENSIRKSLEDNQGVSKFVKMDQTELEALQN 594

>NDAI0C01390 Chr3 (290301..292430) [2130 bp, 709 aa] {ON} Anc_5.475
           YOR138C
          Length = 709

 Score =  424 bits (1090), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 220/557 (39%), Positives = 333/557 (59%), Gaps = 54/557 (9%)

Query: 133 SYNIVQHNEFKSTMDDPTVVLPLPLNSLIESYFGLFALLVSVYFPHVFLKPDFQDLNFRP 192
           +YN+V + + K+ + DPT++LP+P+NSL+E+Y  L  L +++  P  FL+PDF+DLN+  
Sbjct: 156 NYNVVTYTQLKARVTDPTIILPVPMNSLLENYLALIMLAIAINIPTPFLRPDFKDLNYEN 215

Query: 193 DWFKGTSFTEPKYRIAYR---EADDGSTT--SDIVLASGP-------SDELQPHLLWQLQ 240
           DW+KG S + P Y +  +   +ADD   +  SD  +  G        +D++QP LLWQLQ
Sbjct: 216 DWYKGNSLSIPNYGLKIQNDHDADDEGVSEPSDTNILDGEGEKNNQRNDDIQPKLLWQLQ 275

Query: 241 KLISVVNTRMCERAFVSAKLFTLSLEPQLKSKLANSEHLYEVLPAFIKSLAVDLEMCPGI 300
           KLISVVN+ + ER+++S K+F+L L P ++  LAN E+L +VLP F KSLA ++E C  I
Sbjct: 276 KLISVVNSTLSERSYISTKVFSLGLTPDVRYTLANYENLADVLPVFYKSLATEMEKCVAI 335

Query: 301 RDQ--------------------------ETRNLFISSALHTPNKNEPPMETFLSLFHFL 334
                                        E  +LF+S+A +        ++T ++   F 
Sbjct: 336 FGSDITENDKVDNADNDNNNGNSEERMRGEMESLFVSTASYEDAATGERLKTPVTTLSFS 395

Query: 335 PEEYDSNLYKMFNVLLYPXXXXXXXXVIRRG---GTGQEEERYVEPENTLKEVAPVLTIL 391
           PEEY+SNLYKMFN LL+P         +  G   GTG            L  +AP+ T++
Sbjct: 396 PEEYESNLYKMFNTLLFPEIDNPSKTAVSEGDVPGTG-----------CLDYIAPIFTVV 444

Query: 392 FNELETNTESVTLPNGVDMPLEFYPQLYTKRCKDQLIRHIISKRKQARVRSRYLLEEISA 451
           F+ +++ T+ V LP GVDMP+EFYPQLYT  C+D L+R +  +RK+A   S+ LL++ + 
Sbjct: 445 FHAMDSTTDEVDLPGGVDMPMEFYPQLYTSTCRDALVRDVFPRRKEAHRLSKELLQKFNQ 504

Query: 452 LKSYQGKNTFTILESTLAYLQESPDDANNEAASQIASLKDTLNSMRSAKMEEYKDLASKL 511
           L+S+QGK+    L+ST+ YL +    +  +A  ++  L+  +N+ ++  ME+YK L++ L
Sbjct: 505 LRSFQGKDITMFLKSTMDYLTKDC-GSETKALEEMKILETLINNAKNTIMEDYKALSADL 563

Query: 512 HGEWNLSHPETHIINTAKQLGLIEN-PYVLTMAAISPYSYFIRNRNGVWSWIQSNTLGTE 570
            G  N+SHPE  II+ AK   LI++ PY+LTMA ISP +YFIRNR G W  ++ N + TE
Sbjct: 564 QGPLNVSHPEVSIIDQAKASNLIDDEPYLLTMAVISPLAYFIRNRQGKWYLVRFNMISTE 623

Query: 571 FKVNKCSSASVVQEAIRHGTKYASEMPLMFIYCEEGKIPTEEVVEKALDSNNGCSKFAKD 630
           F++ +C S   VQ AI+  T +A+E PLMFIYC +  I  + +++K L+ N GC +F+KD
Sbjct: 624 FQITECESIRNVQTAIKQCTIHANEEPLMFIYCRKSAILDDLIIQKYLEDNKGCLQFSKD 683

Query: 631 DQSSLRTLHSQFIDGID 647
           DQ +L  L  Q     D
Sbjct: 684 DQIALDVLRQQIFSSDD 700

 Score = 64.7 bits (156), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 34/44 (77%)

Query: 1  MMDNQAVKSLLEMGIPHEVAVEALQRTGGNLEAAVNFIFSNELP 44
          M  N +V SL+EMGIP EVAV AL R  GNLEAAV FIFSNE+P
Sbjct: 1  MESNDSVSSLMEMGIPREVAVNALIRANGNLEAAVAFIFSNEIP 44

>Kwal_55.21267 s55 (757685..759499) [1815 bp, 604 aa] {ON} YOR138C -
           Hypothetical ORF [contig 130] FULL
          Length = 604

 Score =  414 bits (1063), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 242/650 (37%), Positives = 354/650 (54%), Gaps = 74/650 (11%)

Query: 2   MDNQAVKSLLEMGIPHEVAVEALQRTGGNLEAAVNFIFSNELPDQGSMST------ENNV 55
           M   A+KSLL+MGI  +VA+EAL +T G++E +VN+IFS ELP QG  S        +  
Sbjct: 1   MSESAIKSLLDMGITRDVAIEALSKTNGDVENSVNYIFSGELPQQGPESKPLQPLHADAE 60

Query: 56  ELPRISENR----IMAGNSYDVPNNGEQXXXXXXXXXXXXXXXXXXXXXXXRSGSNSTNE 111
           + P+  E+R    ++    Y   +NG                         R  + ST E
Sbjct: 61  QGPQKEEDREDSALLEHTEYASVSNG-----------------PLEEPERYRDYTLSTQE 103

Query: 112 YRRAAQEYDHYSVSETSIPPPSYNIVQHNEFKSTMDDPTVVLPLPLNSLIESYFGLFALL 171
              AA E  +       + P S N +  N F                        LF L 
Sbjct: 104 --EAANEVKNDQEDPLVVKPESSNALFENYF-----------------------ALFCLA 138

Query: 172 VSVYFPHVFLKPDFQDLNFRPDWFKGTSFTEPKYRIAYREADDGSTTSDIVLASGPSDEL 231
           V + FPH FL PDF+DLN+ PDW +G  F +P++RI +   +D +      L S  +  L
Sbjct: 139 VGLGFPHYFLGPDFKDLNYGPDWARG-QFLKPQFRIKFETNEDVTIVPRETLTSQDNLTL 197

Query: 232 QPHLLWQLQKLISVVNTRMCERAFVSAKLFTLSLEPQLKSKLANSEHLYEVLPAFIKSLA 291
           QP LLWQ QK ++V ++    R  VSA+  T +LEPQ+  KL N+EHL++VLP+FI+SLA
Sbjct: 198 QPELLWQFQKFLAVQHSPSSYRKQVSARYLTKALEPQVVEKLNNAEHLHDVLPSFIRSLA 257

Query: 292 VDLEMCPGIRDQETRNLFISSALHTPNKNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLY 351
            D+E+CPG   Q  + LFIS+A + P     P+ET +SL HF+PEEYDSN+YKMFN LLY
Sbjct: 258 NDVELCPG--SQSIKELFISTAYYKPASEPVPIETLVSLLHFMPEEYDSNIYKMFNALLY 315

Query: 352 PXXXXXXXXVIRRGGTGQEEERYVEPENTLKEVAPVLTILFNELETNTESVTLPNGVDMP 411
           P        V              E +N+L  +A ++TI+F+E++ +T+ + LP+GV++P
Sbjct: 316 PNDADDDDDV-------------EETQNSLGNLASMITIVFDEMDESTDDIRLPHGVEVP 362

Query: 412 LEFYPQLYTKRCKDQLIRHIISKRKQARVRSRYLLEEISALKSYQGKNTFTILESTLAYL 471
           ++FYPQLYT+  K  LI+ +     + + R+  +L+ ++ LKS+QGK+  + L STL ++
Sbjct: 363 MKFYPQLYTEDAKQSLIKDVTKHAGEGQQRAHSILKTLNELKSFQGKHIHSFLNSTLDFI 422

Query: 472 QESPDDAN-----NEAASQIASLKDTLNSMRSAKMEEYKDLASKLHGEWNLSHPETHIIN 526
                        N+    +  +K  L+  ++  M EYK ++ KL+ +WNLSHPE  II 
Sbjct: 423 ARDSSAVTENPQINDLVDTLQHIKQDLSKKKTDGMAEYKAISHKLNNDWNLSHPELGIIE 482

Query: 527 TAKQLGLIENPYVLTMAAISPYSYFIRNRNGVWSWIQSNTLGTEFKVNKCSSASVVQEAI 586
             ++LGLI+ PY+LT A ISP++YFIR R+  W  +          V K + A  V   I
Sbjct: 483 QGEKLGLIDEPYILTTAVISPFNYFIRKRDSQWYHVLGKQHNDALNVAK-TDAETVTNTI 541

Query: 587 RHGTKYASEMPLMFIYCEEGKIPTEEVVEKALDSNNGCSKFAKDDQSSLR 636
           R  T+ ASE PLMF Y +E  I T E + +A++ N G + FA+ DQSSL+
Sbjct: 542 RLNTRTASETPLMFTYFKESAIDTNETLTEAIEKNTGVTSFAEQDQSSLK 591

>TBLA0A02540 Chr1 (613560..615596) [2037 bp, 678 aa] {ON} Anc_5.475
           YOR138C
          Length = 678

 Score =  414 bits (1065), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 240/698 (34%), Positives = 376/698 (53%), Gaps = 99/698 (14%)

Query: 13  MGIPHEVAVEALQRTGGNLEAAVNFIF--------------SNELPDQGSM--------- 49
           MGI  +VA   L + GGNLEAA+N IF              S+ L  Q ++         
Sbjct: 1   MGIAKDVATSTLNKVGGNLEAAINHIFLDTPDTQEREAISTSDLLTAQKTISSNNYNNDN 60

Query: 50  ----------STENNVELPRISENRIMAGNSYDVPNNGEQXXXXXXXXXXXXXXXXXXXX 99
                     +T  ++EL R   +R +  N+ ++P+N                       
Sbjct: 61  SNSSFDSDSQATSCHIELSR-KNSRKVNSNTSNLPSN----------------------T 97

Query: 100 XXXRSGSNSTNEYRR-------------AAQEYDHYSVSETSIP---------------- 130
                GSNS N   R             + +EY    +++T  P                
Sbjct: 98  FIISGGSNSNNILSRENLSENSSDSSIDSKEEYQPLYLTDTQPPTYQDFTMTSNDNSQQI 157

Query: 131 --PPSYNIVQHNEFKSTMDDPTVVLPLPLNSLIESYFGLFALLVSVYFPHVFLKPDFQDL 188
             PP Y+   +   KS  DDPTV+L L  + L+ +YFGLF++ ++++ P +F+ PDF +L
Sbjct: 158 FVPPVYSKGTYKVQKSLPDDPTVLLSLEPSKLLSNYFGLFSMSLALFAPDLFMGPDFVNL 217

Query: 189 NFRPDWFKGTSFTEPKYRIAYRE-----ADDGSTTSDIVLASGPSDEL--QPHLLWQLQK 241
           NF  +W KG     P+Y + Y        +D     + +  S    EL  QP++LWQLQK
Sbjct: 218 NFNDNWNKGLQIDTPEYEVKYTHNLEPGLEDRIEIVNAINLSEKERELTYQPYILWQLQK 277

Query: 242 LISVVNTRMCERAFVSAKLFTLSLEPQLKSKLANSEHLYEVLPAFIKSLAVDLEMCPGIR 301
           +IS++N+++  RA++S+ +++L L+   + KL  + HLY++LP FI+SL  D +  P + 
Sbjct: 278 VISIMNSQISSRAYISSGIYSLCLDDNTQKKLMETSHLYDILPTFIRSLMNDCKHVPDLD 337

Query: 302 DQETRNLFISSALHTPNKNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLYPXXXXXXXXV 361
               +N+F+S A H    ++ P +  L LFHFLPEEYDSNLYKMFN LLY          
Sbjct: 338 QNRMKNMFVSKAFHQIPIHKEPTKVSLFLFHFLPEEYDSNLYKMFNSLLYRSYDEPIYPR 397

Query: 362 IRRGGTGQEE---ERYVEPENTLKEVAPVLTILFNELETNTESVTLPNGVDMPLEFYPQL 418
             +          E   E E++L E++ +LT++F+EL+ +TE +T P+GV++P EFYP+L
Sbjct: 398 TNQNSADSSSSDDEISNEEESSLDEISTILTVIFDELDQDTELITQPDGVEIPFEFYPEL 457

Query: 419 YTKRCKDQLIRHIISKRKQARVRSRYLLEEISALKSYQGKNTFTILESTLAYLQESPDDA 478
           YTK+CK++LI  I+  R Q +++ + +L ++++LKS++GK+    L STL YLQ   D  
Sbjct: 458 YTKKCKEKLINGILHTRYQNKLKMKEVLNDLNSLKSFEGKDILRFLNSTLEYLQR--DGK 515

Query: 479 NNEAASQIASLKDTLNSMRSAKMEEYKDLASKLHGEWNLSHPETHIINTAKQLGLIENPY 538
                ++++ +K+ L+  ++ KM EYK ++  L  EWN+  PE  II  A+ LGLI +P+
Sbjct: 516 EGPMVNKLSYVKEQLSRAKTEKMLEYKTISRSLQNEWNIDKPELSIIEQAQDLGLIGDPH 575

Query: 539 VLTMAAISPYSYFIRNRNGVWSWIQSNTLGTEFKVNKCSSASVVQEAIRHGTKYASEMPL 598
           +L MA +SPY YF R+R   W   QS+ +GT+F++ K  S   VQ+ I+  TK ASE P+
Sbjct: 576 LLVMAVLSPYLYFFRDRRNRWFKFQSSIMGTDFEITKYESDKTVQDEIKLNTKSASETPI 635

Query: 599 MFIYCEEGKIPTEEVVEKALDSNNGCSKFAKDDQSSLR 636
           MF+YC++  IP + +V +    N GCS FA+ D+ SL+
Sbjct: 636 MFVYCKKDAIPNDSLVLQKFAKNQGCSAFAQADEMSLK 673

>KLTH0F15004g Chr6 (1228654..1230447) [1794 bp, 597 aa] {ON} weakly
           similar to uniprot|Q12242 Saccharomyces cerevisiae
           YOR138C RUP1
          Length = 597

 Score =  410 bits (1055), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 216/503 (42%), Positives = 304/503 (60%), Gaps = 23/503 (4%)

Query: 141 EFKSTMDDPTVVLPLPLNSLIESYFGLFALLVSVYFPHVFLKPDFQDLNFRPDWFKGTSF 200
           + K+  +DP VV P   N+L E+YF LF L V + FPH FL+PDFQDL +  DW+KG  F
Sbjct: 102 QLKNRPEDPLVVRPASGNALFENYFALFCLAVGLGFPHHFLEPDFQDLTYGQDWYKG-QF 160

Query: 201 TEPKYRIAYREADDGSTTSDIVLASGPSDELQPHLLWQLQKLISVVNTRMCERAFVSAKL 260
            +P YR+ +   DD S      L S  +  LQP LLWQ QK ++V N+  C R +V+A+ 
Sbjct: 161 LKPAYRVKFENNDDVSIVPQETLTSQDNLILQPELLWQFQKFLAVQNSPQCRRKYVTARY 220

Query: 261 FTLSLEPQLKSKLANSEHLYEVLPAFIKSLAVDLEMCPGIRDQETRNLFISSALHTPNKN 320
            T  LEPQ+  KL NS+HL+E LP+FIKSLA D+E+CPG      + LFIS+A + P   
Sbjct: 221 LTKVLEPQVVEKLNNSDHLHEALPSFIKSLANDVELCPGAH--SVKELFISTAYYKPVSE 278

Query: 321 EPPMETFLSLFHFLPEEYDSNLYKMFNVLLYPXXXXXXXXVIRRGGTGQEEERYVEPENT 380
             P+ET +SL HF+PEEYD+N+YKMFN LLYP                 E+    + +N+
Sbjct: 279 PEPIETLVSLLHFMPEEYDTNIYKMFNALLYP--------------DSNEDAEMDDIQNS 324

Query: 381 LKEVAPVLTILFNELETNTESVTLPNGVDMPLEFYPQLYTKRCKDQLIRHIISKRKQARV 440
           L  +AP++TI+F+E++ +TE  TLP+GVD+PLEFYPQLYT+  K+ LI+ +      ++ 
Sbjct: 325 LGNLAPMITIVFDEMDESTEQATLPHGVDVPLEFYPQLYTEEAKNLLIKEVTKLSADSQT 384

Query: 441 RSRYLLEEISALKSYQGKNTFTILESTLAYLQESPDDANNEAASQ-----IASLKDTLNS 495
           ++R +L  ++ LKS+QGK   + L S L ++ +     + ++  Q     +  +K  L S
Sbjct: 385 QARSILRNLNDLKSFQGKQIHSFLNSALDFITKDMSGVSEQSGVQELVDSLQEVKQQLGS 444

Query: 496 MRSAKMEEYKDLASKLHGEWNLSHPETHIINTAKQLGLIENPYVLTMAAISPYSYFIRNR 555
            ++ KM +YK ++ +L+ E NLSHPE  II  AK LGLI+ PY+LT A IS  +YFIR  
Sbjct: 445 KKTEKMAQYKAVSHRLNNELNLSHPELGIIQRAKDLGLIDEPYLLTSAVISASNYFIRQN 504

Query: 556 NGVWSWIQSNTLGTEFKVNKCSSASVVQEAIRHGTKYASEMPLMFIYCEEGKIPTEEVVE 615
           NG W  +   +      V K + AS V  AIR  T+ ASE PLMF Y +   I TE  V+
Sbjct: 505 NGQWFHVVGRSNSEHMDVTK-TDASTVSSAIRFHTRCASESPLMFTYFKPSAIDTEAQVK 563

Query: 616 KALDSNNGCSKFAKDDQSSLRTL 638
           +A+  N G   FA+ DQ  + TL
Sbjct: 564 EAVGHNKGAKLFAEQDQKHINTL 586

 Score = 60.8 bits (146), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 27/46 (58%), Positives = 36/46 (78%)

Query: 2  MDNQAVKSLLEMGIPHEVAVEALQRTGGNLEAAVNFIFSNELPDQG 47
          M   A++SLL+MGI  EVA+EAL +T G++E +VN+IFS ELP QG
Sbjct: 1  MSENAIQSLLDMGITREVAIEALAKTNGDVENSVNYIFSGELPQQG 46

>KNAG0B04050 Chr2 (776430..778451) [2022 bp, 673 aa] {ON} Anc_5.475
           YOR138C
          Length = 673

 Score =  392 bits (1007), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 239/676 (35%), Positives = 361/676 (53%), Gaps = 54/676 (7%)

Query: 3   DNQAVKSLLEMGIPHEVAVEALQRTGGNLEAAVNFIFSNELPDQGSMSTENNVELPRISE 62
           +  AV SL EMGIP +VA++AL+R  GNL AAVN+IFSN++P         +VELP+  E
Sbjct: 4   EQDAVASLGEMGIPEDVALDALRRANGNLSAAVNYIFSNDMP------AGEHVELPQPRE 57

Query: 63  NRIMAGNSYDVPNNGEQXXXXXXXXXXXXXXXXXXXXXXXRSGSN----STNEYRRAAQE 118
           +  +     D      Q                        +G N      +     + +
Sbjct: 58  SSDLKPGDLDQVLRESQRTGPQLNQLVQLDSHPAADTNDEDTGGNIYLDEDDNIEVGSVQ 117

Query: 119 YDHYSVSETSIPP---------------PSYNIVQHNEFKSTMDDPTVVLPLPLNSLIES 163
            +  S + TSIPP               P Y   +    +   + P             +
Sbjct: 118 LNEVSPA-TSIPPNSDIGSSPDDGTGDPPEYGGCKVPAAEEGAERPDSGAAPAAERYATN 176

Query: 164 YFGLFALLVSVYFPHVFLKPDFQDLNFRPDWFKGTSFTEPKYRIAYREADDGS---TTSD 220
           Y  LFA  V+ Y P  F++ DF++LN+  +W+ G +  +P   ++   AD GS      +
Sbjct: 177 YLVLFAFAVATYAPLQFVQQDFKNLNYDAEWYAGDAIQQPLCIVSDVGADGGSRQIVPEE 236

Query: 221 IVLASGPSDELQPHLLWQLQKLISVVNTRMCERAFVSAKLFTLSLEPQLKSKLANSEHLY 280
            V +  P   +QP +LWQLQ++ISV ++++ ER++VSAK+FT   + +++S + +S+HLY
Sbjct: 237 EVTSDTP---VQPEMLWQLQRVISVCHSKLSERSYVSAKVFTKVFDTEVESCIRDSDHLY 293

Query: 281 EVLPAFIKSLAVDLEMCPGIR-DQETRNLFISSALHTPNKNEPPMETFLSLFHFLPEEYD 339
           E LP+FIKS+  D EMCP    + + +++F+SSA+    +   P ETFL LFHF PEEY+
Sbjct: 294 EALPSFIKSIIRDAEMCPAQHSNTDVKSMFLSSAIQDAEQGAEPEETFLFLFHFPPEEYN 353

Query: 340 SNLYKMFNVLLYPXXXXXXXXVIRRGGTGQEEERYVEPENTLKEVAPVLTILFNELETNT 399
           +NLYKMFN LLYP              T    +  V+ E +LKE+AP+LTI+FNE +   
Sbjct: 354 ANLYKMFNALLYPEDDTIDDNSSD---TDSSNDTDVQVEGSLKELAPLLTIIFNEADPGQ 410

Query: 400 ES-------VTLPNGVDMPLEFYPQLYTKRCKDQLIRHIISKRKQARVRSRYLLEEISAL 452
            S       +  P GV++P  FYPQLYT+  K+Q+++ I+ +RK AR   R  L  ++ L
Sbjct: 411 LSAGAQDTCINSPQGVEVPFSFYPQLYTREVKEQVVKPILRQRKAARAELRQCLARMNQL 470

Query: 453 KSYQGKNTFTILESTLAYLQESP---------DDANNEAASQIASLKDTLNSMRSAKMEE 503
           KSY+GK     LE     L   P          +   E   ++ S+K  LN  R+   ++
Sbjct: 471 KSYEGKGCCAFLEQYAEVLAGRPCVSAVRSRTKNEMKEVIQKVTSIKLQLNEERAKLKKQ 530

Query: 504 YKDLASKLHGEWNLSHPETHIINTAKQLGLIENPYVLTMAAISPYSYFIRNRNGV--WSW 561
           Y DL++KL  EWN+S+PE  +I  AK+LGL++ P++L+M  +SPY Y +R+ +G   W+ 
Sbjct: 531 YVDLSNKLQNEWNISNPERKVIGEAKRLGLLDKPHLLSMVVLSPYFYLMRDSSGGSDWTL 590

Query: 562 IQSNTLGTEFKVNKCSSASVVQEAIRHGTKYASEMPLMFIYCEEGKIPTEEVVEKALDSN 621
           +QSN+ GT+  + K  +   VQ+ IR  TK A++ PLMFIYC E    ++E    A++ N
Sbjct: 591 VQSNSYGTDGLITKHVTEEKVQQYIRDCTKTANDNPLMFIYCREDFFVSQEETWSAIEKN 650

Query: 622 NGCSKFAKDDQSSLRT 637
            GCS+F K DQ  L T
Sbjct: 651 MGCSEFNKADQLYLLT 666

>ZYRO0D11264g Chr4 complement(948942..950585) [1644 bp, 547 aa] {ON}
           similar to uniprot|Q12242 Saccharomyces cerevisiae
           YOR138C RUP1
          Length = 547

 Score =  372 bits (956), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 209/493 (42%), Positives = 298/493 (60%), Gaps = 61/493 (12%)

Query: 143 KSTMDDPTVVLPLPLNSLIESYFGLFALLVSVYFPHVFLKPDFQDLNFRPDWFKGTSFTE 202
           KS + DPTVV+PLP +SL E+YF LF+L +  Y PH+  KP+  DL + P W +G+S   
Sbjct: 113 KSLVTDPTVVIPLP-HSLFENYFALFSLSMCQYLPHLMAKPELGDLMYNPKWAQGSS--- 168

Query: 203 PKYRIAYREADDGSTTSDIVLASGPSDELQPHLLWQLQKLISVVNTRMCERAFVSAKLFT 262
                      D ST+                 + QLQ+L SVVN    +R +VSAKLF 
Sbjct: 169 -----------DPSTS----------------FIQQLQRLCSVVNASFSDRCYVSAKLFA 201

Query: 263 LSLEPQLKSKLANSEHLYEVLPAFIKSLAVDLEMCPGIRDQETRNLFISSALHTPNKNEP 322
             L+  LK KLA +EHL+EVLP+FI+SL   LE C    + + R+LF+SSAL +  K   
Sbjct: 202 AVLDAPLKRKLAEAEHLHEVLPSFIRSLIHALEECGCYAEDQIRSLFVSSALSSECK--- 258

Query: 323 PMETFLSLFHFLPEEYDSNLYKMFNVLLYPXXXXXXXXVIRRGGTGQEEERYVEPENTLK 382
              + LS+  F+PEEY+S+LY MFN LLYP                 E E   E  N+L 
Sbjct: 259 ---SLLSVLQFMPEEYESSLYAMFNALLYP-----------------ELEEGEESGNSLL 298

Query: 383 EVAPVLTILFNELETNTESVTLPNGVDMPLEFYPQLYTKRCKDQLIRHIISKRKQARVRS 442
           ++APVLTI+F+E++ +TE VT   GVD+PLEFYPQLYTK  KD ++R +  +RK A+ RS
Sbjct: 299 DLAPVLTIVFDEMDADTE-VTSNRGVDVPLEFYPQLYTKSVKDAIVRPLQQQRKAAQERS 357

Query: 443 RYLLEEISALKSYQGKNTFTILESTLAYLQESPDDANNEAASQIASLKDTLNSMRSAKME 502
           R +L E++ LKSYQGK+T   + STL YLQ   D+ + E   ++ SLK+++   ++ +  
Sbjct: 358 RQVLAEMNGLKSYQGKDTLKFINSTLDYLQR--DNQSKEIIDKLESLKNSIADHKTQRKN 415

Query: 503 EYKDLASKLHGEWNLSHPETHIINTAKQLGLIENPYVLTMAAISPYSYFIRNRNGVWSWI 562
           EYK+L+ KLHGEWNLSHP T++IN A + GLI+ PY+L M  +SP  Y  R+R+G W  I
Sbjct: 416 EYKELSQKLHGEWNLSHP-TYLINEAMERGLIDEPYLLAMVVLSPGHYLQRSRSGQWKMI 474

Query: 563 QSNTLGTEFKVNKCSSASVVQEAIRHGTKYASEMPLMFIYCEEGKIPTEEVVEKALDSNN 622
           ++++     +++ C + S VQ  IR  T + S+ PLM +Y +   +  + +V K+L+SN 
Sbjct: 475 RTDS--NMIRISDC-APSQVQATIRQHTTFPSKTPLMLLYVKSSHVSVDTIVSKSLESNE 531

Query: 623 GCSKFAKDDQSSL 635
           G + F + DQ  L
Sbjct: 532 GITNFLRIDQEEL 544

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 28/53 (52%), Positives = 37/53 (69%)

Query: 6  AVKSLLEMGIPHEVAVEALQRTGGNLEAAVNFIFSNELPDQGSMSTENNVELP 58
          A +SL+EMGI  EVA  ALQ+T GNLEAAVN+IFS E+ D   ++   +  +P
Sbjct: 3  AQQSLIEMGITPEVAQRALQQTHGNLEAAVNYIFSGEVSDDQPVNQPQSAPMP 55

>CAGL0I07205g Chr9 (694434..696245) [1812 bp, 603 aa] {ON} similar
           to uniprot|Q12242 Saccharomyces cerevisiae YOR138c
          Length = 603

 Score =  361 bits (927), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 235/645 (36%), Positives = 346/645 (53%), Gaps = 72/645 (11%)

Query: 7   VKSLLEMGIPHEVAVEALQRTGGNLEAAVNFIFS--NELPDQGSMSTENNVELPRISENR 64
           V+SLLEMGI  +VA +AL+   G++EAA+N+IF+  NE+ D  +M+ +    +P +    
Sbjct: 7   VQSLLEMGIARDVAEQALRECNGDVEAALNYIFNTPNEI-DNDAMAGQQMGSVP-VGTQG 64

Query: 65  IMAGNSYDVPNNGEQXXXXXXXXXXXXXXXXXXXXXXXRSGSNSTNEYRRAAQEYDHYSV 124
           I   +++ +  N                             ++ ++      Q    Y+ 
Sbjct: 65  IFDDSAFKIQENNPPQSQSYSEQQLVQENLPDNTFRSDSDTNSDSDSSSSLEQS--QYTS 122

Query: 125 SETSIPPPSYNIVQHNEFKSTMDDPTVVLPLPLNSLIESYFGLFALLVSVYFPHVFLKPD 184
            +  IP          +FK+TMD PTVV+P P       Y  LFAL +S++ PH F+K D
Sbjct: 123 IDDLIP---------QQFKNTMDYPTVVIPAPAVPNHIYYCALFALFISIHLPHYFVKAD 173

Query: 185 FQD--LNFRPDWFKGTSFTEPKYRIAYREADDGSTTSDIVLASGPSDELQPHLLWQLQKL 242
             D  L F PDWF              RE               P DE    L  QL KL
Sbjct: 174 HDDMPLLFSPDWFNDID----------RE---------------PEDEPLLVLRDQLHKL 208

Query: 243 ISVVNTR-MCERAFVSAKLFTLSLEPQLKSK---LANSE--HLYEVLPAFIKSLAVDLEM 296
           I+V N+     RAFV++K+F + L+  ++S    L N    HLY++LP+FIK++A +L  
Sbjct: 209 IAVQNSNDHSARAFVTSKMFDVDLQSVIQSNEPMLTNPNYFHLYQILPSFIKTIA-NLSY 267

Query: 297 CPGIRDQETRNLFISSALHTPNKNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLYPXXXX 356
                    +NLFISSA+    +     E+ LSLFHFLPEEY+SNLYKMFNVLLYP    
Sbjct: 268 T-------EKNLFISSAIQGGEEASSSKESLLSLFHFLPEEYESNLYKMFNVLLYPDDDH 320

Query: 357 XXXXVIRRGGTGQEEERYVEPENTLKEVAPVLTILFNELETNTESVTLPNGVDMPLEFYP 416
                      G++E+     EN+LKE+APV+TI+FNE E   E+  + NGV++PL+FYP
Sbjct: 321 ---------DIGEDEDEV--SENSLKELAPVMTIIFNEAENIDENAPVTNGVEVPLKFYP 369

Query: 417 QLYTKRCKDQLIRHIISKRKQARVRSRYLLEEISALKSYQGKNTFTILESTLAYLQESPD 476
           QLYTK+CKDQLI H++SKRK  R   + +L++I  LKSYQGK+  + + S+L YL +  D
Sbjct: 370 QLYTKKCKDQLISHVLSKRKDGRKELKQILKDIGNLKSYQGKDILSFINSSLDYLTKDKD 429

Query: 477 DANNEAASQIASLKDTLNSMRSAKMEEYKDLASKLHGEWNLSHPETHIINTAKQLGLIEN 536
           D+    A ++  LKD L + ++ KM  YK ++ K+H EWN+ +PE  I+ TA +LGLI+ 
Sbjct: 430 DSG--IAEELHKLKDELTAKKTEKMNSYKQISEKMHTEWNIQNPELKIVETATKLGLIDE 487

Query: 537 PYVLTMAAISPYSYFIRNRNGVWSWIQSNTLGT---EFKVNKCSSASVVQEAIRHGTKYA 593
           PY L +A +SP+ YF+RNR   W  ++ N   T   +  V KC     V + +++ T   
Sbjct: 488 PYFLNLAVVSPFFYFVRNRKDEWYEVRFNPFNTAEDKISVGKCDGPGEVIQHVKNSTTVP 547

Query: 594 SEMPLMFIYCEEGKIPTEEVVEKALDSNNGCSKFAKDDQSSLRTL 638
           +  PLMF+Y ++  +  +  +++ L  N     F K DQ  L+  
Sbjct: 548 NSTPLMFVYSKDSYMADDTEMQELLSQNKTLLDFFKQDQIYLQNF 592

>TBLA0B02230 Chr2 (521358..523730) [2373 bp, 790 aa] {ON} Anc_5.475
           YOR138C
          Length = 790

 Score =  341 bits (874), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 194/519 (37%), Positives = 296/519 (57%), Gaps = 66/519 (12%)

Query: 143 KSTMDDPTVVLPLPLNSLIESYFGLFALLVSVYFP-HVFLKPDFQDLNFRPDWFKGTSFT 201
           K  + DPTV+LPL  N L+E+Y  LF   + +  P  +F    F DL +   W+  ++  
Sbjct: 178 KLQISDPTVLLPLSQNCLLENYLSLFLYSLCMLCPLQIFETQQFNDLMYNKKWYSISNNN 237

Query: 202 EPKYRIAYREADDGSTTSDIVLASGPSDELQPHLLWQLQKLISVVNTRMCERAFVSAKLF 261
           E             +TT+D              L  QLQ++ S++N+RM ERAF+S K+F
Sbjct: 238 E-------------NTTTD-------------SLFLQLQRVTSIINSRMSERAFISTKMF 271

Query: 262 TLSLEPQLKSKLANSEHLYEVLPAFIKSLAVDLEMCPGIRDQETRNLFISSALHTPNKNE 321
           + +    L   L+ S+HL E+   FI+SL   + + P  +D     + +++A++  ++  
Sbjct: 272 SFAFNKDLNYLLSQSDHLNEIFNPFIESLVTTV-LPPIFKD-----ILVTTAINKDSQTN 325

Query: 322 PPMETFLSLFHFLPEEYDSNLYKMFNVLLYPXXXXXXXXVIRRGGTGQEEERY------- 374
               + +S+ +FLPEEY+SNLYKMFN L+YP           R    Q +E         
Sbjct: 326 EIFRSPISMINFLPEEYESNLYKMFNNLVYPNEYG-------RNDDEQSDESLQTDDDDN 378

Query: 375 -VEPENTLKEVAPVLTILFNEL-ETNTESVTLPNGVDMPLEFYPQLYTKRCKDQLIRHII 432
               ++ L+E++P+ TILF E  E+++ S TLP GV++PL+FYPQLY+K+  DQLI+HII
Sbjct: 379 DDANDSALEEISPIFTILFEEYDESDSSSTTLPEGVEIPLQFYPQLYSKKVNDQLIKHII 438

Query: 433 SKRKQARVRSRYLLEEISALKSYQGKNTFTILESTLAYLQESPDDANNEAASQIASLKDT 492
           SKRK+A+ +SR LL EI++LKS+QGK+   IL+ST+ Y+ E       ++A+ + ++   
Sbjct: 439 SKRKEAQSKSRSLLNEINSLKSFQGKDIMKILQSTIDYI-EKDSQRETKSANNLTNILTE 497

Query: 493 LNSMRSAKMEEYKDLASKLHGEWNLSHPETHIINTAKQLGLIENPYVLTMAAISPYSYFI 552
           + + ++ KM++YK+L  KLH EWNLSHPE  II TAKQL LI++PY L+M   SP  Y I
Sbjct: 498 MKNCKNLKMDQYKELTRKLHSEWNLSHPEGSIIETAKQLNLIDSPYNLSMVIFSPDLYLI 557

Query: 553 RNRNGVWSWIQSNTLGTE----------------FKVNKCSSASVVQEAIRHGTKYASEM 596
           +  N  W  I   ++                   F + KC+S   +Q+ I+  T+  SE 
Sbjct: 558 KKANVDWYLIDCRSINQMQNKNRNNNNNNNNPDLFVLRKCNSEIEIQDIIKQKTRNPSET 617

Query: 597 PLMFIYCEEGKIPTEEVVEKALDSNNGCSKFAKDDQSSL 635
           PLMFIYC+E  +P E+ V K+ +SN  C+KF K+DQ +L
Sbjct: 618 PLMFIYCKESFLPNEDDVMKSFESNMACTKFLKEDQLTL 656

 Score = 63.5 bits (153), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 43/63 (68%), Gaps = 3/63 (4%)

Query: 1  MMDNQAVKSLLEMGIPHEVAVEALQRTGGNLEAAVNFIFSNELPDQGSMSTENNVELPRI 60
          M D + +++L++MGIP +VA  AL+   GN+EAAVN+IFSNELP Q S   E     PRI
Sbjct: 1  MEDQEKIQTLIDMGIPPDVANNALRAANGNVEAAVNYIFSNELPPQASQMPE---LPPRI 57

Query: 61 SEN 63
           EN
Sbjct: 58 DEN 60

>KLLA0E03169g Chr5 complement(292918..294552) [1635 bp, 544 aa] {ON}
           weakly similar to uniprot|Q12242 Saccharomyces
           cerevisiae YOR138C RUP1
          Length = 544

 Score =  245 bits (626), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 155/500 (31%), Positives = 262/500 (52%), Gaps = 37/500 (7%)

Query: 152 VLPLPLNSLIESYFGLFALLVSVYFPHVFLKPDFQDLNFRPDWFKGTSFTEPKYRIAYRE 211
           +LP   ++L+ESYF LFAL ++V  P  FL  DF++L + P WFKG    +  YR+ +R 
Sbjct: 57  ILPKGSSALLESYFPLFALCMAVNVPTKFLNVDFKELVYNPHWFKG-ELVQSDYRLVHRN 115

Query: 212 ADDGSTTSDIVLASGPSDELQPHLLWQLQKLISVVNTRMCERAFVSAKLFTLSLEPQLKS 271
           A          L      E+QP L+ ++Q LI + N     R FV+++L     +  +  
Sbjct: 116 AG-PLLIHKRELTGSEYLEMQPELIPRMQLLIGIANDPESMRRFVASELINKGTDFNVSR 174

Query: 272 KLANSEHLYEVLPAFIKSLAVDLEMCPGIRDQETRNLFISSALHTPNKNEPPMETFLSLF 331
            L+  +HL EV P FIK+L  D+++C    D+ T  LF+S ALH PN  EP   T LS+ 
Sbjct: 175 ALSECDHLSEVFPQFIKNLHNDMDLCLK-DDKSTSKLFLSKALHRPNVLEPFQPTSLSVL 233

Query: 332 HFLPEEYDSNLYKMFNVLLYPXXXXXXXXVIRRGGTGQEEERYVEPENTLKEVAPVLTIL 391
           +F PE Y   LY+MFN +L P                ++  R  E EN    +APV TI+
Sbjct: 234 NFSPENYAYTLYEMFNPMLLP----------------EDSGRGYEIENAFDFLAPVFTII 277

Query: 392 FNELETNTESVTLPNGVDMPLEFYPQLYTKRCKDQLIRHIISKRKQARVRSRYLLEEISA 451
           F++++  TE V L +GV +P+EFYPQLYTK   ++++  ++ +    R  ++  ++++S+
Sbjct: 278 FDDMDDTTEEVNLSHGVQIPIEFYPQLYTKNALEKVVVPVLEETDALRNTNKLKVDQMSS 337

Query: 452 LKSYQGKNTFTILESTLAYLQESP---DDANNEAASQIASLKDTLNSMRSAKMEEYKDLA 508
           L+S+QGK   + L S++ YL+E P   +D + E    +  +K  L++ +   M +Y +  
Sbjct: 338 LQSFQGKQISSFLNSSINYLEEIPLGDEDKSKELVDTLEKIKYQLSNKKREMMADYTETQ 397

Query: 509 SKLHGEWNLSHPETHIINTAKQLGLIENPYVLTMAAISPYSYFI-----RNRNGVWSWIQ 563
            ++    +   P   II+ AKQ+G+I+ PY+L +   SP  Y I      +         
Sbjct: 398 RQI-DLLSFEGPSEKIIDLAKQVGIIDEPYLLRLVVFSPNDYIIARGISADDGNTGMETG 456

Query: 564 SNTLGTEFKVNKCSSASVVQEAI---------RHGTKYASEMPLMFIYCEEGKIPTEEVV 614
           +N L     + +  S+S+ QE +         +  T++ASE P++F+Y ++  I   + +
Sbjct: 457 NNNLQYIRNIIEFGSSSLTQEELTAQETQDITKSHTRHASETPILFVYIKKDHIDAPQDI 516

Query: 615 EKALDSNNGCSKFAKDDQSS 634
             ++  N   + F K++ ++
Sbjct: 517 LASISENETLTNFLKEEHTT 536

>Smik_5.308 Chr5 (461464..462750) [1287 bp, 428 aa] {ON} YER143W
           (REAL)
          Length = 428

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 25/35 (71%)

Query: 5   QAVKSLLEMGIPHEVAVEALQRTGGNLEAAVNFIF 39
           Q +K L+++G P +  V+AL++TGGN E A + +F
Sbjct: 393 QTIKQLMDLGFPRDTVVKALKQTGGNAEFAASLLF 427

>YER143W Chr5 (456319..457605) [1287 bp, 428 aa] {ON}  DDI1DNA
           damage-inducible v-SNARE binding protein with a role in
           suppression of protein secretion; may play a role in
           S-phase checkpoint control; has ubiquitin-associated
           (UBA), ubiquitin-like (UBL), and retroviral-like
           proteinase (RVP) domains
          Length = 428

 Score = 37.7 bits (86), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 24/35 (68%)

Query: 5   QAVKSLLEMGIPHEVAVEALQRTGGNLEAAVNFIF 39
           Q +K L+++G P +  V+AL++T GN E A + +F
Sbjct: 393 QTIKQLMDLGFPRDAVVKALKQTNGNAEFAASLLF 427

>Skud_5.280 Chr5 (446952..448238) [1287 bp, 428 aa] {ON} YER143W
           (REAL)
          Length = 428

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 23/35 (65%)

Query: 5   QAVKSLLEMGIPHEVAVEALQRTGGNLEAAVNFIF 39
           Q +K L+++G P +  V AL++T GN E A + +F
Sbjct: 393 QTIKQLMDLGFPRDAVVTALKQTNGNAEFAASLLF 427

>NCAS0I01620 Chr9 complement(299269..301656) [2388 bp, 795 aa] {ON}
           Anc_3.270 YBR058C
          Length = 795

 Score = 37.0 bits (84), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 17/68 (25%), Positives = 42/68 (61%), Gaps = 4/68 (5%)

Query: 2   MDNQAVKSLLEMGIPHEVAVEALQRTGGNLEAAVNFIFSNELPDQGSMSTENNVELPRIS 61
           +D +++ ++++MG+  +++++AL    G++ A++ ++F+N   D G + +E     P+  
Sbjct: 665 VDQESLSNMIDMGLNEKLSIKALVLNKGDINASIEWVFNNP-DDNGELPSETT---PKRD 720

Query: 62  ENRIMAGN 69
           E  I+ GN
Sbjct: 721 EEGIIYGN 728

>NDAI0C05890 Chr3 (1349126..1350514) [1389 bp, 462 aa] {ON}
           Anc_8.185 YER143W
          Length = 462

 Score = 35.8 bits (81), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 20/33 (60%)

Query: 7   VKSLLEMGIPHEVAVEALQRTGGNLEAAVNFIF 39
           +K L+++G P    + AL RTGGN E A   +F
Sbjct: 429 IKQLMDLGFPRNQVITALNRTGGNAEYAAALLF 461

>KLTH0F08382g Chr6 (724794..726767) [1974 bp, 657 aa] {ON} similar
           to uniprot|P15424 Saccharomyces cerevisiae YDR194C
           MSS116 DEAD-box protein required for efficient splicing
           of mitochondrial Group I and II introns presumed RNA
           helicase due to DEAD-box motif
          Length = 657

 Score = 35.4 bits (80), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 36/60 (60%), Gaps = 4/60 (6%)

Query: 2   MDNQAVKSLLEMGIPHEVA--VEALQRT--GGNLEAAVNFIFSNELPDQGSMSTENNVEL 57
           MD   V+ +L++G+P E++  +  + RT  GG    A  ++F +ELP   +++ E NV++
Sbjct: 435 MDFPGVEEVLQLGVPSELSNYIHRIGRTARGGKEGKATIYLFKDELPFIDTLAREKNVKI 494

>KLLA0F18700g Chr6 (1718738..1721050) [2313 bp, 770 aa] {ON} similar
           to uniprot|P38237 YBR058C Saccharomyces cerevisiae UBP14
           Ubiquitin-specific protease that specifically
           disassembles unanchored ubiquitin chains
          Length = 770

 Score = 34.7 bits (78), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 40/73 (54%), Gaps = 9/73 (12%)

Query: 2   MDNQAVKSLLEMGIPHEVAVEALQRTGGNLEAAVNFIFSNELPDQGSMSTENNVELPRIS 61
           +D++A+ S+  MG+  ++  +AL    G++ A+V ++FS+ + D G        ELP   
Sbjct: 633 VDSEALNSMTAMGLDSKLCRKALILKNGDVNASVEWVFSH-MDDDG--------ELPEAE 683

Query: 62  ENRIMAGNSYDVP 74
           E +  +  S+ +P
Sbjct: 684 EWKDQSRKSFGIP 696

>Ecym_7178 Chr7 (363600..367409) [3810 bp, 1269 aa] {ON} similar to
            Ashbya gossypii ABR149W
          Length = 1269

 Score = 34.7 bits (78), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 23/36 (63%)

Query: 6    AVKSLLEMGIPHEVAVEALQRTGGNLEAAVNFIFSN 41
            A++ L  MG   E AV+AL++   +LEAA NF+  N
Sbjct: 1233 AIEELSNMGFSEEEAVKALEKCKWDLEAATNFLLDN 1268

>NDAI0C06330 Chr3 (1470554..1471621) [1068 bp, 355 aa] {ON} 
          Length = 355

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 34/69 (49%), Gaps = 7/69 (10%)

Query: 490 KDTLNSMRSAK-MEEYKDLASKLHGEWNLSH---PETHIINTAKQLGLIENPYVLTMAAI 545
           KD L    S + +E+YK L SK  GE N++    P  HII     +G    P+V   ++ 
Sbjct: 53  KDGLFMFSSPESLEKYKQLNSKYFGELNINGFGIPYLHIIRIVSPIGF---PFVDNCSSF 109

Query: 546 SPYSYFIRN 554
             Y Y +RN
Sbjct: 110 KIYKYEVRN 118

>KLLA0E10341g Chr5 complement(911148..912392) [1245 bp, 414 aa] {ON}
           similar to uniprot|P40087 Saccharomyces cerevisiae
           YER143W DDI1 DNA damage-inducible v-SNARE binding
           protein contains a ubiquitin-associated (UBA) domain may
           act as a negative regulator of constitutive exocytosis
           may play a role in S-phase checkpoint control
          Length = 414

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 23/33 (69%)

Query: 7   VKSLLEMGIPHEVAVEALQRTGGNLEAAVNFIF 39
           +K L+++G   + A+ AL +TGGN++ A + +F
Sbjct: 381 IKKLVDLGFSRKEAINALNKTGGNVDYAASLLF 413

>Suva_5.271 Chr5 (427633..428919) [1287 bp, 428 aa] {ON} YER143W
           (REAL)
          Length = 428

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 12/35 (34%), Positives = 24/35 (68%)

Query: 5   QAVKSLLEMGIPHEVAVEALQRTGGNLEAAVNFIF 39
           + +K L+++G P +  V+AL++T GN + A + +F
Sbjct: 393 KTIKQLMDLGFPRDDVVKALKQTNGNADFAASLLF 427

>Kpol_1013.69 s1013 complement(167435..171169) [3735 bp, 1244 aa] {ON}
            complement(167435..171169) [3735 nt, 1245 aa]
          Length = 1244

 Score = 33.5 bits (75), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 22/36 (61%)

Query: 6    AVKSLLEMGIPHEVAVEALQRTGGNLEAAVNFIFSN 41
            A++ L  MG   E A  AL+R G +LE+A N++  N
Sbjct: 1208 AIEELSGMGFSKEEATRALERCGYDLESATNYLLDN 1243

>KAFR0C00410 Chr3 complement(85302..87611) [2310 bp, 769 aa] {ON}
           Anc_3.270 YBR058C
          Length = 769

 Score = 32.7 bits (73), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 13/52 (25%), Positives = 33/52 (63%), Gaps = 1/52 (1%)

Query: 2   MDNQAVKSLLEMGIPHEVAVEALQRTGGNLEAAVNFIFSNELPDQGSMSTEN 53
           ++ +++ S++ MG+   ++ +AL    G++ A++ ++F+N + D G +  EN
Sbjct: 640 INEESLNSMISMGLAQNLSRKALILNNGDINASIEWVFNN-MDDNGELPEEN 690

>AGR023C Chr7 complement(756961..759303) [2343 bp, 780 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR058C
           (UBP14)
          Length = 780

 Score = 32.7 bits (73), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 21/37 (56%)

Query: 3   DNQAVKSLLEMGIPHEVAVEALQRTGGNLEAAVNFIF 39
           D   V S++ MG     A+ AL  TG  +E A+N+IF
Sbjct: 584 DEDKVISIISMGFSKNAALRALYNTGSEVERALNWIF 620

>Kpol_1028.89 s1028 complement(197927..200560) [2634 bp, 877 aa]
           {ON} complement(197927..200560) [2634 nt, 878 aa]
          Length = 877

 Score = 32.7 bits (73), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 23/36 (63%)

Query: 6   AVKSLLEMGIPHEVAVEALQRTGGNLEAAVNFIFSN 41
           A++ L  MG   + AV+AL++   +L+AA NF+  N
Sbjct: 841 AIEELCGMGFTEDEAVKALEKHNWDLDAATNFLLDN 876

>KAFR0B02300 Chr2 (451471..452721) [1251 bp, 416 aa] {ON} Anc_8.185
           YER143W
          Length = 416

 Score = 32.3 bits (72), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 12/34 (35%), Positives = 22/34 (64%)

Query: 7   VKSLLEMGIPHEVAVEALQRTGGNLEAAVNFIFS 40
           +K L+++G      ++AL  TGGN + A +F+F+
Sbjct: 383 IKQLMDLGFSRNEVIKALDATGGNADFAASFLFN 416

>KNAG0A04660 Chr1 (663566..665707) [2142 bp, 713 aa] {ON} Anc_8.402
           YDR194C
          Length = 713

 Score = 32.3 bits (72), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 35/65 (53%), Gaps = 4/65 (6%)

Query: 2   MDNQAVKSLLEMGIPHEVA--VEALQRTG--GNLEAAVNFIFSNELPDQGSMSTENNVEL 57
           MD   +K +L++G+P E+A  +  + RT   G    +V F+  +ELP    +    N+E+
Sbjct: 466 MDFPNIKEVLQIGLPSELANYIHRIGRTARSGKSGKSVIFLCKDELPFITELKHRRNIEI 525

Query: 58  PRISE 62
             ++E
Sbjct: 526 ANVTE 530

>Suva_2.70 Chr2 complement(125732..129874) [4143 bp, 1380 aa] {ON}
            YBL047C (REAL)
          Length = 1380

 Score = 32.3 bits (72), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 21/34 (61%)

Query: 6    AVKSLLEMGIPHEVAVEALQRTGGNLEAAVNFIF 39
            AV+ L  MG   E A  AL+R+  +LEAA NF+ 
Sbjct: 1344 AVEELSGMGFTEEEAHNALERSNWDLEAATNFLL 1377

>NCAS0A03920 Chr1 complement(793999..795417) [1419 bp, 472 aa] {ON}
           Anc_8.185 YER143W
          Length = 472

 Score = 31.6 bits (70), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 19/33 (57%)

Query: 7   VKSLLEMGIPHEVAVEALQRTGGNLEAAVNFIF 39
           +K + ++G     A+ AL RTGGN E A   +F
Sbjct: 439 IKQVTDLGFTRTEAINALNRTGGNAELAAALLF 471

>Kpol_526.23 s526 (62128..63399) [1272 bp, 423 aa] {ON}
           (62128..63399) [1272 nt, 424 aa]
          Length = 423

 Score = 31.6 bits (70), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 12/34 (35%), Positives = 21/34 (61%)

Query: 6   AVKSLLEMGIPHEVAVEALQRTGGNLEAAVNFIF 39
            +K L+++G      ++AL +TGGN E A + +F
Sbjct: 389 TIKKLMDLGFSRAEVIKALTQTGGNAEFAASLLF 422

>Skud_8.33 Chr8 (66983..68464) [1482 bp, 493 aa] {ON} YHL012W (REAL)
          Length = 493

 Score = 31.6 bits (70), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 28/52 (53%)

Query: 570 EFKVNKCSSASVVQEAIRHGTKYASEMPLMFIYCEEGKIPTEEVVEKALDSN 621
           E K  KCS   +VQ+     TK+ S++PL+F+   E +  T   +EK   S+
Sbjct: 121 EVKNGKCSLDIIVQQTQNLNTKWNSDVPLIFMTSLETESHTTNFLEKHYSSD 172

>KNAG0G01580 Chr7 (352916..354136) [1221 bp, 406 aa] {ON} Anc_8.185
           YER143W
          Length = 406

 Score = 31.2 bits (69), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 12/34 (35%), Positives = 21/34 (61%)

Query: 6   AVKSLLEMGIPHEVAVEALQRTGGNLEAAVNFIF 39
           A+  L+++G      ++AL  TGGN E A +++F
Sbjct: 372 AINQLMDLGFTRTEVIKALDMTGGNAELAASYLF 405

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.131    0.377 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 67,903,657
Number of extensions: 2930476
Number of successful extensions: 9525
Number of sequences better than 10.0: 51
Number of HSP's gapped: 9719
Number of HSP's successfully gapped: 64
Length of query: 672
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 556
Effective length of database: 40,180,143
Effective search space: 22340159508
Effective search space used: 22340159508
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)