Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_15.3175.474ON62662631880.0
YOR137C (SIA1)5.474ON62262627290.0
Skud_15.3015.474ON62562526630.0
Suva_8.1895.474ON62662626340.0
TDEL0A033805.474ON55962813251e-177
NCAS0H022605.474ON57064211261e-146
NDAI0C014005.474ON70564511271e-145
TBLA0A025505.474ON5786079811e-125
SAKL0G03542g5.474ON5746109511e-120
KLTH0F15026g5.474ON5746168731e-109
Kwal_55.212685.474ON5685987804e-95
KLLA0E03147g5.474ON5786265641e-63
Ecym_24554.200ON5723413132e-29
NCAS0J012204.200ON5833592412e-20
YLR361C (DCR2)4.200ON5783512393e-20
KNAG0B058604.200ON5853652331e-19
SAKL0B05038g4.200ON5903612331e-19
TDEL0E017304.200ON5743522332e-19
Smik_12.4484.200ON5803592294e-19
Skud_12.4454.200ON5813582278e-19
KLLA0B13134g4.200ON5653542261e-18
ZYRO0B07898g4.200ON5833562232e-18
TPHA0F011004.200ON5583412171e-17
Suva_10.4624.200ON5813432143e-17
KAFR0A062104.200ON5813652134e-17
KLTH0E10824g4.200ON5803572082e-16
Kwal_55.203334.200ON5773532072e-16
NDAI0J019704.200ON5893421974e-15
Kpol_472.154.200ON5293771956e-15
TBLA0D020204.200ON6433681941e-14
ABL009W4.200ON5693531814e-13
CAGL0B02761g4.200ON5783501752e-12
ZYRO0D13156g5.554ON65080733.0
CAGL0D00528g4.280ON2081190733.8
CAGL0I00352g6.109ON16773694.1
Smik_8.1825.409ON327101715.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_15.317
         (626 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_15.317 Chr15 complement(543212..545092) [1881 bp, 626 aa] {...  1232   0.0  
YOR137C Chr15 complement(581813..583681) [1869 bp, 622 aa] {ON} ...  1055   0.0  
Skud_15.301 Chr15 complement(535844..537721) [1878 bp, 625 aa] {...  1030   0.0  
Suva_8.189 Chr8 complement(336968..338848) [1881 bp, 626 aa] {ON...  1019   0.0  
TDEL0A03380 Chr1 complement(601033..602712) [1680 bp, 559 aa] {O...   514   e-177
NCAS0H02260 Chr8 complement(443026..444738) [1713 bp, 570 aa] {O...   438   e-146
NDAI0C01400 Chr3 (292788..294905) [2118 bp, 705 aa] {ON} Anc_5.474    438   e-145
TBLA0A02550 Chr1 (616882..618618) [1737 bp, 578 aa] {ON} Anc_5.4...   382   e-125
SAKL0G03542g Chr7 complement(292214..293938) [1725 bp, 574 aa] {...   370   e-120
KLTH0F15026g Chr6 (1230760..1232484) [1725 bp, 574 aa] {ON} simi...   340   e-109
Kwal_55.21268 s55 (759935..761641) [1707 bp, 568 aa] {ON} YOR137...   305   4e-95
KLLA0E03147g Chr5 complement(290622..292358) [1737 bp, 578 aa] {...   221   1e-63
Ecym_2455 Chr2 complement(885426..887144) [1719 bp, 572 aa] {ON}...   125   2e-29
NCAS0J01220 Chr10 complement(212622..214373) [1752 bp, 583 aa] {...    97   2e-20
YLR361C Chr12 complement(847388..849124) [1737 bp, 578 aa] {ON} ...    97   3e-20
KNAG0B05860 Chr2 complement(1152991..1154748) [1758 bp, 585 aa] ...    94   1e-19
SAKL0B05038g Chr2 complement(434061..435833) [1773 bp, 590 aa] {...    94   1e-19
TDEL0E01730 Chr5 (333362..335086) [1725 bp, 574 aa] {ON} Anc_4.2...    94   2e-19
Smik_12.448 Chr12 complement(786446..788188) [1743 bp, 580 aa] {...    93   4e-19
Skud_12.445 Chr12 complement(787532..789277) [1746 bp, 581 aa] {...    92   8e-19
KLLA0B13134g Chr2 (1149114..1150811) [1698 bp, 565 aa] {ON} simi...    92   1e-18
ZYRO0B07898g Chr2 (616796..618547) [1752 bp, 583 aa] {ON} simila...    91   2e-18
TPHA0F01100 Chr6 complement(249205..250881) [1677 bp, 558 aa] {O...    88   1e-17
Suva_10.462 Chr10 complement(807033..808778) [1746 bp, 581 aa] {...    87   3e-17
KAFR0A06210 Chr1 (1254374..1256119) [1746 bp, 581 aa] {ON} Anc_4...    87   4e-17
KLTH0E10824g Chr5 (973337..975079) [1743 bp, 580 aa] {ON} simila...    85   2e-16
Kwal_55.20333 s55 (355985..357718) [1734 bp, 577 aa] {ON} YLR361...    84   2e-16
NDAI0J01970 Chr10 complement(488882..490651) [1770 bp, 589 aa] {...    80   4e-15
Kpol_472.15 s472 (43361..44950) [1590 bp, 529 aa] {ON} (43361..4...    80   6e-15
TBLA0D02020 Chr4 (503782..505713) [1932 bp, 643 aa] {ON} Anc_4.2...    79   1e-14
ABL009W Chr2 (381100..382809) [1710 bp, 569 aa] {ON} Syntenic ho...    74   4e-13
CAGL0B02761g Chr2 (265971..267707) [1737 bp, 578 aa] {ON} simila...    72   2e-12
ZYRO0D13156g Chr4 complement(1106020..1107972) [1953 bp, 650 aa]...    33   3.0  
CAGL0D00528g Chr4 (64404..70649) [6246 bp, 2081 aa] {ON} highly ...    33   3.8  
CAGL0I00352g Chr9 (26900..27403) [504 bp, 167 aa] {ON} highly si...    31   4.1  
Smik_8.182 Chr8 (299804..300787) [984 bp, 327 aa] {ON} YHR104W (...    32   5.1  

>Smik_15.317 Chr15 complement(543212..545092) [1881 bp, 626 aa] {ON}
           YOR137C (REAL)
          Length = 626

 Score = 1232 bits (3188), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 599/626 (95%), Positives = 599/626 (95%)

Query: 1   MRLHYRRKFNFLRRVXXXXXXXXXXXXXXXXKLHAKNALINPNTAEYHEGMIDDIQVLRC 60
           MRLHYRRKFNFLRRV                KLHAKNALINPNTAEYHEGMIDDIQVLRC
Sbjct: 1   MRLHYRRKFNFLRRVLFILSIISLYLSRDSLKLHAKNALINPNTAEYHEGMIDDIQVLRC 60

Query: 61  YHWYRQCGSLYAPRLHPSNTASKVKDKNNVLWSRVSKNITIEALYSLQSGAFYNSYLYVH 120
           YHWYRQCGSLYAPRLHPSNTASKVKDKNNVLWSRVSKNITIEALYSLQSGAFYNSYLYVH
Sbjct: 61  YHWYRQCGSLYAPRLHPSNTASKVKDKNNVLWSRVSKNITIEALYSLQSGAFYNSYLYVH 120

Query: 121 PKGFQSNSRNSIKELAIARDSALIPLQVLRDINKMVKSSDSSVFHNHVYQREKPTSSWWK 180
           PKGFQSNSRNSIKELAIARDSALIPLQVLRDINKMVKSSDSSVFHNHVYQREKPTSSWWK
Sbjct: 121 PKGFQSNSRNSIKELAIARDSALIPLQVLRDINKMVKSSDSSVFHNHVYQREKPTSSWWK 180

Query: 181 LLFGISVDSDDIAVFGEEWVYKGSGIWCKYVLNDDDSDPPIISLEIYLGSSFIESRPSWK 240
           LLFGISVDSDDIAVFGEEWVYKGSGIWCKYVLNDDDSDPPIISLEIYLGSSFIESRPSWK
Sbjct: 181 LLFGISVDSDDIAVFGEEWVYKGSGIWCKYVLNDDDSDPPIISLEIYLGSSFIESRPSWK 240

Query: 241 EVMHEFHRNNIPSLPISITRKLKTKNNLHKASKRLTGPLKAPEKDNNILELLQVDGNYKI 300
           EVMHEFHRNNIPSLPISITRKLKTKNNLHKASKRLTGPLKAPEKDNNILELLQVDGNYKI
Sbjct: 241 EVMHEFHRNNIPSLPISITRKLKTKNNLHKASKRLTGPLKAPEKDNNILELLQVDGNYKI 300

Query: 301 TSPHIQFSRGQRSFKILQMTDFHFKCTDNSMSIINEIRTVNFIDRVLALENPDLVVITGD 360
           TSPHIQFSRGQRSFKILQMTDFHFKCTDNSMSIINEIRTVNFIDRVLALENPDLVVITGD
Sbjct: 301 TSPHIQFSRGQRSFKILQMTDFHFKCTDNSMSIINEIRTVNFIDRVLALENPDLVVITGD 360

Query: 361 LLDSQNTIDYQTCIMKLVQPMISNKIPYAISLGVSDESNLATPSQVQDYIRNLPYTFNSV 420
           LLDSQNTIDYQTCIMKLVQPMISNKIPYAISLGVSDESNLATPSQVQDYIRNLPYTFNSV
Sbjct: 361 LLDSQNTIDYQTCIMKLVQPMISNKIPYAISLGVSDESNLATPSQVQDYIRNLPYTFNSV 420

Query: 421 ASEEGHIAIRVSFXXXXXXXXXXXRGINAKDETTPSEALFFVFDSFNPVNDFLLDYSNLI 480
           ASEEGHIAIRVSF           RGINAKDETTPSEALFFVFDSFNPVNDFLLDYSNLI
Sbjct: 421 ASEEGHIAIRVSFKKKLLKNTLLKRGINAKDETTPSEALFFVFDSFNPVNDFLLDYSNLI 480

Query: 481 GKIDYGLAFQYFPLSEYRPHGLFPIIGQYNERSTLTVDTSRSKGEVSMTIDGKNYKSFLD 540
           GKIDYGLAFQYFPLSEYRPHGLFPIIGQYNERSTLTVDTSRSKGEVSMTIDGKNYKSFLD
Sbjct: 481 GKIDYGLAFQYFPLSEYRPHGLFPIIGQYNERSTLTVDTSRSKGEVSMTIDGKNYKSFLD 540

Query: 541 ILNLWNIKGVSCGHEHNNDCCLQSINEMWLCYGGSAGIDVARIEGIHPNVRLFNLDDIKD 600
           ILNLWNIKGVSCGHEHNNDCCLQSINEMWLCYGGSAGIDVARIEGIHPNVRLFNLDDIKD
Sbjct: 541 ILNLWNIKGVSCGHEHNNDCCLQSINEMWLCYGGSAGIDVARIEGIHPNVRLFNLDDIKD 600

Query: 601 EITSWKRSSNLVDEVYDYQYIYKGKH 626
           EITSWKRSSNLVDEVYDYQYIYKGKH
Sbjct: 601 EITSWKRSSNLVDEVYDYQYIYKGKH 626

>YOR137C Chr15 complement(581813..583681) [1869 bp, 622 aa] {ON}
           SIA1Protein of unassigned function involved in
           activation of the Pma1p plasma membrane H+-ATPase by
           glucose
          Length = 622

 Score = 1055 bits (2729), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 505/626 (80%), Positives = 555/626 (88%), Gaps = 4/626 (0%)

Query: 1   MRLHYRRKFNFLRRVXXXXXXXXXXXXXXXXKLHAKNALINPNTAEYHEGMIDDIQVLRC 60
           MRLHYRR+FNFLRR+                KLHAKN L++ N AEYH GMIDDIQ+LRC
Sbjct: 1   MRLHYRRRFNFLRRILFILCITSLYLSRDSLKLHAKNVLMDHNVAEYHGGMIDDIQILRC 60

Query: 61  YHWYRQCGSLYAPRLHPSNTASKVKDKNNVLWSRVSKNITIEALYSLQSGAFYNSYLYVH 120
           YHWYRQC SLYAP+LHPSNTA K+KDKN++LW+RVSKNIT+E LYSLQSG FYNSYLYVH
Sbjct: 61  YHWYRQCSSLYAPKLHPSNTAKKIKDKNSILWTRVSKNITVETLYSLQSGPFYNSYLYVH 120

Query: 121 PKGFQSNSRNSIKELAIARDSALIPLQVLRDINKMVKSSDSSVFHNHVYQREKPTSSWWK 180
            K FQSN +N+IKELAIARDSALIPLQVLRDINK+VKSSDSSVFHNHVY REKPTSSWWK
Sbjct: 121 LKDFQSNPKNTIKELAIARDSALIPLQVLRDINKLVKSSDSSVFHNHVYLREKPTSSWWK 180

Query: 181 LLFGISVDSDDIAVFGEEWVYKGSGIWCKYVLNDDDSDPPIISLEIYLGSSFIESRPSWK 240
           LLFGISVD+D+IAVFGEEWVYKGSGIWCKY+LNDDD+D PI +LEIYLGSSFIESRPSWK
Sbjct: 181 LLFGISVDTDNIAVFGEEWVYKGSGIWCKYILNDDDNDAPITNLEIYLGSSFIESRPSWK 240

Query: 241 EVMHEFHRNNIPSLPISITRKLKTKNNLHKASKRLTGPLKAPEKDNNILELLQVDGNYKI 300
           EV+HEFHRNNIPSLPISITRKL+TKN+ HK S  L G L+ P KD NI    QVD +YKI
Sbjct: 241 EVIHEFHRNNIPSLPISITRKLETKNHHHKFSNGLLGSLRTPSKDINI----QVDADYKI 296

Query: 301 TSPHIQFSRGQRSFKILQMTDFHFKCTDNSMSIINEIRTVNFIDRVLALENPDLVVITGD 360
           TSPHIQFSRGQRSFKILQ+TDFHFKCTDNSM++INEI+TVNFIDRVLA ENPDLVVITGD
Sbjct: 297 TSPHIQFSRGQRSFKILQITDFHFKCTDNSMTVINEIKTVNFIDRVLASENPDLVVITGD 356

Query: 361 LLDSQNTIDYQTCIMKLVQPMISNKIPYAISLGVSDESNLATPSQVQDYIRNLPYTFNSV 420
           LLDS NTIDYQTCIMK+VQPMISNKIPYAISLGVSDESNLAT +Q++D+IRNLPYTFN+V
Sbjct: 357 LLDSHNTIDYQTCIMKVVQPMISNKIPYAISLGVSDESNLATSAQIRDFIRNLPYTFNNV 416

Query: 421 ASEEGHIAIRVSFXXXXXXXXXXXRGINAKDETTPSEALFFVFDSFNPVNDFLLDYSNLI 480
           ASEEGH+AI VSF           R I+ +DET PSEALFFVFDSF PVN+FL DY++LI
Sbjct: 417 ASEEGHMAIEVSFKKKLTKNTLLERDIDTEDETNPSEALFFVFDSFAPVNNFLQDYNDLI 476

Query: 481 GKIDYGLAFQYFPLSEYRPHGLFPIIGQYNERSTLTVDTSRSKGEVSMTIDGKNYKSFLD 540
           GKID+GLAFQYFPLSEYRPHGLFPIIGQYNERSTLTVDT RS+G+VSMTI+GK+YKSFLD
Sbjct: 477 GKIDFGLAFQYFPLSEYRPHGLFPIIGQYNERSTLTVDTPRSRGQVSMTINGKHYKSFLD 536

Query: 541 ILNLWNIKGVSCGHEHNNDCCLQSINEMWLCYGGSAGIDVARIEGIHPNVRLFNLDDIKD 600
           IL+LWNIKGVSCGHEHNNDCCLQS NEMWLCYGGSAGI + RI+GI+P VRLFNLDDI D
Sbjct: 537 ILSLWNIKGVSCGHEHNNDCCLQSKNEMWLCYGGSAGIGLPRIQGIYPTVRLFNLDDILD 596

Query: 601 EITSWKRSSNLVDEVYDYQYIYKGKH 626
           EITSWKR+SNLVDEVYDYQYIYKGK 
Sbjct: 597 EITSWKRNSNLVDEVYDYQYIYKGKQ 622

>Skud_15.301 Chr15 complement(535844..537721) [1878 bp, 625 aa] {ON}
           YOR137C (REAL)
          Length = 625

 Score = 1030 bits (2663), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 488/625 (78%), Positives = 552/625 (88%)

Query: 1   MRLHYRRKFNFLRRVXXXXXXXXXXXXXXXXKLHAKNALINPNTAEYHEGMIDDIQVLRC 60
           MRLH RRK NFLRR+                +L+ KN  INP  AEY+ G IDDIQ+LRC
Sbjct: 1   MRLHNRRKVNFLRRILFILCIFLLYLSRDSLRLNTKNVFINPKIAEYNGGTIDDIQILRC 60

Query: 61  YHWYRQCGSLYAPRLHPSNTASKVKDKNNVLWSRVSKNITIEALYSLQSGAFYNSYLYVH 120
           YHWYRQCGSLYAPRLHPS +A +VKDK++VLWSRVSKNIT+E+LYSLQSG FYNSYLYVH
Sbjct: 61  YHWYRQCGSLYAPRLHPSTSAERVKDKSSVLWSRVSKNITVESLYSLQSGTFYNSYLYVH 120

Query: 121 PKGFQSNSRNSIKELAIARDSALIPLQVLRDINKMVKSSDSSVFHNHVYQREKPTSSWWK 180
            K FQ NS+NSIKELA+ARDSALIPLQVLRDINKMVKSSDSSVFHNHVY+REKPTSSWWK
Sbjct: 121 MKSFQGNSKNSIKELAMARDSALIPLQVLRDINKMVKSSDSSVFHNHVYRREKPTSSWWK 180

Query: 181 LLFGISVDSDDIAVFGEEWVYKGSGIWCKYVLNDDDSDPPIISLEIYLGSSFIESRPSWK 240
           LLFGISVDSDDIAVFGEEWVYKGSGIWCK++LNDDD+DPPII+LEIYLGSSFIESRP WK
Sbjct: 181 LLFGISVDSDDIAVFGEEWVYKGSGIWCKFILNDDDNDPPIINLEIYLGSSFIESRPFWK 240

Query: 241 EVMHEFHRNNIPSLPISITRKLKTKNNLHKASKRLTGPLKAPEKDNNILELLQVDGNYKI 300
           EV+HEFHRNN+PS+PISITRK +TKN  +K   +L G L+AP+K+N+ L LLQ D +Y+I
Sbjct: 241 EVIHEFHRNNMPSMPISITRKHETKNAHYKYPNKLPGSLEAPDKNNDALRLLQADEDYRI 300

Query: 301 TSPHIQFSRGQRSFKILQMTDFHFKCTDNSMSIINEIRTVNFIDRVLALENPDLVVITGD 360
           TS HIQ+S GQRSFKILQMTDFHFKCTDNSMSIINEIRTVNFIDRVLALE PDLVVITGD
Sbjct: 301 TSSHIQYSWGQRSFKILQMTDFHFKCTDNSMSIINEIRTVNFIDRVLALEKPDLVVITGD 360

Query: 361 LLDSQNTIDYQTCIMKLVQPMISNKIPYAISLGVSDESNLATPSQVQDYIRNLPYTFNSV 420
           LLDSQN++DYQTCIMKLVQPMISN++PYAISLG SDESN AT SQ++D+I NLPY FN++
Sbjct: 361 LLDSQNSMDYQTCIMKLVQPMISNQVPYAISLGASDESNFATLSQIKDFIGNLPYAFNNI 420

Query: 421 ASEEGHIAIRVSFXXXXXXXXXXXRGINAKDETTPSEALFFVFDSFNPVNDFLLDYSNLI 480
           AS+EGH+AI+VSF           + ++  +ET+P+EALFFVFDSFNPVNDFLLDYS+LI
Sbjct: 421 ASKEGHMAIKVSFNKKLSKNALLEKRVDNNEETSPAEALFFVFDSFNPVNDFLLDYSDLI 480

Query: 481 GKIDYGLAFQYFPLSEYRPHGLFPIIGQYNERSTLTVDTSRSKGEVSMTIDGKNYKSFLD 540
           GKIDYGLAFQYFPLSEYRP GLFPIIGQYNE+STLTV+TSR KGEVSMTI+GK+Y+SFLD
Sbjct: 481 GKIDYGLAFQYFPLSEYRPRGLFPIIGQYNEKSTLTVETSRCKGEVSMTINGKHYESFLD 540

Query: 541 ILNLWNIKGVSCGHEHNNDCCLQSINEMWLCYGGSAGIDVARIEGIHPNVRLFNLDDIKD 600
           IL+LWN+KGV CGHEHNNDCCLQS N+MWLCYGGSAGID+ RIEGI+PNVRLFN+DDI D
Sbjct: 541 ILSLWNMKGVGCGHEHNNDCCLQSKNDMWLCYGGSAGIDLPRIEGIYPNVRLFNVDDIMD 600

Query: 601 EITSWKRSSNLVDEVYDYQYIYKGK 625
           EITSWKR+S +VDEVYDYQYIYKG+
Sbjct: 601 EITSWKRNSIIVDEVYDYQYIYKGE 625

>Suva_8.189 Chr8 complement(336968..338848) [1881 bp, 626 aa] {ON}
           YOR137C (REAL)
          Length = 626

 Score = 1019 bits (2634), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 487/626 (77%), Positives = 542/626 (86%)

Query: 1   MRLHYRRKFNFLRRVXXXXXXXXXXXXXXXXKLHAKNALINPNTAEYHEGMIDDIQVLRC 60
           MRLHYRRKFNFLRR+                 L+AKN L++PN  EYH G+IDDIQVLRC
Sbjct: 1   MRLHYRRKFNFLRRILFILCIFSLYLSRDSLSLNAKNTLLSPNLTEYHGGLIDDIQVLRC 60

Query: 61  YHWYRQCGSLYAPRLHPSNTASKVKDKNNVLWSRVSKNITIEALYSLQSGAFYNSYLYVH 120
           Y WYRQCGSLYAPRL PS    K K+K NVLW+RVSKNI++E +YSLQ+G FYNSYLYVH
Sbjct: 61  YCWYRQCGSLYAPRLQPSGAGKKAKEKKNVLWNRVSKNISVEPMYSLQTGIFYNSYLYVH 120

Query: 121 PKGFQSNSRNSIKELAIARDSALIPLQVLRDINKMVKSSDSSVFHNHVYQREKPTSSWWK 180
            K  QS  +NSIKELAIARDSALIPLQVLRDINKMVKSSDSSVFHNHVYQR+KPTS WWK
Sbjct: 121 AKNIQSKLKNSIKELAIARDSALIPLQVLRDINKMVKSSDSSVFHNHVYQRDKPTSPWWK 180

Query: 181 LLFGISVDSDDIAVFGEEWVYKGSGIWCKYVLNDDDSDPPIISLEIYLGSSFIESRPSWK 240
           LL GI+VDSDDI+VFGEEWVYKG+GIWCKY+LN+D +D PI+ LEIYLGSSFIESRP+WK
Sbjct: 181 LLLGIAVDSDDISVFGEEWVYKGNGIWCKYILNNDGNDLPIVDLEIYLGSSFIESRPNWK 240

Query: 241 EVMHEFHRNNIPSLPISITRKLKTKNNLHKASKRLTGPLKAPEKDNNILELLQVDGNYKI 300
           EV+HEFHRNNIPSLPISITRK+ T    H     L GPLK+PE +NNIL LLQVD +Y+I
Sbjct: 241 EVIHEFHRNNIPSLPISITRKINTPRTRHGPLNGLPGPLKSPENENNILRLLQVDEDYRI 300

Query: 301 TSPHIQFSRGQRSFKILQMTDFHFKCTDNSMSIINEIRTVNFIDRVLALENPDLVVITGD 360
           TSPHIQFS+GQRSFKILQMTDFHFKCT+N M+IINEIRTVNFIDR+LALENPDLVVITGD
Sbjct: 301 TSPHIQFSKGQRSFKILQMTDFHFKCTENGMTIINEIRTVNFIDRMLALENPDLVVITGD 360

Query: 361 LLDSQNTIDYQTCIMKLVQPMISNKIPYAISLGVSDESNLATPSQVQDYIRNLPYTFNSV 420
           LLDS N++DYQTCIM+LVQPMISNKIPYAISLG SDES LA+  Q++D+I NLPY+FN V
Sbjct: 361 LLDSANSMDYQTCIMRLVQPMISNKIPYAISLGASDESKLASLPQIKDFISNLPYSFNHV 420

Query: 421 ASEEGHIAIRVSFXXXXXXXXXXXRGINAKDETTPSEALFFVFDSFNPVNDFLLDYSNLI 480
           A+EEGH+AI+VSF           R  +AK E++PSEALFF+FDSFNPV DFLLDYSNLI
Sbjct: 421 ATEEGHMAIQVSFKKKLLKHALFERETDAKYESSPSEALFFIFDSFNPVGDFLLDYSNLI 480

Query: 481 GKIDYGLAFQYFPLSEYRPHGLFPIIGQYNERSTLTVDTSRSKGEVSMTIDGKNYKSFLD 540
           GKIDYGL FQYFP+SEYRPHGLFPIIGQYNERSTLTVDT+RSKGEVSMTI GK+Y SFLD
Sbjct: 481 GKIDYGLTFQYFPISEYRPHGLFPIIGQYNERSTLTVDTARSKGEVSMTIGGKHYNSFLD 540

Query: 541 ILNLWNIKGVSCGHEHNNDCCLQSINEMWLCYGGSAGIDVARIEGIHPNVRLFNLDDIKD 600
           ILNLWN+KGVSCGHEHNNDCCLQS NEMWLCYGGSAG+DV+R+EG++PNVRLFNLDDI D
Sbjct: 541 ILNLWNVKGVSCGHEHNNDCCLQSKNEMWLCYGGSAGMDVSRMEGLYPNVRLFNLDDIMD 600

Query: 601 EITSWKRSSNLVDEVYDYQYIYKGKH 626
           EITSWKRSSNLVDEVYDYQYIYKGK 
Sbjct: 601 EITSWKRSSNLVDEVYDYQYIYKGKQ 626

>TDEL0A03380 Chr1 complement(601033..602712) [1680 bp, 559 aa] {ON}
           Anc_5.474 YOR137C
          Length = 559

 Score =  514 bits (1325), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 275/628 (43%), Positives = 384/628 (61%), Gaps = 77/628 (12%)

Query: 2   RLHYRRKFNFLRRVXXXXXXXXXXXXXXXXKLHAKNALINPNTAEYHEGMIDDIQVLRCY 61
           RL +RR    LRR+                 +H +N    P T+EY  G+IDD+Q +RCY
Sbjct: 4   RLRHRRIITILRRLAIASFFLLAYSSRSSFIIHLQNTFNVPTTSEYRGGLIDDVQSIRCY 63

Query: 62  HWYRQCGSLYAPRLHPSNTASKVKDKNNVLWSRVSKNITIEALYSLQSGAFYNSYLYVHP 121
            W+ QC SL A +        +  D   V WSR+SKN+T E+LYS+++  FY +YLYVH 
Sbjct: 64  RWFGQCRSLIAKQ--------RSSDDRIVSWSRISKNLTDESLYSIETSFFYKTYLYVHE 115

Query: 122 KGFQSNSRNSIKELAIARDSALIPLQVLRDINKMVKSSDSSVFHNHVYQREKPTSSWWKL 181
                N    I ELAI+RDS++IP+QV +D+ +++K+SDSSVFHNHV++  +P   ++  
Sbjct: 116 WDGSVNP-GPISELAISRDSSMIPIQVTQDVQRLIKTSDSSVFHNHVHRERRPIIDFFTR 174

Query: 182 LFGISVDSDDIAVFGEEWVYKGSGIWCKYVLNDDDSDPPIISLEIYLGSSFIESRPSWKE 241
                 DSD I   GE+W YKG GIWCK+  + D    PI ++++YLGS F+ESRP+WKE
Sbjct: 175 DHS---DSDIIHSLGEDWKYKGGGIWCKHRSDQD----PITNIQLYLGSGFLESRPNWKE 227

Query: 242 VMHEFHRN-NIPSLPISITRKLKTKNNLHKASKRLTGPLKAPEKDNNILELLQVDGNYKI 300
           V+HE+ RN    S  IS+TR++   NN H+      G      KD+++L +         
Sbjct: 228 VIHEYSRNKGHKSQLISVTREI---NNGHEK-----GEQSVIIKDDDVLRIS-------- 271

Query: 301 TSPHIQFSRGQRSFKILQMTDFHFKCTDNSMSIINEIRTVNFIDRVLALENPDLVVITGD 360
            SPH       +S KILQ++D HF+C+++++++++E +T +FI  V++ E PDLVV+TGD
Sbjct: 272 LSPHYG-----KSLKILQISDIHFRCSEDTIAVLSEFQTKHFISNVISRERPDLVVVTGD 326

Query: 361 LLDSQNTIDYQTCIMKLVQPMISNKIPYAISLGVSDESNLATPSQVQDYIRNLPYTFNSV 420
            LD  N++DYQ CIMKLVQPMI +K PYAI+ GVSD S  A  SQ+QD+I+ LPY+ N  
Sbjct: 327 FLDGDNSLDYQACIMKLVQPMIKSKTPYAITTGVSDYSRFAAISQIQDFIKGLPYSLNRY 386

Query: 421 ASEEGHIAIRVSFXXXXXXXXXXXRGINAKDETTPSEALFFVFDSFNPVNDFL---LDYS 477
           AS EGH+AI   F                   +  ++A  ++ DSF+PV  F     DY 
Sbjct: 387 ASPEGHLAISSHF-------------------SKGTDAAIYILDSFHPVKQFFSMQKDYQ 427

Query: 478 NLIGKIDYGLAFQYFPLSEYRPHGLFPIIGQYNERSTLTVDTSRSKGEVSMTIDGKNYKS 537
                  Y LAF++ P+ EYRP G+FPIIGQYNE+S +           S   D K  + 
Sbjct: 428 TY----RYALAFRHLPIPEYRPEGVFPIIGQYNEQSIVK----------SKLFDDKILQK 473

Query: 538 FLDILNLWNIKGVSCGHEHNNDCCLQSINEMWLCYGGSAGIDVARIEGIHPNVRLFNLDD 597
              I+  +N+K +SCGHEH+NDCCLQS  +MWLCYGGSAGI + R+ G+ P+VRLFN+D 
Sbjct: 474 ---IMYSFNVKAMSCGHEHSNDCCLQSRGDMWLCYGGSAGIGIDRMNGMEPSVRLFNIDG 530

Query: 598 IKDEITSWKRSSNLVDEVYDYQYIYKGK 625
             DE+TSWKR+  L++ VYDYQYIY+G+
Sbjct: 531 DLDEVTSWKRNFRLIESVYDYQYIYQGQ 558

>NCAS0H02260 Chr8 complement(443026..444738) [1713 bp, 570 aa] {ON}
           Anc_5.474
          Length = 570

 Score =  438 bits (1126), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 258/642 (40%), Positives = 361/642 (56%), Gaps = 93/642 (14%)

Query: 1   MRLHYRRKFNFLRRVXXXXXXXXXXXXXXXXKLHAKNALINPNTAEYHEGMIDDIQVLRC 60
           MRL  RR     +R+                + H KN        EY  G I DIQ + C
Sbjct: 1   MRLKTRRIVKTSQRLLQLLIFFILCNSLGSLRNHLKNVFRQDIPEEYTGGPITDIQCIPC 60

Query: 61  YHWYRQCGSLYAPRLHPSNTASKVKDKNNVLWSRVSKNITIEALYSLQSGAFYNSYLYVH 120
           ++WY+ CGS+                 N+  W RVSKN++ E+LYS++SG F  S+LYV 
Sbjct: 61  FYWYQTCGSIIW---------------NDQKWLRVSKNLSDESLYSMESGPFSRSFLYVR 105

Query: 121 PKGFQSNSRNSIKELAIARDSALIPLQVLRDINKMVKSSDSSVFHNHVYQREKPT--SSW 178
               Q      I ++AI+ D  +IP+ V +DIN +++SSDSSV+HNH + ++  +  +SW
Sbjct: 106 ----QDTGEKPISDIAISSDPLMIPVHVTQDINNLLQSSDSSVYHNHKFHQKGSSWRASW 161

Query: 179 -WKLLFGISVDS------------DDIAVFGEEWVYKGSGIWCKYVLNDDDSDPPIISLE 225
            W    G  + S            DDI++ GE W YKG GIWCK+    D++   + ++E
Sbjct: 162 SWFWNSGKVLASHDHADDASDSTMDDISLRGENWKYKGYGIWCKF----DNTKEIVANIE 217

Query: 226 IYLGSSFIESRPSWKEVMHEFHRNNIPSLPISITRKLKTKNNLHKASKRLTGPLKAPEKD 285
           I+LGS F+ESRP W+EV+HEF  ++   LPISIT K+ T        K  TG L      
Sbjct: 218 IFLGSLFLESRPYWREVIHEFKPDDKLPLPISITVKIATN------VKEETGELN----- 266

Query: 286 NNILELLQVDGNYKITSPHIQFSRGQRSFKILQMTDFHFKCTDNSMSIINEIRTVNFIDR 345
                    DG  K+ S           FKILQ++D HF+ + NSM ++ E +T+ FI  
Sbjct: 267 ---------DGTLKMDS----------KFKILQVSDVHFRSSINSMPMLKEYQTMQFITN 307

Query: 346 VLALENPDLVVITGDLLDSQNTIDYQTCIMKLVQPMISNKIPYAISLGVSDESNLATPSQ 405
            +  E P+LV++TGD+LDS N+IDYQTCIM LVQPMI  KIPY I+LG +D S  A+  Q
Sbjct: 308 TITRELPNLVIVTGDILDSTNSIDYQTCIMNLVQPMIKFKIPYIITLGSADYSEYASRDQ 367

Query: 406 VQDYIRNLPYTFNSVASEEGHIAIRVSFXXXXXXXXXXXRGINAKDETTPSEALFFVFDS 465
           + ++I  LPY+    +++ GH+ I +             +  + K E +  E + +V DS
Sbjct: 368 IINFISTLPYSLTKFSTDNGHLIIPL------------HKFNDPKGEVSQDELMIYVIDS 415

Query: 466 FNPV-NDFLLDYSNLIGK---IDYGLAFQYFPLSEYRPHGLFPIIGQYNERSTLTVDTSR 521
           F+ + ND  + +  +  K    +Y LAF+  P+ +YRP GLFPIIGQYNER++L +    
Sbjct: 416 FHSIEND--VKFKEIASKPVDWEYALAFRSLPIPQYRPDGLFPIIGQYNERTSLEL---- 469

Query: 522 SKGEVSMTIDGKNYKSFLDILNLWNIKGVSCGHEHNNDCCLQSINEMWLCYGGSAGIDVA 581
            +  V   +   N  +  D L    +K +SCGHEHNNDCCLQS NEMWLCYGGS G+   
Sbjct: 470 -RENVGTAVG--NVINLQDFLISKKVKSISCGHEHNNDCCLQSKNEMWLCYGGSTGVGTK 526

Query: 582 RIEGIHPNVRLFNLDDIKDEITSWKRSSNLVDEVYDYQYIYK 623
           R+EG+  NVRLF++D    EITSWKR+ +L+D VYDYQYIYK
Sbjct: 527 RMEGLFANVRLFDIDTDIGEITSWKRNMHLIDNVYDYQYIYK 568

>NDAI0C01400 Chr3 (292788..294905) [2118 bp, 705 aa] {ON} Anc_5.474
          Length = 705

 Score =  438 bits (1127), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 258/645 (40%), Positives = 361/645 (55%), Gaps = 110/645 (17%)

Query: 35  AKNALINPNTAEYHEGMIDDIQVLRCYHWYRQCGSLYAPRLHPSNTASKVKDKNNVLWSR 94
            +++ I+P   EY EG I DIQ LRCYHWY  C  L+                + +LW R
Sbjct: 113 TRDSTIHP---EYEEGPILDIQRLRCYHWYSTCNVLW---------------HDGILWQR 154

Query: 95  VSKNITIEALYSLQSGAFYNSYLYVH-------------PKGFQSNSRNSIKELAIARDS 141
           + K+++ E LY+L+S  +Y+SY+YV              P G   ++   I E+A++RD 
Sbjct: 155 IKKDLSDEKLYALESTQYYDSYIYVKTLSANMDTLSPNIPNG-SPHTLKRISEIAMSRDP 213

Query: 142 ALIPLQVLRDINKMVKSSDSSVFHNHVYQR----EKPTSS-------------------- 177
            +IP+QV+RD+NK+ KSSDSS+FH HV+ +      P  S                    
Sbjct: 214 TIIPMQVIRDVNKLFKSSDSSMFHTHVFHQSGDEHDPVYSDNHAHNKNKDIDVHDDNSHM 273

Query: 178 --------WWKLLFGISVDS--DDIAVFGEEWVYKGSGIWCKYVLNDDDSDPPIIS-LEI 226
                    W  L  IS DS  DD+++ GE+W Y+GSGIWCKY  N  + +P I++ LEI
Sbjct: 274 NGYQFLQQIWSWLLAIS-DSHDDDLSLMGEDWKYRGSGIWCKYE-NGVEMEPMIVNKLEI 331

Query: 227 YLGSSFIESRPSWKEVMHEFHRNNIP---SLPISITRKLKTKNNLHKASKRLTGPLKAPE 283
           YLGSSF E R +WKE++HE+         SLPISITR++              G     +
Sbjct: 332 YLGSSFQEFRHNWKEIIHEYKTERDERDVSLPISITRQI--------------GRGTKTD 377

Query: 284 KDNNILELLQVDGNYKITSPHIQFSRGQRSFKILQMTDFHFKCTDNSMSIINEIRTVNFI 343
            D  IL   + +  + + +           FKILQ++D H+KC+D S+S + E +T NFI
Sbjct: 378 PDKIILIEKETEKKFGLMTAF--------GFKILQVSDLHYKCSDESISNLKEFQTNNFI 429

Query: 344 DRVLALENPDLVVITGDLLDSQNTIDYQTCIMKLVQPMISNKIPYAISLGVSDESNLATP 403
            +V+  E P+L+VITGD+LD  N +DYQTCIMKLVQP I+ +IPY I LG SD S  A+ 
Sbjct: 430 KKVILREFPNLIVITGDILDGTNCVDYQTCIMKLVQPFINFEIPYLIMLGTSDYSRYASR 489

Query: 404 SQVQDYIRNLPYTFNSVASEEGHIAIRVSFXXXXXXXXXXXRGINAKDETTPSEALFFVF 463
             +  +IR LPY  N ++       + +                N  D+      + +  
Sbjct: 490 ESILQFIRTLPYCINKLSQNVNDTNVMIPIYNKY----------NDDDKVNDPYIMIYGV 539

Query: 464 DSFNPVNDFLLDYSNLIGKIDYGLAFQYFPLSEYRPHGLFPIIGQYNERSTLTVDTSRSK 523
           DSFNP+++  +     + K DYGLAF+  P+ EYRP G+FPI+GQYNE+S+LT +   + 
Sbjct: 540 DSFNPIDNTKMKNEGSV-KWDYGLAFRSLPIPEYRPEGMFPIVGQYNEKSSLTFEEFANN 598

Query: 524 GEVSMTIDGKNYK-----SFLDILNLWNIKGVSCGHEHNNDCCLQSINEMWLCYGGSAGI 578
            +     DG + +        D L   N++ +SCGHEH+NDCCLQS N+MWLCY GS+G+
Sbjct: 599 DDSVDADDGGDGRWIGANKLQDFLISENVQVLSCGHEHSNDCCLQSKNKMWLCYDGSSGM 658

Query: 579 DVARIEGIHPNVRLFNLDDIKDEITSWKRSSNLVDEVYDYQYIYK 623
           DVAR+E IH +VRLF +D    EITSWKR+SN +D VYDYQYIYK
Sbjct: 659 DVARLENIHASVRLFEVDTNAGEITSWKRNSNSIDNVYDYQYIYK 703

>TBLA0A02550 Chr1 (616882..618618) [1737 bp, 578 aa] {ON} Anc_5.474
           YOR137C
          Length = 578

 Score =  382 bits (981), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 219/607 (36%), Positives = 341/607 (56%), Gaps = 75/607 (12%)

Query: 32  KLHAKNALINPNTAEYHEGMIDDIQVLRCYHWYRQCGSLYAPRLHPSNTASKVKDKNNVL 91
           +L   N    PN  EY+ G+IDDI++++CY WY+ C +LYA         S V D + VL
Sbjct: 31  RLFFLNVKSQPNAVEYNGGLIDDIKLMKCYRWYKNCETLYA--------QSAVHDNSFVL 82

Query: 92  WSRVSKNITIEALYSLQSGAFYNSYLYVHPKGFQSN---SRNSIKELAIARDSALIPLQV 148
           W+RVSKN+T  +LY+++S   Y ++ YVH     +N    +  + ++A++RD +L+PL V
Sbjct: 83  WNRVSKNMTDSSLYAIESNWLYETFFYVHLFNTNANKEDEKQPLADIAVSRDPSLVPLTV 142

Query: 149 LRDINKMVKSSDSSVFHNHVYQREKPTSSWWKLLFGISVDSDDIAVFGEEWVYKGSGIWC 208
           L+++   ++SSDS + +  +Y ++   +SWW   +   + +        +W +    +W 
Sbjct: 143 LQEVMPSLRSSDSMMGNKRLYYQK---TSWWYRFWNNPLPTK--MNLMNKWKHNNDILWS 197

Query: 209 KYVLNDDDSDPPIISLEIYLGSSFIESRPSWKEVMHEFHRNNIPSLPISITRKLKTKNNL 268
           K  +  D     I ++++YLGS+F+ESRP WKE++HE H  +  S+PISITRK++   + 
Sbjct: 198 K--IQHDSC--LITNIQLYLGSNFVESRPFWKEIIHELHNEDGNSIPISITRKVECGFDA 253

Query: 269 HKASKRLTGPLKAPEKDNNILELLQVDGNYKITSPHIQFSRGQRSFKILQMTDFHFKCTD 328
           +            P+   N  +LLQ+              + +   KILQ++D H K  +
Sbjct: 254 NHT---------FPKNTINNKDLLQL--------------KQKSDLKILQLSDIHIKGNE 290

Query: 329 NSMSIINEIRTVNFIDRVLALENPDLVVITGDLLDSQNTIDYQTCIMKLVQPMISNKIPY 388
            + +I+ E ++  FI R++ +E PDLVVITGD+LD   ++DYQTCI+ +VQP+I  +IP+
Sbjct: 291 ENSAILGEFQSRIFISRIIDIERPDLVVITGDILDGNKSVDYQTCILNVVQPIIRAQIPF 350

Query: 389 AISLGVSDESNLATPSQVQDYIRNLPYTFNSVASEEGHIAIRVSFXXXXXXXXXXXRGIN 448
            IS G  D S  AT  ++ D++  +PY  N  +   GH+ I  +F              +
Sbjct: 351 VISFGAKDFSKYATQQEITDFVNQIPYCLNKNSDSNGHLTIPYNFSTIPN---------D 401

Query: 449 AKDE----TTPSEALFFVFDSFNPVNDFLLDYSNLI-GKIDYGLAFQYFPLSEYRPHGLF 503
           +KD+     T ++   F+F+S      F  DY +L        LAFQY P+  YR  G+F
Sbjct: 402 SKDDYSNLITQNDLAIFIFNSKTSKRQFFKDYISLYKSPPKLALAFQYLPIPTYRLSGVF 461

Query: 504 PIIGQYNERSTLTVDTSRSKGEVSMTIDG-KNYKSFLDILNLWNIKGVSCGHEHNNDCCL 562
           PIIGQYNER+ L               +G  N  + ++ ++  NIK +SCG +H+NDCCL
Sbjct: 462 PIIGQYNERNLLP--------------EGFDNDDNLINYMHEMNIKALSCGFDHSNDCCL 507

Query: 563 QSINEMWLCYGGSAGIDVARIEGIHPNVRLFNLDDIKDEITSWKRSSNLVDEVYDYQYIY 622
           QSI+++WLCY G+ G+       + P+VRLF +D+I   ITSWKR+ N +DEVYDYQYIY
Sbjct: 508 QSIHDIWLCYSGATGLTAPHSIFMPPSVRLFKVDNIDKSITSWKRNYNKIDEVYDYQYIY 567

Query: 623 ---KGKH 626
              K KH
Sbjct: 568 NQPKQKH 574

>SAKL0G03542g Chr7 complement(292214..293938) [1725 bp, 574 aa] {ON}
           similar to uniprot|Q12212 Saccharomyces cerevisiae
           YOR137C SIA1 Suppressor of eIF5A High-copy suppressor of
           temperature-sensitive tif51A-1
          Length = 574

 Score =  370 bits (951), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 233/610 (38%), Positives = 329/610 (53%), Gaps = 97/610 (15%)

Query: 37  NALINPNTAEYHEGMIDDIQVLRCYHWYRQCGSLYAPRLHPSNTASKVKDKNNVLWSRVS 96
           N     +  +Y  G+IDD++ ++CY WY  C ++Y  + H +           + W RV 
Sbjct: 38  NTFKKGHDVQYQGGLIDDVRFIKCYRWYSHCDTIY-DKQHSNGPL--------IQWKRVH 88

Query: 97  KNITIEALYSLQSGAFYNSYLYVH-PKGFQSNSRNSIKELAIARDSALIPLQVLRDINKM 155
           K +    LY++ SG  Y++YLYVH  K     +  +I +LAIAR+  ++PL VL+D+N  
Sbjct: 89  KKMRDSNLYAINSGMLYSTYLYVHSAKKTTFGTTRAITDLAIAREKTVVPLHVLKDVNLQ 148

Query: 156 VKSSDSSVFHNHVYQREKPTSSWWKLLFGISVDSDDIAVFGEEWVYKGSGIWCKYVLNDD 215
           ++SSD+SVFHNH Y +E    SW   +FG    S  ++V  E+W YK  GIWCKY L  +
Sbjct: 149 IRSSDNSVFHNHEYPQE---FSW--SIFGKG--SPTLSVDDEDWEYKSDGIWCKYSLIQE 201

Query: 216 DSD-PPIISLEIYLGSSFIESRPSWKEVMHEFHRNNIPSLPISITR--KLKTKNNLHKAS 272
            SD   + +L+IYLG  FIESRP WKE +H   R  + +L I+  R  K +  +N+H A 
Sbjct: 202 GSDDTALTNLQIYLGDDFIESRPMWKEAIHGKSRGRLAALSITSERFNKNELVDNVHIA- 260

Query: 273 KRLTGPLKAPEKDNNILELLQVDGNYKITSPHIQFSRGQRSFKILQMTDFHFKCTDNSMS 332
                         N L L                    + FKILQ++D H+    + M 
Sbjct: 261 --------------NTLSL------------------KSQGFKILQLSDLHYS---SGMG 285

Query: 333 IINE------IRTVNFIDRVLALENPDLVVITGDLLDSQNTIDYQTCIMKLVQPMISNKI 386
           + NE       +T NFI  V+  E PDLVVITGD+LD  NT+DY+T ++K VQPM+S++ 
Sbjct: 286 VCNEPPCLADFQTRNFISTVIDREKPDLVVITGDILDGVNTLDYETALLKAVQPMVSSRT 345

Query: 387 PYAISLGVSDESNLATPSQVQDYIRNLPYTFNSVASEEGHIAI-RVSFXXXXXXXXXXXR 445
           PYAI+ G+ D S  AT   + ++I +LP+  NSV ++   I + + SF            
Sbjct: 346 PYAIAFGLQDFSTQATKRDILEFIGSLPFCMNSVNNDSNVINLDKHSFYTTNIALP---- 401

Query: 446 GINAKDETTPSEALFFVFDSFN--PVNDFLLD--YSNLIGKID---YGLAFQYFPLSEYR 498
            I+  +E +    + +V DS +    + FL +   S L+ K     Y  AFQ+ P  EYR
Sbjct: 402 -IHKGEEIS---GMVYVLDSTDVESQDSFLRNAHASALLSKHTKPMYSFAFQHLPTIEYR 457

Query: 499 PHGLFPIIGQYNERSTLTVDTSRSKGEVSMTIDGKNYKSFLDILNLWNIKGVSCGHEHNN 558
           P GLF IIG YNE+  L+    R+K                D L    ++ +SCG+EH N
Sbjct: 458 PTGLFAIIGSYNEKKQLSDVIPRTK--------------LRDTLGELKVQVLSCGYEHGN 503

Query: 559 DCCLQS-----INEMWLCYGGSAGIDVARIEGIHPNVRLFNLDDIKDEITSWKRSSNLVD 613
           DCCL S       E+WLCYGG +G+   +IEG+ PN+RLF +DD K EITSWKRS    +
Sbjct: 504 DCCLHSTGPEYTGELWLCYGGVSGLSGYQIEGMSPNIRLFGIDDEKGEITSWKRSLANPE 563

Query: 614 EVYDYQYIYK 623
           EVYDYQYIYK
Sbjct: 564 EVYDYQYIYK 573

>KLTH0F15026g Chr6 (1230760..1232484) [1725 bp, 574 aa] {ON} similar
           to uniprot|Q12212 Saccharomyces cerevisiae YOR137C SIA1
           Suppressor of eIF5A High-copy suppressor of
           temperature-sensitive tif51A-1
          Length = 574

 Score =  340 bits (873), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 227/616 (36%), Positives = 321/616 (52%), Gaps = 104/616 (16%)

Query: 32  KLHAKNALINPNTAE-YHEGMIDDIQVLRCYHWYRQCGSLYAPRLHPSNTASKVKDKNNV 90
           K H  N    P   E Y  G+IDD++ L+C+ WY+ C  +   R          ++   V
Sbjct: 36  KTHFANIFQPPTKLEGYTGGLIDDVRFLKCFRWYKDCDVILEKR---------GRNGEFV 86

Query: 91  LWSRVSKNITIEALYSLQSGAFYNSYLYVHPKGFQSNSRNSIKELAIARDSALIPLQVLR 150
            W RV K +  E LYS+ SG FY SYLYVHP      +++ + +LAIA+D + IP+QVL+
Sbjct: 87  PWMRVRKELDEEKLYSVDSGLFYRSYLYVHP---CDGNKDCVSDLAIAKDRSSIPMQVLQ 143

Query: 151 DINKMVKSSDSSVFHNHVYQREKPTSSWWKLLFGISVDSDDIAVFGEEWVYKGSGIWCKY 210
           DIN  ++S DSS+FH H + +     ++W  +FG     + +++ GE+W Y+  GIWCKY
Sbjct: 144 DINAKIQSKDSSMFHGHEHHK-----TFWTRIFGGR--RERLSLQGEDWHYRRHGIWCKY 196

Query: 211 -VLNDDDSDPPIISLEIYLGSSFIESRPSWKEVMHEF-HRNNIPSLPISITRKLKTKNNL 268
              N  D    I +L+I+LGS F++ RP WK  +HE  HRN+    PISI+        +
Sbjct: 197 SSSNKIDEGQSITNLQIFLGSGFVDPRPMWKTAIHEMDHRNSESPTPISIS--------I 248

Query: 269 HKASKRLTGPLKAPEKDNNILELLQVDGNYKITSPHIQFSRGQRSFKILQMTDFHF---- 324
            K  K +         +N IL     DG                 FKILQ++D H     
Sbjct: 249 QKYDKSMDSRFVT---ENGILN--ADDGK----------------FKILQVSDLHVSNAI 287

Query: 325 -KCTDNSMSIINEIRTVNFIDRVLALENPDLVVITGDLLDSQNTIDYQTCIMKLVQPMIS 383
            +C   S    NE +T  FI R++ LE PDLVV TGD ++   T DYQT I+K  + +IS
Sbjct: 288 ERC--ESHLCTNEWKTQRFISRIIELETPDLVVFTGDFINGPETTDYQTAILKATECVIS 345

Query: 384 NKIPYAISLGVSDESNLATPSQVQDYIRNLPYTFNSVASEEGHIA--IRVSFXXXXXXXX 441
            KIP+A++ G  D S  A+   + ++I++LPY  N + +++   A  I  +F        
Sbjct: 346 AKIPWAMTWGTLDYSKYASERDIFNFIKSLPYNLNYLHAKQVQDASLITTTFALQ----- 400

Query: 442 XXXRGINAKDETTPSEALFFVFDSFNPVN--DFL-LDYSNLIGKID----YGLAFQYFPL 494
                +   +E      + ++ DS NP N  DFL   Y N     D    Y LAFQ+ P+
Sbjct: 401 -----LKRDNEIF---GVVYILDSTNPENAVDFLKTAYENASKNSDRDTLYSLAFQHAPI 452

Query: 495 SEYRPHGLFPIIGQYNERSTLTVDTSRSKGEVSMTIDGKNYKSFLDILNLWNIKGVSCGH 554
            EYRP G FPIIG YN++S L V       +V +             L+ + I   SCG 
Sbjct: 453 PEYRPSGSFPIIGSYNDKSPLDV------PQVGIR----------KALDDFKIHAFSCGQ 496

Query: 555 EHNNDCCLQSIN-----EMWLCYGGSAGIDVARI--EGIHPNVRLFNLDDIKDEITSWKR 607
           EH NDCCLQS +     ++WLCYGG AG+ V R   E    +VRLF +DD   EIT+WKR
Sbjct: 497 EHGNDCCLQSSDSNSNKDVWLCYGGHAGV-VGRYSPEDSASSVRLFRIDDSLKEITTWKR 555

Query: 608 SSNLVDEVYDYQYIYK 623
           +S   D VYDYQ+++K
Sbjct: 556 NSREPDSVYDYQFLFK 571

>Kwal_55.21268 s55 (759935..761641) [1707 bp, 568 aa] {ON} YOR137C
           (SIA1) - High-copy suppressor of temperature-sensitive
           tif51A-1 [contig 130] FULL
          Length = 568

 Score =  305 bits (780), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 199/598 (33%), Positives = 300/598 (50%), Gaps = 103/598 (17%)

Query: 47  YHEGMIDDIQVLRCYHWYRQCGSLYAPRLHPSNTASKVKDKNNVL-WSRVSKNITIEALY 105
           Y  G IDD++ ++C+ W+  C  ++           +   ++ +L W RV K++  ++LY
Sbjct: 51  YEGGTIDDVKFIKCFRWFGDCNVVF----------ERHSLRDEILPWLRVGKSLNDDSLY 100

Query: 106 SLQSGAFYNSYLYVHPKGFQSNSRNSIKELAIARDSALIPLQVLRDINKMVKSSDSSVFH 165
           ++  G  +++YLYVHP      +++SI +LAIARD + +P+QVL+D+N   K  DSS+FH
Sbjct: 101 AVDRGLLHHTYLYVHP---NDGTQDSISDLAIARDESNVPVQVLQDVNSRAKFKDSSMFH 157

Query: 166 NHVYQREKPTSSWWKLLFGISVDSDDIAVFGEEWVYKGSGIWCKYVLNDDDSDPPIIS-L 224
           +H + +     S W  + G    S  +++ GE+W YKG G+WCKY       D  +I+ +
Sbjct: 158 DHDHHK-----SIWSWIRGSGFHS--LSLRGEDWHYKGHGVWCKYSSKSRLDDEAVITDI 210

Query: 225 EIYLGSSFIESRPSWKEVMHE---FHRNNIPSLPISITRKLKTKNNLHKASKRLTGPLKA 281
           + ++G  F+E RP WK  +HE   F R+   S+  SI    K  +    AS         
Sbjct: 211 QTFIGYGFVEPRPMWKVAIHEMNNFGRDLQQSISFSIQISDKEAHIDPSASN-------- 262

Query: 282 PEKDNNILELLQVDGNYKITSPHIQFSRGQRSFKILQMTDFHF----------KCTDNSM 331
                  ++L   DG                 FKILQ++D H           KCT    
Sbjct: 263 -------IDLQLRDGE----------------FKILQLSDVHVSSDLANCDVEKCT---- 295

Query: 332 SIINEIRTVNFIDRVLALENPDLVVITGDLLDSQNTIDYQTCIMKLVQPMISNKIPYAIS 391
              N  +T  F+ RV+ LE PD+V+ TGD +D  N IDYQT I+K  + +IS +IP+A++
Sbjct: 296 ---NYQKTKMFVSRVIQLERPDMVIFTGDFIDGPNAIDYQTAILKAAETVISAEIPWAVT 352

Query: 392 LGVSDESNLATPSQVQDYIRNLPYTFNSVASEEG-HIAIRVSFXXXXXXXXXXXRG--IN 448
            G SD S  A+  Q+  Y+  LP+  N ++  +G  ++   +F           +   I 
Sbjct: 353 WGSSDYSKYASKRQILQYLETLPFCLNRLSFGKGDKVSGNTTFNSFPLNNGSDSQVGLIY 412

Query: 449 AKDETTPSEALFFVFDSFNPVNDFLLDYSNLIGKIDYGLAFQYFPLSEYRPHGLFPIIGQ 508
             D T+   A  FV  ++  V    ++++N   K  Y LAFQ+ P+ EYRP G FPIIG 
Sbjct: 413 TLDSTSDENAAEFVRSAYKDV----IEHTNR--KPLYSLAFQHSPIPEYRPKGPFPIIGS 466

Query: 509 YNERSTLTVDTSRSKGEVSMTIDGKNYKSFLDILNLWNIKGVSCGHEHNNDCCLQSIN-- 566
           YN++  L V                      + L    I+ +SC  EH NDCCLQS    
Sbjct: 467 YNDKDPLDVPQ----------------LGIREALEDAEIQAMSCSQEHGNDCCLQSSGPD 510

Query: 567 ---EMWLCYGGSAGIDVARIEGIHPNVRLFNLDDIKDEITSWKRSSNLVDEVYDYQYI 621
              ++WLCYGG  G+    +     NVRLF +DD   EIT+WKR+S   D VYDYQY+
Sbjct: 511 CKKDVWLCYGGHTGVAGHYVSEKMANVRLFRIDDNAKEITTWKRNSLSPDAVYDYQYL 568

>KLLA0E03147g Chr5 complement(290622..292358) [1737 bp, 578 aa] {ON}
           weakly similar to uniprot|Q12212 Saccharomyces
           cerevisiae YOR137C SIA1 Suppressor of eIF5A High-copy
           suppressor of temperature-sensitive tif51A-1
          Length = 578

 Score =  221 bits (564), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 186/626 (29%), Positives = 282/626 (45%), Gaps = 124/626 (19%)

Query: 34  HAKNALINPNTAEYHEGMID------DIQVLRCYHWYRQCGSLYAPRLHPSNTASKVKDK 87
           H KN L+     +    + D      D+++ +CY W+  C +++   L            
Sbjct: 33  HLKNWLVQAPDLKLSGSLQDTGIKVRDVRISKCYSWFSNCDAIWDYSLQ----------D 82

Query: 88  NNVLWSRVSKNITIEALYSLQSGAFYNSYLYVHPKGFQSNSRNS-IKELAIARDSALIPL 146
           + V W R+      +   S+  G  + SY+Y  P     N R S + +LA++R+   +PL
Sbjct: 83  DLVTWYRIDMGKMQDT--SIGQGFGWTSYVYWQP--LYPNERGSAVVDLALSRNG--LPL 136

Query: 147 QVLRDINKMVKSSDSSVFH------NHVYQREKPTSSW-----WKLLFGISVDSDDIAVF 195
            +  +    +K++D   +H      N  Y ++  ++ +     W   FG  +        
Sbjct: 137 GLANERYNKIKNNDIDGYHVHSNTDNEFYVKDDSSNRFNPDMKWSAKFGNHL-------- 188

Query: 196 GEEWVYKGSGIWCKYVLNDDDSDPPIISLEIYLGSSFIESRPSWKEVMHEFHRNNIPSLP 255
            E+W ++G GIWCKY    +     I  ++ ++G  FIESRP WKE++H  HR    S P
Sbjct: 189 -EDWFWRGDGIWCKYGRRSNG----IKEIKAFIGEDFIESRPMWKEMVHCLHREGY-SKP 242

Query: 256 ISITRKLKTKNNLHKASKRLTGPLKAPEKDNNILELLQVDGNYKITSPHIQFSRGQRSFK 315
           ISI+ +            RL       EKD +           +I+ P +   R    FK
Sbjct: 243 ISISFQ----------KSRLDDFTYGKEKDLS-----------QISEPSLVMKRA--DFK 279

Query: 316 ILQMTDFHFK---CTDNSMSIINEI-----RTVNFIDRVLALENPDLVVITGDLL-DSQN 366
           ILQ++D HF     +D+     + I       V FI  V+  E PDL VITG +  D   
Sbjct: 280 ILQISDLHFGRHIVSDSRKEKPDSIFRYDWPNVQFIHSVIRNERPDLAVITGHIFKDFNK 339

Query: 367 TIDYQTCIMKLVQPMISNKIPYAISLGVSDESNLATPSQVQ--DYIRNLPYTFNSVASEE 424
            +DY++ I+K+V P+ISN IP+  + G   E  + T  +V   ++I++LP+  N      
Sbjct: 340 NLDYESQILKMVSPIISNGIPFLFTWG---EPQVTTEFKVNILNFIKSLPFCLN------ 390

Query: 425 GHIAIRVSFXXXXXXXXXXXRGINAKDETTPSE-ALFFVFDSFNPVNDFLLDYSNLIGKI 483
                   F             + AK   +  +    F FDS    +   LD      + 
Sbjct: 391 -------KFDLKNSTYLMLPLLLPAKTPGSQKQIGTIFAFDSNVTESYNFLDKFPRSPQS 443

Query: 484 DYGLAFQYFPLSEYRPHGLFPIIGQYNERSTLTVDTSRSKGEVSMTIDGKNYKSFLDILN 543
            Y LAFQ+ PL EYRP G F +IG Y ++ +L          +  T      K+F ++L 
Sbjct: 444 VYNLAFQHLPLHEYRPQGSFALIGNYEQKGSLDY--------IPHT------KAFRNLLG 489

Query: 544 LWNIKGVSCGHEHNNDCCLQS-------INEMWLCYGGSAGIDVARIEGIHPNVRLFNLD 596
             +IK +SCGHEH NDCC+ S        N MWLCYGG  G D A        VR+F +D
Sbjct: 490 EKDIKAISCGHEHGNDCCVLSDGKQQNLKNNMWLCYGGVTGYDQA----YESKVRIFKID 545

Query: 597 DIKDEITSWKRSSNLVDEVYDYQYIY 622
             K++ITSWKRS     +V DYQYI+
Sbjct: 546 TEKNDITSWKRSIKDTSKVSDYQYIW 571

>Ecym_2455 Chr2 complement(885426..887144) [1719 bp, 572 aa] {ON}
           similar to Ashbya gossypii ABL009W
          Length = 572

 Score =  125 bits (313), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 99/341 (29%), Positives = 156/341 (45%), Gaps = 40/341 (11%)

Query: 311 QRSFKILQMTDFHF-----KCTDNSMSIIN---EIRTVNFIDRVLALENPDLVVITGDLL 362
           + +FK++Q+ D HF     +C D   +  N   + +T+NF++ VL +ENPDL+V TGD +
Sbjct: 240 EGNFKVVQLADLHFGVGKGECKDEFPTTENCEADPKTLNFVETVLEIENPDLIVFTGDQI 299

Query: 363 DSQNTIDYQTCIMKLVQPMISNKIPYAISLGVSDESNLATPSQVQDYIRNLPYTFNSVAS 422
           + +   D +T ++K + P I   IPYA+  G  D+S      ++  Y+  LPY+   +  
Sbjct: 300 EGEWEQDSETALLKALGPAIRRGIPYAVIWGNHDDSGSMDRQELSKYVYQLPYSLFKINP 359

Query: 423 EEGHIAIRVSFXXXXXXXXXXXR-GINA-------KDETTPSEALFFVFDSFNPVN-DFL 473
            +G   +R  F           R G  A         + +P+  ++F +D       ++L
Sbjct: 360 RDG---LRNDFGFGNYVLQVDDRDGSPAITFYFLDSHKRSPNPKVYFGYDWIKEEQLNYL 416

Query: 474 LDY--SNLIGK-IDYGLAFQYFPLSEYRPHGLFPIIGQYNERSTLTVDTSRSKGEVSMTI 530
            +Y   NL  K  D  +AF + PL EY          Q NE+           G     I
Sbjct: 417 EEYYTKNLADKHTDLSMAFIHIPLPEYLNFQSVRNDEQQNEKI----------GSFKEGI 466

Query: 531 DGKNYKS-FLDILNLWNIKGVSCGHEHNNDCCLQS-----INEMWLCYGGSAG-IDVARI 583
               Y S   D+L    +  VS GH+H ND CL++      + +WLCYGG+ G    A  
Sbjct: 467 TAPRYNSGTADVLVKLKVSAVSVGHDHCNDYCLETDFLSHSDSLWLCYGGAVGERGYAGY 526

Query: 584 EGIHPNVRLFNLDDIKDEITSWKRSSNLVDEVYDYQYIYKG 624
            G    +R+F  +  K  I +WKR     D  +D+Q I+ G
Sbjct: 527 GGTERRIRIFEFNAKKKVINTWKRLHGSPDRKFDFQIIHDG 567

>NCAS0J01220 Chr10 complement(212622..214373) [1752 bp, 583 aa] {ON}
           Anc_4.200
          Length = 583

 Score = 97.4 bits (241), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 97/359 (27%), Positives = 158/359 (44%), Gaps = 84/359 (23%)

Query: 314 FKILQMTDFHF-----KCTDN---SMSIINEIRTVNFIDRVLALENPDLVVITGDLLDSQ 365
           FKI+Q+ D H      KC D          + +T+ F+ +VL LE+P LVV TGD +   
Sbjct: 249 FKIVQLADLHMGVGINKCEDEFPKHEHCEADPKTIEFVKKVLELEDPQLVVFTGDQIMGD 308

Query: 366 NTI-DYQTCIMKLVQPMISNKIPYAISLGVSDESNLATPSQVQDYIRNLPYTFNSVASEE 424
            +I D +T ++K + P++  KIP+A+  G  D+    T  ++ +   NLPY+   + +++
Sbjct: 309 RSIQDSETTLLKAIAPVVKRKIPWAMVWGNHDDEGSLTRWELSELATNLPYSLFQIGTKD 368

Query: 425 --------GHIAIRVSFXXXXXXXXXXXRGINAKDETTPSEALFFVFDS-------FNPV 469
                   G+  I+                 N  D+     A F+  DS        +P 
Sbjct: 369 TKNNLFGVGNYYIQAQ--------------ANDSDDLI---ATFYFLDSHKYSKTKISPG 411

Query: 470 NDFLLD---------YSNLIG-------KIDYGLAFQYFPLSEY-------RPHGLFPII 506
            D++ +         Y+N +        K+   +AF + PL EY       RP+    I+
Sbjct: 412 YDWIKESQWDYFEDLYNNKLKLSIQSSHKLHVSMAFFHIPLPEYLNLDSKRRPNEQNQIV 471

Query: 507 GQYNERSTLTVDTSRSKGEVSMTIDGKNYKSFLDILNLWNIKGVSCGHEHNNDCCLQ--- 563
           G + E   +T     S G              L++L    +   SCGH+H ND CLQ   
Sbjct: 472 GTFKE--GVTAPRYNSGG--------------LNVLQKLGVSVTSCGHDHCNDYCLQDDS 515

Query: 564 SINEMWLCYGGSAGIDVARIEG-IHPNVRLFNLDDIKDEITSWKRSSNLVDEVYDYQYI 621
           + + +WLCYGG  G       G     +R++ +D  K  I++WKR ++   E++DYQ I
Sbjct: 516 TPSFIWLCYGGGGGEGGYAGYGGTERRLRIYEIDSNKGTISTWKRLNSSPKEIFDYQII 574

>YLR361C Chr12 complement(847388..849124) [1737 bp, 578 aa] {ON}
           DCR2Phosphoesterase involved in downregulation of the
           unfolded protein response, at least in part via
           dephosphorylation of Ire1p; dosage-dependent positive
           regulator of the G1/S phase transition through control
           of the timing of START
          Length = 578

 Score = 96.7 bits (239), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 91/351 (25%), Positives = 156/351 (44%), Gaps = 60/351 (17%)

Query: 311 QRSFKILQMTDFHF-----KCTDN---SMSIINEIRTVNFIDRVLALENPDLVVITGDLL 362
           +  FKI+Q+ D H      +C D      +   + +T  F+ +VL +E P LVV TGD +
Sbjct: 245 EGKFKIVQLADLHLGVGESECIDEYPKHEACKADPKTETFVQQVLDIEKPQLVVFTGDQI 304

Query: 363 DSQNTI-DYQTCIMKLVQPMISNKIPYAISLGVSDESNLATPSQVQDYIRNLPYTFNSVA 421
               +I D +T ++K V P+I+ KIP+A+  G  D+    T  Q+ +    LPY+    +
Sbjct: 305 MGDRSIQDSETVLLKAVAPVIARKIPWAMVWGNHDDEGSLTRWQLSEIASVLPYSLFKFS 364

Query: 422 SEEGHIAIRVSFXXXXXXXXXXXRGINAKDETTPSEALFF-----------VFDSFNPVN 470
             + H                  +  +  D   P   L+F           ++  ++ + 
Sbjct: 365 PHDTH-------DNTFGVGNYIYQIFSNNDTEVPVGTLYFLDSHKYSTVGKIYPGYDWIK 417

Query: 471 D----FLLDYSNLIGKIDYGLAFQYF--PLSEY-------RPHGLFPIIGQYNERSTLTV 517
           +    ++ DY ++  K   GL+  +F  PL EY        P    P+IG Y E   +T 
Sbjct: 418 ESQWKYIEDYHDVNLKFKTGLSMAFFHIPLPEYLNIESKTHPGEKNPLIGMYKE--GVTA 475

Query: 518 DTSRSKGEVSMTIDGKNYKSFLDILNLWNIKGVSCGHEHNNDCCLQ---SINEMWLCYGG 574
               S+G              +  L+  ++  VSCGH+H ND CL+   + N++WLCYGG
Sbjct: 476 PKYNSEG--------------ITTLDRLSVDVVSCGHDHCNDYCLRDDSTPNKIWLCYGG 521

Query: 575 SAGIDVARIEG-IHPNVRLFNLDDIKDEITSWKRSSNLVDEVYDYQYIYKG 624
             G       G     +R++ ++  ++ I +WKR +    E++D+Q +  G
Sbjct: 522 GGGEGGYAGYGGTERRIRIYEINVNENNIHTWKRLNGSPKEIFDFQSMLDG 572

>KNAG0B05860 Chr2 complement(1152991..1154748) [1758 bp, 585 aa]
           {ON} Anc_4.200 YLR361C
          Length = 585

 Score = 94.4 bits (233), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 85/365 (23%), Positives = 148/365 (40%), Gaps = 76/365 (20%)

Query: 314 FKILQMTDFHF-----KCTD-------NSMSIINEIRTVNFIDRVLALENPDLVVITGD- 360
           FK++Q+ D H      KC D       +    + + +T+ F++ VL  E+P LVV TGD 
Sbjct: 238 FKVVQLADLHMGVGPGKCIDEFPEHSKSEGPCLADPKTLTFVESVLDTESPQLVVFTGDQ 297

Query: 361 LLDSQNTIDYQTCIMKLVQPMISNKIPYAISLGVSDESNLATPSQVQDYIRNLPYTFNSV 420
           ++  ++  D +T ++K + P++   IP+ +  G  D+    +  ++  +   LP +   +
Sbjct: 298 IMGDKSRYDSETTLLKALAPVLERHIPWCLVWGNHDDEGSLSRWELSRFAETLPLSLFKI 357

Query: 421 ASEE-GHIAIRVSFXXXXXXXXXXXRGINAKDETTPSEALFFV-----------FDSFNP 468
           +  + G  +  V             +  +   E  P+  L+F+           +  ++ 
Sbjct: 358 SPRDTGDSSFGVG--------NYFHQVFSDNGEEKPAITLYFLDSHKYSRTGKLYPGYDW 409

Query: 469 VNDFLLDY----------------SNLIGKIDYGLAFQYFPLSEY-------RPHGLFPI 505
           + +   DY                +    +    +AF + PL EY        P    P+
Sbjct: 410 IKEAQWDYVKQLYDKAIAPFADAATETSQERQLSMAFFHIPLPEYGDFQSQSNPAEQNPM 469

Query: 506 IGQYNERSTLTVDTSRSKGEVSMTIDGKNYKSFLDILNLWNIKGVSCGHEHNNDCCLQ-- 563
           +GQ+ E   LT     S G              L  L    ++  SCGH+H ND CLQ  
Sbjct: 470 LGQHKE--GLTAPKYNSGG--------------LTTLQHMRVQATSCGHDHCNDYCLQDD 513

Query: 564 -SINEMWLCYGGS-AGIDVARIEGIHPNVRLFNLDDIKDEITSWKRSSNLVDEVYDYQYI 621
            + +++WLC+GGS      A   G    +R FN D     I +WKR +      +DYQ +
Sbjct: 514 STGDKIWLCFGGSAGEGAYAGYGGTERRIRTFNFDTTSGRIETWKRLNGSPQNAFDYQVL 573

Query: 622 YKGKH 626
               H
Sbjct: 574 VDLGH 578

>SAKL0B05038g Chr2 complement(434061..435833) [1773 bp, 590 aa] {ON}
           similar to uniprot|Q05924 Saccharomyces cerevisiae
           YLR361C DCR2 Protein involved in cell cycle regulation
          Length = 590

 Score = 94.4 bits (233), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 101/361 (27%), Positives = 157/361 (43%), Gaps = 76/361 (21%)

Query: 308 SRGQRSFKILQMTDFHF-----KCTDN---SMSIINEIRTVNFIDRVLALENPDLVVITG 359
           SRG+  FKI+Q+ D HF     KC D      S   + +T+ FI+RVL  E P LVV TG
Sbjct: 250 SRGK--FKIVQLADLHFSVGKGKCRDEFPMHDSCEADPKTLEFINRVLDREKPHLVVFTG 307

Query: 360 D-LLDSQNTIDYQTCIMKLVQPMISNKIPYAISLGVSDESNLATPSQVQDYIRNLPYTFN 418
           D ++ ++   D +T ++K+++P+I+ KIP+A+  G  D+    +  ++   +  LPY+  
Sbjct: 308 DQIMGNECKQDSETALLKVLEPVITRKIPFAMVWGNHDDEGSLSRWEMSQIVAKLPYSI- 366

Query: 419 SVASEEGHIAIRVSFXXXXXXXXXXXRGINA--KDETTPSEALFF-----------VFDS 465
                      R+S              I      E  P+ +L+F           +F  
Sbjct: 367 ----------FRLSQHDTKDSKFGLGNYIQQIFTSENQPAISLYFLDSHKYSSNPKIFPG 416

Query: 466 FNPVNDFLLDY------SNL------IGKIDYGLAFQYFPLSEY-------RPHGLFPII 506
           ++ + +   DY      +NL       G     +AF + PL EY        P     +I
Sbjct: 417 YDWIKEEQWDYMRNYYETNLKKANEAYGGNHLSMAFFHIPLPEYLHFQSQQEPDKQNLVI 476

Query: 507 GQYNERSTLTVDTSRSKGEVSMTIDGKNYKSFLDILNLWNIKGVSCGHEHNNDCCL--QS 564
           G Y E   +T     S G              L  L+   +  VS GH+H ND CL   S
Sbjct: 477 GNYKE--GITAPKYNSGG--------------LKALHDLKVSAVSVGHDHCNDYCLLEDS 520

Query: 565 IN---EMWLC-YGGSAGIDVARIEGIHPNVRLFNLDDIKDEITSWKRSSNLVDEVYDYQY 620
           I+   ++WLC  GG      A   G    +R+F +D   + I +WKR +   DE++D+Q 
Sbjct: 521 ISKDEKIWLCYGGGGGEGGYAGYGGTERRIRIFEIDTQGNSIYTWKRLNGTPDEIFDHQT 580

Query: 621 I 621
           I
Sbjct: 581 I 581

>TDEL0E01730 Chr5 (333362..335086) [1725 bp, 574 aa] {ON} Anc_4.200
           YLR361C
          Length = 574

 Score = 94.4 bits (233), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 99/352 (28%), Positives = 151/352 (42%), Gaps = 63/352 (17%)

Query: 314 FKILQMTDFHF-----KCTDN---SMSIINEIRTVNFIDRVLALENPDLVVITGDLLDSQ 365
           FKILQ+ D HF     +C D      +   + +T+ FI+RVL +E+PDLVV TGD +   
Sbjct: 239 FKILQLADLHFSAGKSECRDEFPKHPTCEADSKTLRFIERVLDIESPDLVVYTGDQIMGD 298

Query: 366 NTI-DYQTCIMKLVQPMISNKIPYAISLGVSDESNLATPSQVQDYIRNLPYTFNSVA--- 421
            +I D +T ++K V P I  KIP+A+  G  D+        +  Y+ +LPY+   ++   
Sbjct: 299 RSIRDSETSLLKAVAPAIRRKIPWAMVWGNHDDEGSLGRWALSKYVESLPYSIFQISPKD 358

Query: 422 SEEGHIAIRVSFXXXXXXXXXXXRGINAKDETT--PSEALFF-----------VFDSFNP 468
           +++    +   F                 D TT  P+  L+F           V+  ++ 
Sbjct: 359 TKDNSFGVGNYFHQII-------------DPTTGKPAATLYFLDSHKYSTTGKVYPGYDW 405

Query: 469 VNDFLLDYSNLI------------GKIDYGLAFQYFPLSEYRPHGLFPIIGQYNERSTLT 516
           + +   DY   +             +    +AF + PL EY     F    + N R+ L 
Sbjct: 406 IKEAQWDYLRELYDEKISPSLAKPSQKHLSMAFFHIPLPEYLD---FDSQKEANNRNPL- 461

Query: 517 VDTSRSKGEVSMTIDGKNYKSFLDILNLWNIKGVSCGHEHNNDCCL---QSINEMWLCYG 573
                SK  V       N K  LD L    +   SCGH+H ND CL    +  + WLCYG
Sbjct: 462 --VGNSKEAVMAPKYNSNGKKTLDHL---GVSVTSCGHDHCNDYCLLDDSTSKKTWLCYG 516

Query: 574 GSAGIDVARIEGIHP-NVRLFNLDDIKDEITSWKRSSNLVDEVYDYQYIYKG 624
           G  G       G     VR++ LD    +I +WKR +   +  +DYQ +  G
Sbjct: 517 GGTGEGGYGGYGGTERRVRIYLLDGKNGDIHTWKRLNGNPNGYFDYQLMVSG 568

>Smik_12.448 Chr12 complement(786446..788188) [1743 bp, 580 aa] {ON}
           YLR361C (REAL)
          Length = 580

 Score = 92.8 bits (229), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 92/359 (25%), Positives = 156/359 (43%), Gaps = 66/359 (18%)

Query: 301 TSPHIQFSRGQRSFKILQMTDFHF-----KCTDN---SMSIINEIRTVNFIDRVLALENP 352
           T P       +  FKI+Q+ D H      +C D      +   + +T  FI++VL  E P
Sbjct: 237 TGPQRLQVTNEGKFKIVQLADLHLGVGESECLDEFPKHEACKADPKTKIFIEQVLDNEKP 296

Query: 353 DLVVITGDLLDSQNTI-DYQTCIMKLVQPMISNKIPYAISLGVSDESNLATPSQVQDYIR 411
            LVV +GD +    +I D +T ++K V P+I+ KIP+A+  G  D+    T  Q+ +   
Sbjct: 297 QLVVFSGDQIMGDRSIQDSETVLLKAVAPVIARKIPWAMVWGNHDDEGSLTRWQLSELAS 356

Query: 412 NLPYT---FNSVASEEGHIAIRVSFXXXXXXXXXXXRGINAKDETTPSEALFF------- 461
            LPY+   F+   +++    +               +  + K    P   L+F       
Sbjct: 357 ELPYSLFKFSPYDTQDNSFGV----------GNYIWQVFSNKSTELPVSTLYFLDSHKYS 406

Query: 462 ----VFDSFNPVND----FLLDY--SNLIGKIDYGLAFQYFPLSEY-------RPHGLFP 504
               ++  ++ + +    ++ DY   NL  K    +AF + PL EY        P    P
Sbjct: 407 TVGKIYPGYDWIKESQWKYIEDYYHENLKLKTGPSMAFFHIPLPEYLNVESKTHPGERNP 466

Query: 505 IIGQYNERSTLTVDTSRSKGEVSMTIDGKNYKSFLDILNLWNIKGVSCGHEHNNDCCLQ- 563
           ++G Y E   +T     S+G              L+ L+   +  +SCGH+H ND CL+ 
Sbjct: 467 LVGTYKE--GVTAPKYNSEG--------------LNTLDKLGVDVISCGHDHCNDYCLRD 510

Query: 564 --SINEMWLC-YGGSAGIDVARIEGIHPNVRLFNLDDIKDEITSWKRSSNLVDEVYDYQ 619
             + N +WLC  GG      A   G    +R++ ++  ++ I +WKR +    E++DYQ
Sbjct: 511 DSTPNRLWLCYGGGGGEGGYAGYGGTERRIRIYEINVGENNIHTWKRLNGSPREIFDYQ 569

>Skud_12.445 Chr12 complement(787532..789277) [1746 bp, 581 aa] {ON}
           YLR361C (REAL)
          Length = 581

 Score = 92.0 bits (227), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 95/358 (26%), Positives = 154/358 (43%), Gaps = 64/358 (17%)

Query: 301 TSPHIQFSRGQRSFKILQMTDFHF-----KCTDN---SMSIINEIRTVNFIDRVLALENP 352
           T P       +  FKI+Q+ D H      +C D          + +T  FI +VL +E P
Sbjct: 238 TEPQRLQETNEGKFKIVQLADLHLGVGESECVDEFPKHEVCKADPKTKTFIQQVLDIEKP 297

Query: 353 DLVVITGDLLDSQNTI-DYQTCIMKLVQPMISNKIPYAISLGVSDESNLATPSQVQDYIR 411
            +VV TGD +    +I D +T ++K V P+I+ KIP+A+  G  D+    T  Q+     
Sbjct: 298 QMVVFTGDQIMGDRSIQDSETVLLKAVAPVIARKIPWAMVWGNHDDEGSLTRWQLSQLAS 357

Query: 412 NLPYT-FNSVASEEGHIAIRVSFXXXXXXXXXXXRGINAKDET-TPSEALFF-------- 461
            LPY+ F S   +       V               + +KD+T  P   L+F        
Sbjct: 358 ALPYSLFKSNIHDTQDNTFGVG---------NYVHQVFSKDDTEAPVSTLYFLDSHKYST 408

Query: 462 ---VFDSFNPVND----FLLDYSN--LIGKIDYGLAFQYFPLSEY-----RPHG--LFPI 505
              ++  ++ + +    ++ +Y +  L  K    +AF + PL EY     + H     P+
Sbjct: 409 AGKIYPGYDWIKESQWKYIEEYHDKVLKSKTKLSMAFFHIPLPEYLNTASKTHAGEKNPL 468

Query: 506 IGQYNERSTLTVDTSRSKGEVSMTIDGKNYKSFLDILNLWNIKGVSCGHEHNNDCCLQ-- 563
           IG Y E   +T     S+G              +  L+   +  +SCGH+H ND CL+  
Sbjct: 469 IGTYKE--GVTAPKYNSEG--------------IATLDRLGVDVISCGHDHCNDYCLRDD 512

Query: 564 -SINEMWLC-YGGSAGIDVARIEGIHPNVRLFNLDDIKDEITSWKRSSNLVDEVYDYQ 619
            + N  WLC  GG      A   G    +R++ +D  +D I +WKR +   + ++DYQ
Sbjct: 513 STPNRPWLCYGGGGGEGGYAGYGGTERRIRIYEIDISEDNIHTWKRLNGSPENLFDYQ 570

>KLLA0B13134g Chr2 (1149114..1150811) [1698 bp, 565 aa] {ON} similar
           to uniprot|Q05924 Saccharomyces cerevisiae YLR361C DCR2
           Protein involved in cell cycle regulation
          Length = 565

 Score = 91.7 bits (226), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 90/354 (25%), Positives = 151/354 (42%), Gaps = 66/354 (18%)

Query: 307 FSRGQRSFKILQMTDFHFK-----CTD---NSMSIINEIRTVNFIDRVLALENPDLVVIT 358
           F   Q  FKI+Q+ D HF      C D      +   + +T+ FID+VL +E P +VV T
Sbjct: 226 FVNDQHKFKIVQLADLHFSVGKGVCRDEFPQHETCEADPKTLQFIDQVLDIEKPQMVVFT 285

Query: 359 GD-LLDSQNTIDYQTCIMKLVQPMISNKIPYAISLGVSDESNLATPSQVQDYIRNLPYTF 417
           GD ++  +   D +T ++K++ P+IS KIP+A+  G  D+       Q+ ++   LPY+ 
Sbjct: 286 GDQIMGDECKQDSETALLKVLAPVISRKIPWAMVWGNHDDEGSLNRWQLSEFASKLPYSL 345

Query: 418 NSVASEEGHIAIRVSFXXXXXXXXXXXRGINAKDETTPSEALFFV----------FDSFN 467
             +   +                    R +   D TT + AL+F+          F  ++
Sbjct: 346 FEIGPRDS--------KDNQFGLGNYVREVKGGDGTT-NIALYFLDSHKYSKSKAFPGYD 396

Query: 468 PVN----DFLLDYSNLIGKIDYG--------LAFQYFPLSEYR----PHGLFPIIGQYNE 511
            V     +++ +Y      I           +AF + PL EYR      G   ++G Y E
Sbjct: 397 WVKEEQWEYMEEYLESHDSIKQAKHSGDLISMAFFHIPLPEYRNFPQESGSNRVVGTYKE 456

Query: 512 RSTLTVDTSRSKGEVSMTIDGKNYKSFLDILNLWNIKGVSCGHEHNNDCCL-----QSIN 566
              +T     S+G              +  L+   +   S GH+H ND CL        +
Sbjct: 457 --GITAPRYNSEG--------------VKTLHKLGVSVTSVGHDHCNDYCLLDDFNDGED 500

Query: 567 EMWLC-YGGSAGIDVARIEGIHPNVRLFNLDDIKDEITSWKRSSNLVDEVYDYQ 619
           ++WLC  G +     A   G    +R++ +D +K +I SWKR +   +  +D+Q
Sbjct: 501 KIWLCYGGAAGEGGYAGYGGTERRIRVYEIDALKKDIYSWKRLNGSPENTFDHQ 554

>ZYRO0B07898g Chr2 (616796..618547) [1752 bp, 583 aa] {ON} similar
           to uniprot|Q05924 Saccharomyces cerevisiae YLR361C DCR2
           Protein involved in cell cycle regulation
          Length = 583

 Score = 90.5 bits (223), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 84/356 (23%), Positives = 147/356 (41%), Gaps = 68/356 (19%)

Query: 313 SFKILQMTDFHF-----KCTDNSMS---IINEIRTVNFIDRVLALENPDLVVITGD-LLD 363
           ++KI+Q+ D HF     +C D   +      + +T  F++ VL +E PD+V+ TGD ++ 
Sbjct: 246 AYKIVQLADLHFGVGKGECLDEFPAHDHCEADPKTTKFVEEVLDIEQPDMVIFTGDQIMG 305

Query: 364 SQNTIDYQTCIMKLVQPMISNKIPYAISLGVSDESNLATPSQVQDYIRNLPYTFNSVASE 423
           S++  D +T ++K + P+IS  IP+A+  G  D+       ++  ++ +LP +   V  +
Sbjct: 306 SRSKQDSETALLKTLAPVISKGIPWAMVWGNHDDEGTLNRWELSKFVNDLPLSLFMVGPK 365

Query: 424 EGHIAIRVSFXXXXXXXXXXXRGINAKDETTPSEALFF-----------VFDSFNPVNDF 472
           +                      +   +   P    +F           +F  ++ + + 
Sbjct: 366 DT--------ADNTFGVGNYFHQVMDFENRQPVLTFYFLDSHKYSTTGKIFPGYDWIKED 417

Query: 473 LLDYSNLI------------GKIDYGLAFQYFPLSEY-------RPHGLFPIIGQYNERS 513
             DY   I             K    +AF + P  EY       RP    PIIG   E  
Sbjct: 418 QWDYFKRIYDEKLYQHIRNTQKPHLSMAFFHIPTPEYLHEASRERPGESNPIIGNPMEGV 477

Query: 514 TLTVDTSRSKGEVSMTIDGKNYKSFLDILNLWNIKGVSCGHEHNNDCCL---QSINEMWL 570
           T     S++   ++                  N++  SCGH+H+ND CL    S  ++W 
Sbjct: 478 TAPRYDSKAAAALAHM----------------NVQAASCGHDHSNDYCLLDDSSPQKIWF 521

Query: 571 CYGGSAGIDVA--RIEGIHPNVRLFNLDDIKDEITSWKRSSNLVDEVYDYQYIYKG 624
           CYGG+ G        +G    VR+++ +     I +WKR ++     +DYQ I  G
Sbjct: 522 CYGGAVGEGGYGDHNDGYERRVRIYHFETKDGNIYTWKRLNSSPINYFDYQLIASG 577

>TPHA0F01100 Chr6 complement(249205..250881) [1677 bp, 558 aa] {ON}
           Anc_4.200 YLR361C
          Length = 558

 Score = 88.2 bits (217), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 95/341 (27%), Positives = 149/341 (43%), Gaps = 45/341 (13%)

Query: 314 FKILQMTDFHFKCTDNSM--------SIINEIRTVNFIDRVLALENPDLVVITGD-LLDS 364
           +KI+Q+ D HF  TD               + +T  FID+VL LE PDLV+ TGD ++  
Sbjct: 229 YKIVQLADMHFSITDGECHDEFPPTDDCKADRKTQVFIDKVLDLEQPDLVIFTGDQIMGD 288

Query: 365 QNTIDYQTCIMKLVQPMISNKIPYAISLGVSDESNLATPSQVQDYIRNLPYTFNSVASEE 424
           Q   D ++ ++K+V P+I+ KI +A+  G  D+       ++     +LPY+   + +  
Sbjct: 289 QCKKDSKSALLKVVGPIIARKIKWAMVWGNHDDEGSLDRFELSQLAASLPYSTFRINA-- 346

Query: 425 GHIAIRVSFXXXXXXXXXXXRGINAKDETTPSEALFFVFDSFN--------PVNDFLLDY 476
           G   +  +F              N  D   P  +L F+ DS          P  D++   
Sbjct: 347 GIDTLDTTFGIGNYVQKIYKEEKNKPDSYIPIGSLIFM-DSHKYSKSPKSFPGYDWIKPS 405

Query: 477 S-NLIGKIDYGL------AFQYFPLSEYRPHGLFPIIGQYNERSTLTVDTSRSKGEVSMT 529
             N IGK  YGL      AF + PL EY            N +S  T   ++  G     
Sbjct: 406 QYNYIGK-HYGLKTPLNMAFFHIPLPEY-----------LNIKSESTGKENKIVGSGREG 453

Query: 530 IDGKNYKS-FLDILNL-WNIKGVSCGHEHNNDCCLQSIN---EMWLC-YGGSAGIDVARI 583
           +    Y S  L+ L    N++ +S GH+H ND CL + +   + WLC  GG+     +  
Sbjct: 454 VTAPKYNSGTLEFLKKELNVQLISVGHDHCNDYCLSNDDYGSKSWLCYGGGAGEGGYSGY 513

Query: 584 EGIHPNVRLFNLDDIKDEITSWKRSSNLVDEVYDYQYIYKG 624
            G    +R+F +D  K  I +WKR      + +D+Q +  G
Sbjct: 514 GGTERRIRVFEIDFDKLSIETWKRKQTNSQDTFDHQELVSG 554

>Suva_10.462 Chr10 complement(807033..808778) [1746 bp, 581 aa] {ON}
           YLR361C (REAL)
          Length = 581

 Score = 87.0 bits (214), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 87/343 (25%), Positives = 143/343 (41%), Gaps = 60/343 (17%)

Query: 314 FKILQMTDFHF-----KCTDN---SMSIINEIRTVNFIDRVLALENPDLVVITGDLLDSQ 365
           FKI+Q+ D H      +C D      +   + +T  F+ +VL +E P LVV TGD +   
Sbjct: 251 FKIVQLADLHLGVGESECVDEFPKHETCKADPKTEAFVQQVLDIEAPQLVVFTGDQIMGD 310

Query: 366 NTI-DYQTCIMKLVQPMISNKIPYAISLGVSDESNLATPSQVQDYIRNLPYTFNSVASEE 424
            +I D +T ++K V P+IS  IP+A+  G  D+    T  Q+ +    LPY+        
Sbjct: 311 RSIQDSETALLKAVAPVISRGIPWAMVWGNHDDEGSLTRWQLSELASTLPYSLF------ 364

Query: 425 GHIAIRVSFXXXXXXXXXXXRGINAKDETTPSEALFF-----------VFDSFNPVNDFL 473
               I  +            +  +  D   P   L+F           ++  ++ + +  
Sbjct: 365 -QFGIYDTKDNTFGVGNYVHQVFSKNDTEMPVSTLYFLDSHKYSTVGKIYPGYDWIKESQ 423

Query: 474 LDY------SNLIGKIDYGLAFQYFPLSEY-------RPHGLFPIIGQYNERSTLTVDTS 520
            +Y        L  K +  +AF + PL EY        P     ++G Y E   +T    
Sbjct: 424 WEYMKKYYDETLEFKTELSMAFFHIPLPEYLNTESNTHPGEKNALVGTYKE--GVTAPKY 481

Query: 521 RSKGEVSMTIDGKNYKSFLDILNLWNIKGVSCGHEHNNDCCLQ---SINEMWLC-YGGSA 576
            S+G  ++   G              +  VSCGH+H ND CLQ   + + +WLC  GG  
Sbjct: 482 NSEGMATLEKLG--------------VDVVSCGHDHCNDYCLQDDSTSSLIWLCYGGGGG 527

Query: 577 GIDVARIEGIHPNVRLFNLDDIKDEITSWKRSSNLVDEVYDYQ 619
               A   G    +R++ ++  ++ I +WKR +    E +DYQ
Sbjct: 528 EGGYAGYGGTERRIRIYEINISENNIYTWKRLNGSPKEFFDYQ 570

>KAFR0A06210 Chr1 (1254374..1256119) [1746 bp, 581 aa] {ON}
           Anc_4.200 YLR361C
          Length = 581

 Score = 86.7 bits (213), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 92/365 (25%), Positives = 151/365 (41%), Gaps = 70/365 (19%)

Query: 302 SPHIQFSRGQRSFKILQMTDFHF-----KCTDNSMSIINEI-----RTVNFIDRVLALEN 351
           SP +  +  Q  FKI+Q+ D H      +C D      + +     +T+ FI++VL  E+
Sbjct: 241 SPKLLTTTSQ-DFKIVQLADLHMGVGTNECRDEFPESSDGVCKADPKTLEFIEKVLDNES 299

Query: 352 PDLVVITGDLLDSQNTI-DYQTCIMKLVQPMISNKIPYAISLGVSDESNLATPSQVQDYI 410
           P LVV TGD +    +I D +T ++K + P+I  K+P+A+  G  D+    +  Q+ +  
Sbjct: 300 PQLVVFTGDQIMGDRSIQDSETTLLKALDPVIRRKLPWAMVWGNHDDEGSLSRWQLSELA 359

Query: 411 RNLPYT-----------------------FNSVASEEGHIAIRVSFXXXXXXXXXXXRGI 447
             LPY+                       FN    EEG I +                G 
Sbjct: 360 AKLPYSLFEMSKYDTKNNKFGVGNYAKQVFNGDNEEEGLITLYFLDSHKYSQMGKIYPGY 419

Query: 448 NAKDETTPSEALFFVFDSFNPVNDFLLDYSNLIGKIDYGLAFQYFPLSEY-------RPH 500
           +   E    E L ++   +N     LL  S    K    +AF + PL EY       R  
Sbjct: 420 DWIKE----EQLNYIEHEYN--TKLLLKQSK--QKKQLSMAFFHIPLPEYLNLNSAKRAG 471

Query: 501 GLFPIIGQYNERSTLTVDTSRSKGEVSMTIDGKNYKSFLDILNLWNIKGVSCGHEHNNDC 560
              P++G++ E  T     S +                L+ L    ++  SCGH+H ND 
Sbjct: 472 ENNPLVGEFKEGVTAPKYNSGA----------------LEKLQSLGVQVTSCGHDHCNDY 515

Query: 561 CL---QSINEMWLCYGGS-AGIDVARIEGIHPNVRLFNLDDIKDEITSWKRSSNLVDEVY 616
           CL    + +++WLC+GGS      A   G    +R++ L+  +  + +WK  +   +  +
Sbjct: 516 CLLDDSTSSDIWLCFGGSAGEGAYAGYGGTERRIRVYALNTERSTVYTWKLLNGSPNLPF 575

Query: 617 DYQYI 621
           DYQ +
Sbjct: 576 DYQQL 580

>KLTH0E10824g Chr5 (973337..975079) [1743 bp, 580 aa] {ON} similar
           to uniprot|Q05924 Saccharomyces cerevisiae YLR361C DCR2
           Protein involved in cell cycle regulation
          Length = 580

 Score = 84.7 bits (208), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 89/357 (24%), Positives = 148/357 (41%), Gaps = 76/357 (21%)

Query: 311 QRSFKILQMTDFHF-----KCTDN---SMSIINEIRTVNFIDRVLALENPDLVVITGD-L 361
           +  FKI+Q+ D H+     +C D      + I + +T+ F+++VL  E P LVV TGD +
Sbjct: 245 ENPFKIVQLADLHYSVGEGRCRDEFPKHENCIADPKTLAFVEKVLDTEKPQLVVFTGDQI 304

Query: 362 LDSQNTIDYQTCIMKLVQPMISNKIPYAISLGVSDESNLATPSQVQDYIRNLPYTFNSVA 421
           + S+   D  T ++K+V P+I  +IPYA+  G  D+       ++   +++LP +   + 
Sbjct: 305 MGSECVQDSVTALLKVVDPIIKRQIPYAMVWGNHDDEGSLDRWEISKLVQSLPLSLFKIG 364

Query: 422 SEEGHIAIRVSFXXXXXXXXXXXRGINAKDETTPSEALFFV------------------- 462
               H     SF                 ++  P  AL+F+                   
Sbjct: 365 D---HDTNDNSFGVGNYVHYIY------GEDGNPLSALYFLDAHKYSPNAKAYPGYDWIK 415

Query: 463 ---FDSFNPVNDFLLDYSNLIGKIDYGLAFQYFPLSEY-------RPHGLFPIIGQYNER 512
              ++ F+   D  +D      K    +AF + PL EY        P    P+IG + E 
Sbjct: 416 EEQWNFFDGYKDAFVDQ-----KASLSMAFFHIPLPEYLNVDSSSSPGTQNPLIGNFKE- 469

Query: 513 STLTVDTSRSKGEVSMTIDGKNYKSFLDILNLWNIKGVSCGHEHNNDCCL------QSIN 566
             +T     SKG              +  L    +K  S GH+H ND CL       +IN
Sbjct: 470 -GVTAPKYNSKG--------------IATLRELGVKVTSVGHDHCNDYCLLEDSQSPAIN 514

Query: 567 E-MWLCY-GGSAGIDVARIEGIHPNVRLFNLDDIKDEITSWKRSSNLVDEVYDYQYI 621
           E +WLC+ G +         G    +R++ LD  K  I +WK  ++  +  +D+Q +
Sbjct: 515 ERIWLCFGGAAGEGGYGGYGGTERRIRVYQLDFSKRSIVTWKVLNSSPEAPFDHQTL 571

>Kwal_55.20333 s55 (355985..357718) [1734 bp, 577 aa] {ON} YLR361C -
           Hypothetical ORF [contig 150] FULL
          Length = 577

 Score = 84.3 bits (207), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 92/353 (26%), Positives = 143/353 (40%), Gaps = 68/353 (19%)

Query: 311 QRSFKILQMTDFHF-----KCTDNS---MSIINEIRTVNFIDRVLALENPDLVVITGD-L 361
           + +FKI+Q+ D HF     +C D      +   + +T  FI+RVL LE P LVV TGD +
Sbjct: 242 ENNFKIVQLADLHFSVDEGRCRDEHPVHETCKADPKTSKFIERVLDLEKPQLVVFTGDQI 301

Query: 362 LDSQNTIDYQTCIMKLVQPMISNKIPYAISLGVSDESNLATPSQVQDYIRNLPYTFNSVA 421
           +  +   D  T ++K+V P+I  KIPYA+  G  D+       ++ + +++ PY+   ++
Sbjct: 302 MGDECRQDSLTALLKVVAPVIERKIPYAMVWGNHDDEGSLNRWELSELVKSFPYSLFKIS 361

Query: 422 SEEGHIAIRVSFXXXXXXXXXXXRGINAKDETTPSEALFFVFDSFNP------------- 468
               H     SF             I  KD    S   F     ++P             
Sbjct: 362 E---HDTQDNSFGVGNYMHY-----IYGKDGNPVSSLYFLDSHKYSPNAKAYPGYDWIKE 413

Query: 469 -----VNDFLLDYSNLIGKIDYGLAFQYFPLSEY-------RPHGLFPIIGQYNERSTLT 516
                +  F   +S+   K    +AF + PL EY        P  + P IG + E   LT
Sbjct: 414 EQWKYLETFEDSFSD--QKRSLSMAFFHIPLPEYANFQSTQSPDYMNPSIGSFKE--GLT 469

Query: 517 VDTSRSKGEVSMTIDGKNYKSFLDILNLWNIKGVSCGHEHNNDCCL-------QSINEMW 569
                S G              +  L    +K  S GH+H ND CL        + +++W
Sbjct: 470 APKFNSNG--------------IPTLRKLGVKATSVGHDHCNDYCLLDDSQSQANEDKIW 515

Query: 570 LCY-GGSAGIDVARIEGIHPNVRLFNLDDIKDEITSWKRSSNLVDEVYDYQYI 621
           LC+ G +     A   G    +R F LD     I SWK  ++  +  +D Q +
Sbjct: 516 LCFGGAAGEGGYAGYGGTERRIRTFQLDFEAQSIQSWKVLNSSPESRFDSQIL 568

>NDAI0J01970 Chr10 complement(488882..490651) [1770 bp, 589 aa] {ON}
           Anc_4.200
          Length = 589

 Score = 80.5 bits (197), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 83/342 (24%), Positives = 143/342 (41%), Gaps = 64/342 (18%)

Query: 314 FKILQMTDFHFKCTDNSM---------SIINEIRTVNFIDRVLALENPDLVVITGDLLDS 364
           FKI+Q+ D H    +N+              + +T+ FI+ VL +E+P LV+ TGD +  
Sbjct: 269 FKIVQLADLHMAVGENTCRDEFPKTDEDCKADPKTLKFIESVLDIESPQLVIYTGDQIMG 328

Query: 365 QNTI-DYQTCIMKLVQPMISNKIPYAISLGVSDESNLATPSQVQDYIRNLPYTFNSVASE 423
             +I D +T ++K + P+IS ++ +A+  G  D+    +  Q+ +    LP++    + +
Sbjct: 329 DLSIQDSETTLLKALSPVISRRLSWAMVWGNHDDEGSLSRWQLSELASILPFSLFQFSPK 388

Query: 424 EGHIAIRVSFXXXXXXXXXXXRGINAKDETTPSEALFFVFDSFN--------PVNDFLLD 475
           + +     SF              N  D +   +   +  DS          P  D++ +
Sbjct: 389 DTN---DNSFGVGNYVE-------NIYDYSNELKITLYFLDSHKYSKNGKIFPGYDWIKE 438

Query: 476 ---------YSNLIGKIDYGLAFQYFPLSEYR-------PHGLFPIIGQYNERSTLTVDT 519
                    +S+        +AF + PL EY        P     I+GQ+ E   +T   
Sbjct: 439 DQWEYMKSLHSSTPENKGISMAFFHIPLPEYLDLDSKKVPSQQNEIVGQFKE--GVTAPK 496

Query: 520 SRSKGEVSMTIDGKNYKSFLDILNLWNIKGVSCGHEHNNDCCLQ---SINEMWLCYGGS- 575
             S G              L  L    +   SCGH+H ND CL+   + + +WLCYGGS 
Sbjct: 497 YNSGG--------------LSTLQELGVTVTSCGHDHCNDYCLRDDSTPSMIWLCYGGSA 542

Query: 576 AGIDVARIEGIHPNVRLFNLDDIKDEITSWKRSSNLVDEVYD 617
                A   G    +R+F +D   + + +WKR +    E++D
Sbjct: 543 GEGAYAGYGGTERRIRVFEIDTTDNSVYTWKRLNGSPSEIFD 584

>Kpol_472.15 s472 (43361..44950) [1590 bp, 529 aa] {ON}
           (43361..44950) [1590 nt, 530 aa]
          Length = 529

 Score = 79.7 bits (195), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 95/377 (25%), Positives = 157/377 (41%), Gaps = 60/377 (15%)

Query: 287 NILELLQVDGNYKITS-------------PHIQFSRGQRS--FKILQMTDFHF-----KC 326
           NI++ + + GN K T              P IQ     R+  FKILQ+ D H+     +C
Sbjct: 164 NIIDDISLPGNSKWTKLSVYKPNSSKEVLPEIQLGVKGRTNKFKILQLADLHYSTLDGEC 223

Query: 327 TD---NSMSIINEIRTVNFIDRVLALENPDLVVITGD-LLDSQNTIDYQTCIMKLVQPMI 382
            D    +     + +T  FI+ +L L+ PDLVV TGD ++ SQ ++D  + + K+V P+I
Sbjct: 224 RDEYPKTEDCNADFKTRTFIESILNLDRPDLVVFTGDQIMGSQCSLDATSALFKVVNPII 283

Query: 383 SNKIPYAISLGVSDESNLATPSQVQDYIRNLPYTF-----------NSVASEEGHIAIRV 431
             KIP+ +  G  D+    +  Q+ +   +LPY+            N+  +      IR 
Sbjct: 284 RRKIPWTMVWGNHDDEGSLSRVQLSNLAMSLPYSMFRYNPNFDTSDNTFGTGNYIHKIRA 343

Query: 432 SFXXXXXXXXXXXRGINAKDETTPSEALFFVFDSFNPVNDFLLDY--SNLIGKIDYGLAF 489
           S               + K  TT +  +   +D    + +  L+Y   N   +    +AF
Sbjct: 344 SDGSPLASLIFLD---SHKKATTKTGKVKLGYDW---IKESQLNYVKENYGTETPLNMAF 397

Query: 490 QYFPLSEYRPHGLFPIIGQYNERSTLTVDTSRSKGEVSMTIDGKNYKS-FLDILNLWNIK 548
            + PL E+            N +S   V      G     +    Y S  LD+L    ++
Sbjct: 398 FHIPLPEF-----------LNTKSDEGVKNVIV-GLFKEGVTAPRYNSGALDVLKSLKVQ 445

Query: 549 GVSCGHEHNNDCCLQSINE---MWLCY-GGSAGIDVARIEGIHPNVRLFNLDDIKDEITS 604
            V  GH+H ND CL   ++    WLC+ G +         G    VRL+ ++     I +
Sbjct: 446 VVGVGHDHCNDYCLLEKSKKYGTWLCFGGAAGEGGYGGYGGTERRVRLYEINGKDLSIKT 505

Query: 605 WKRSSNLVDEVYDYQYI 621
           WKR ++   E ++ Q +
Sbjct: 506 WKRLNSKPKEKFEEQLL 522

>TBLA0D02020 Chr4 (503782..505713) [1932 bp, 643 aa] {ON} Anc_4.200
           YLR361C
          Length = 643

 Score = 79.3 bits (194), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 85/368 (23%), Positives = 141/368 (38%), Gaps = 72/368 (19%)

Query: 302 SPHIQFSRGQRSFKILQMTDFHFK-----CTD--------NSMSIINEIRTVNFIDRVLA 348
            P +        FKI+Q+ D H       C D        +  S   +  T+ F+ +VL 
Sbjct: 273 GPRLTTDPANHKFKIVQLADLHLSTGYGVCRDPFPANLIADDGSCHADPLTLQFVSQVLD 332

Query: 349 LENPDLVVITGD-LLDSQNTIDYQTCIMKLVQPMISNKIPYAISLGVSDESNLATPSQVQ 407
            E P LVV +GD ++  +   D +T ++K V P+I   IP+A+  G  D+       ++ 
Sbjct: 333 EEQPQLVVFSGDQIMGDRCKADSKTALLKAVAPVIQRGIPWAMIWGNHDDEGSMDRIEIS 392

Query: 408 DYIRNLP---YTFNSVASEEGHIAIRVSFXXXXXXXXXXXRGINAKDETTPSEALFFV-- 462
           ++   LP   + F    + +    +                      + TP+  L+F+  
Sbjct: 393 EFAAALPGSQFQFTPFDTSDNTFGVGNYLLNVYDTQDVT--------QVTPAFTLYFLDS 444

Query: 463 ------------FDSFNPVNDFLLDYSN----LIGKIDYGLAFQYFPLSEYR------PH 500
                       +D   P       Y +            +AF + P+ EYR      P 
Sbjct: 445 HKYATTGRFSAGYDWVKPKQLHYFQYQHDQLPPTEPQHISMAFLHIPVPEYRNLQSNRPE 504

Query: 501 G---LFPIIGQYNERSTLTVDTSRSKGEVSMTIDGKNYKSFLDILNLWNIKGVSCGHEHN 557
               L P +G + E  T     +R  G +SM             L    I  VSCGH+H 
Sbjct: 505 TRGELNPFVGNHKEPVTAP---ARDSGTLSM-------------LQQLGISVVSCGHDHC 548

Query: 558 NDCCLQ---SINEMWLC-YGGSAGIDVARIEGIHPNVRLFNLDDIKDEITSWKRSSNLVD 613
           ND CL+   + +++WLC  G +     +   G    +R++ LD     + +WKR    ++
Sbjct: 549 NDYCLEDDSTGSDVWLCYGGAAGEGGYSGYGGTERRIRIYELDAKAGRVVTWKRRRGSMN 608

Query: 614 EVYDYQYI 621
           E  DYQ +
Sbjct: 609 EARDYQVL 616

>ABL009W Chr2 (381100..382809) [1710 bp, 569 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR361C
          Length = 569

 Score = 74.3 bits (181), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 85/353 (24%), Positives = 138/353 (39%), Gaps = 78/353 (22%)

Query: 315 KILQMTDFHF-----KCTDNSMSIIN---EIRTVNFIDRVLALENPDLVV-----ITGDL 361
           K++ + D H      +C D   +  N   +++T+ F++ VL +E PD+ V     ITGDL
Sbjct: 249 KVVHLADLHLVPGKGECRDEFPTTENCEADVKTMKFVNDVLDIERPDMAVYTGDQITGDL 308

Query: 362 LDSQNTIDYQTCIMKLVQPMISNKIPYAISLGVSDESNLATPSQVQDYIRNLPYTF---- 417
            D+    D +T ++K   P     IP+A+  G  D++      Q+  Y+  LP++     
Sbjct: 309 CDN----DAETPLLKAFAPANQRWIPFAVIWGNHDDAGSLNRLQLSQYVEALPFSLFKIG 364

Query: 418 ---------------NSVASEEGHIAIRVSFXXXXXXXXXXXRGINAKDETTPSEALFFV 462
                          + V  E GH  I   F           RG    D     +  +F 
Sbjct: 365 PRDTMDRSFGMGNYVHQVLGENGHPEITFYFVDTHSYAPNP-RGRRVYDWVKEEQWQYFE 423

Query: 463 FDSFNPVNDFLLDYSNLIGKIDYGLAFQYFPLSEY-------RPHGLFPIIGQYNERSTL 515
                       D    +   +  LAF + PL EY        P      +G +  R  +
Sbjct: 424 ------------DCHAKLEHTELSLAFLHIPLPEYLDVKSKKDPQKYNQFLGTF--REGV 469

Query: 516 TVDTSRSKGEVSMTIDGKNYKSFLDILNLWNIKGVSCGHEHNNDCCLQSI-----NEMWL 570
           T     S G   +   G              +  V+ GH+H ND CLQ+       ++W+
Sbjct: 470 TAPRHNSGGAERLARLG--------------VSAVTAGHDHCNDYCLQTDFRDIDPKIWM 515

Query: 571 CYGGSAGIDVARIEG-IHPNVRLFNLDDIKDEITSWKRSSNLVDEVYDYQYIY 622
           CYGG+AG       G     +R+F +D  +  I +WKR ++  ++ +D   IY
Sbjct: 516 CYGGAAGEGGYGGYGGTERRIRIFEIDTREKRIETWKRLNSSPNDKFDAHLIY 568

>CAGL0B02761g Chr2 (265971..267707) [1737 bp, 578 aa] {ON} similar
           to uniprot|Q05924 Saccharomyces cerevisiae YLR361c
          Length = 578

 Score = 72.0 bits (175), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 81/350 (23%), Positives = 149/350 (42%), Gaps = 61/350 (17%)

Query: 313 SFKILQMTDFHF-----KCTD---NSMSIINEIRTVNFIDRVLALENPDLVVITGD-LLD 363
            FKI+Q+ D H      +C D   +      + +T+ F++ VL +E P  VV +GD ++ 
Sbjct: 247 GFKIVQLADLHLGVGKNRCLDEYPHHDKCEADSKTLKFVEEVLDIEKPGFVVFSGDQIMG 306

Query: 364 SQNTIDYQTCIMKLVQPMISNKIPYAISLGVSDESNLATPSQVQDYIRNLPYTFNSVASE 423
            ++  D ++ + K V P+I  +IP+A+  G  D+    +  ++      LPY+   ++  
Sbjct: 307 DRSLQDSESVLYKAVDPVIRRRIPWAMVWGNHDDEGSLSRWELSKLAMKLPYSRFQISPH 366

Query: 424 E--------GHIAIRVSFXXXXXXXXXXXRGINAKDETTPSEALFFVFDSFNPVNDFLLD 475
           +        G+ A ++ +             +++   +   +    ++  ++ + +  L+
Sbjct: 367 DTKDNTFGVGNYAHQIFYENDPEVAALSLYFMDSHKYSKTGK----IYLGYDWLKEEQLE 422

Query: 476 Y----------SNLIGKID--YGLAFQYFPLSEY-------RPHGLFPIIGQYNERSTLT 516
           Y          S++   I     + F + PL EY       RP     +IG + E   +T
Sbjct: 423 YIQSLYERGMKSHIKENIHRHAAMTFIHIPLPEYLNLDSKKRPGESNELIGTFKE--GVT 480

Query: 517 VDTSRSKGEVSMTIDGKNYKSFLDILNLWNIKGVSCGHEHNNDCCLQ----SINEMWLCY 572
                S G V++   G              +  V CGH+H ND CL     S   +WLCY
Sbjct: 481 APRYNSGGLVALDKIG--------------VDVVGCGHDHCNDYCLHDDSTSNKNIWLCY 526

Query: 573 GGSAGIDVARIEG-IHPNVRLFNLDDIKDEITSWKRSSNLVDEVYDYQYI 621
           GG AG       G     +R +  D    +IT+WKR ++   E++D+Q +
Sbjct: 527 GGGAGEGGYAGYGGTERRIRTYKFDPQTGKITTWKRLNSKPSEIFDFQIV 576

>ZYRO0D13156g Chr4 complement(1106020..1107972) [1953 bp, 650 aa]
           {ON} similar to uniprot|Q03722 YML020W Saccharomyces
           cerevisiae Hypothetical ORF
          Length = 650

 Score = 32.7 bits (73), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 44/80 (55%), Gaps = 1/80 (1%)

Query: 86  DKNNVLWSRVSKNITIEALYSLQSGAFYNSYLYVHPKGFQSNSRNSIKEL-AIARDSALI 144
           ++ +V +S   K I+I A+  + +G FY +   +  + +Q+  + S++EL    R  +L+
Sbjct: 397 NEGDVPFSTNKKIISILAMAGINNGPFYGADQTLFVRAYQTIEKESLRELFQFQRPDSLV 456

Query: 145 PLQVLRDINKMVKSSDSSVF 164
             +++R I  +V S+   VF
Sbjct: 457 SQKLIRSIRIIVGSNVKIVF 476

>CAGL0D00528g Chr4 (64404..70649) [6246 bp, 2081 aa] {ON} highly
            similar to uniprot|P07149 Saccharomyces cerevisiae
            YKL182w FAS1 fatty-acyl-CoA synthase
          Length = 2081

 Score = 32.7 bits (73), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 49/190 (25%), Positives = 75/190 (39%), Gaps = 38/190 (20%)

Query: 455  PSEALFFVFDSFNPVNDFLLDYSNLIGKIDYGLAFQYFPLSEYRPHGLFPIIGQYNE--- 511
            P EA+  VFD++    D  L+  +    +DY LA    P+   +P    P++ Q  E   
Sbjct: 1009 PDEAIKLVFDAYPCAKDQYLNAQD----VDYFLALCQNPMQ--KPVPFVPVLDQRFEFFF 1062

Query: 512  -----------RSTLTVDTSRS---KGEVSMTIDGKNYKSFLDILNLWNIKGVSCGHEHN 557
                        + +  D  R+    G VS     K  +   DIL+     G+  GH   
Sbjct: 1063 KKDSLWQSEHLEAVVDEDVQRTCILHGPVSAQYTTKVDEPIQDILD-----GIHNGH--- 1114

Query: 558  NDCCLQSINEMWLCYGG-SAGIDVARIEGIHPNVRLFNLDDIKDEITSWKRSSNLVDEVY 616
             D  L+        YGG S+ I V    G    V + N + +KDE T    +S + DE Y
Sbjct: 1115 IDMLLKD------YYGGDSSKIPVVEYFGGEDPVEINNTEIVKDEDTLVLDASTIKDEAY 1168

Query: 617  DYQYIYKGKH 626
             ++ +   K 
Sbjct: 1169 WFKLLSGSKR 1178

>CAGL0I00352g Chr9 (26900..27403) [504 bp, 167 aa] {ON} highly
           similar to uniprot|P06104 Saccharomyces cerevisiae
           YGL058w RAD6 E2 ubiquitin-conjugating
          Length = 167

 Score = 31.2 bits (69), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 33/73 (45%), Gaps = 2/73 (2%)

Query: 235 SRPSWKEVMHEFHRNNIPSLPISITRKLKTKNNLHKASKRLTGPLKAPEKDNNILELLQV 294
           S P+ + +M +F R    S P      L   +N+   +  + GP   P +D     LL+ 
Sbjct: 2   STPARRRLMRDFKRMKEDSPPGVSASPLP--DNVMVWNAMIIGPADTPYEDGTFRLLLEF 59

Query: 295 DGNYKITSPHIQF 307
           D +Y    PH++F
Sbjct: 60  DEDYPNKPPHVKF 72

>Smik_8.182 Chr8 (299804..300787) [984 bp, 327 aa] {ON} YHR104W
           (REAL)
          Length = 327

 Score = 32.0 bits (71), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 46/101 (45%), Gaps = 13/101 (12%)

Query: 469 VNDFLLDYSNLIGKIDYGLAFQYFPLSEYRPHGLFPII-----GQYNERSTLTVDTSRSK 523
           +ND  LDY +L   I + +AF+Y P  E  P G +  +     G   E     +DT R+ 
Sbjct: 97  LNDMGLDYLDLY-YIHFPIAFKYVPFEEKYPPGFYTGVDDEKKGHITEAHVPILDTYRAL 155

Query: 524 GE-----VSMTIDGKNYKSFL--DILNLWNIKGVSCGHEHN 557
            E     +  +I   N++  L  D+L    IK V+   EH+
Sbjct: 156 EECVDEGLIKSIGISNFQGSLVQDLLRGCRIKPVALQIEHH 196

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.412 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 69,375,933
Number of extensions: 3143351
Number of successful extensions: 8506
Number of sequences better than 10.0: 49
Number of HSP's gapped: 8616
Number of HSP's successfully gapped: 67
Length of query: 626
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 510
Effective length of database: 40,180,143
Effective search space: 20491872930
Effective search space used: 20491872930
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 69 (31.2 bits)