Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_15.3015.443ON1272127267990.0
YOR124C (UBP2)5.443ON1272127359110.0
Skud_15.2865.443ON1278127857920.0
Suva_8.1765.443ON1270127356640.0
ZYRO0G01606g5.443ON1305126037290.0
NCAS0H021005.443ON1269124237220.0
TDEL0D025805.443ON1272123336340.0
NDAI0C015505.443ON1295124335600.0
Kpol_1062.235.443ON1266123435450.0
SAKL0G02728g5.443ON1237123534660.0
KNAG0B041905.443ON1262123634660.0
KAFR0D050705.443ON1227124634510.0
TBLA0A064705.443ON1320126933580.0
KLTH0F15862g5.443ON1241124932890.0
Kwal_55.213935.443ON1233122732620.0
TPHA0E017105.443ON1283123732520.0
CAGL0K10252g5.443ON1267125732360.0
Ecym_45145.443ON1246124230430.0
KLLA0E02377g5.443ON1220122528940.0
ACL164C5.443ON138980219350.0
Kpol_1016.15.443ON1251121018960.0
TPHA0J026205.443ON1225124416330.0
KLTH0H13354g1.369ON495971282e-06
KAFR0C045201.369ON4991491239e-06
TBLA0C012001.369ON503361221e-05
SAKL0D10120g1.369ON492401221e-05
Kwal_34.162681.369ON449971202e-05
TDEL0D024001.369ON494961192e-05
KLLA0A10791g1.369ON484901183e-05
ZYRO0G01188g1.369ON500721166e-05
Kpol_2001.541.137ON1223621176e-05
Ecym_27171.369ON483331131e-04
AEL029W1.369ON446841131e-04
Ecym_81401.137ON1264851122e-04
NDAI0G007802.307ON486661112e-04
KAFR0I026005.18ON1213951122e-04
Suva_13.4955.18ON12301051113e-04
SAKL0E07106g2.307ON791491104e-04
TPHA0P006807.390ON727921104e-04
Suva_6.2761.137ON1256891104e-04
Smik_13.5215.18ON12311081104e-04
YMR304W (UBP15)5.18ON12301081094e-04
Skud_13.4785.18ON12311001095e-04
TPHA0A025101.369ON505691085e-04
NDAI0B034302.307ON856481085e-04
NCAS0I031401.137ON12011081078e-04
KNAG0A054502.307ON764491078e-04
ZYRO0C17908g1.137ON1204791079e-04
KNAG0C019401.369ON499481050.001
NCAS0D006001.369ON493961050.001
Skud_6.941.369ON499871050.001
YFR010W (UBP6)1.369ON499481050.001
Kpol_1003.532.307ON788491040.002
YJL197W (UBP12)1.137ON1254811040.002
KAFR0L017307.390ON701761040.002
Smik_7.3141.369ON499481030.002
CAGL0H10582g2.307ON790481030.002
Skud_4.1332.307ON787481030.002
Kpol_534.231.369ON496981030.002
Suva_5.2177.390ON754951030.002
YDL122W (UBP1)2.307ON809481030.002
Smik_4.1152.307ON790481030.002
Smik_2.497.390ON745511030.002
Suva_4.1252.307ON793481030.002
TDEL0C056401.137ON1178391030.003
TDEL0G023702.307ON747631020.003
KAFR0A069102.307ON678481020.003
Smik_5.2447.390ON749781020.003
AGR389C2.307ON775491020.003
TPHA0G008502.307ON782491020.003
TBLA0B060802.307ON824631020.003
Smik_10.371.137ON1247701020.003
NCAS0B061302.307ON770491020.003
ZYRO0A02420g2.307ON745491010.003
NDAI0A016707.390ON846781010.003
Kwal_27.114442.307ON757491010.004
Skud_5.2237.390ON748781010.004
KLTH0G10934g2.307ON758491010.004
NDAI0H035501.369ON502341000.004
Skud_10.221.137ON1255811010.004
Klac_YGOB_Anc_5.18b5.18ON11661031000.006
CAGL0M13783g5.18ON119658990.007
CAGL0K10494g1.369ON49596980.007
NCAS0D023905.18ON121195990.007
KLLA0D08459g2.69ON75066990.007
KAFR0D021605.712ON84652980.008
AFR627C1.137ON128750990.008
TBLA0J006001.137ON146277990.008
Kwal_33.136281.137ON116059980.009
KAFR0A075802.69ON80266980.009
Suva_6.831.369ON50033970.009
KNAG0F012202.69ON78466980.010
SAKL0H00418g5.18ON119097970.011
YER098W (UBP9)7.390ON75466970.012
KLTH0B09944g5.18ON118995970.012
Kpol_1045.417.390ON712103960.013
KNAG0C021801.137ON123152960.014
TDEL0B036708.742ON463112950.015
Suva_14.1562.69ON78866960.015
NCAS0E026107.390ON71777960.015
KLLA0C03476g1.137ON125263960.016
TBLA0C070205.18ON124758960.017
NCAS0G018002.69ON87566950.019
ABL145W2.69ON74966940.024
TPHA0A025401.137ON128628940.024
NDAI0B004801.137ON125380940.025
Smik_14.1442.69ON76366940.025
NDAI0F034102.69ON87066940.026
TPHA0L022905.18ON119395940.026
Kpol_513.255.18ON119092940.029
TDEL0B020805.712ON102587940.029
TBLA0B097602.69ON89866930.030
CAGL0J11352g2.69ON77166930.030
KLTH0F03674g1.137ON119839930.031
NDAI0E008108.742ON49348930.032
TBLA0E017605.712ON121242930.032
Ecym_46857.390ON77831930.033
Kwal_26.95985.18ON119195930.041
Kwal_33.144302.69ON51166920.043
KLLA0E08801g2.307ON77149920.043
ZYRO0A05962g8.742ON46571910.044
AGR370W7.390ON740102920.044
Kpol_1044.242.69ON72466920.046
Skud_14.1482.69ON77666920.049
TDEL0A011002.69ON66166910.053
Ecym_56715.18ON117695910.055
NCAS0G036802.307ON48248900.059
ZYRO0C09812g2.69ON70266910.061
NDAI0I025305.18ON119753910.061
SAKL0E13002g2.69ON73966900.073
NCAS0B005808.742ON466141890.075
TBLA0D010708.742ON48380890.080
KLTH0B07150g2.69ON75666890.085
KAFR0C004103.270ON76963890.091
Kwal_27.108427.390ON71131890.097
ZYRO0D07062g5.18ON119358890.099
YBL067C (UBP13)7.390ON74733890.10
KAFR0F015601.137ON117158890.11
YMR223W (UBP8)8.742ON47148880.11
AGL357W5.18ON116695890.11
Skud_13.3928.742ON47348880.12
YNL186W (UBP10)2.69ON79266880.12
Smik_13.4318.742ON47148870.13
Suva_13.4078.742ON47148870.13
KLLA0A00396g5.712ON101230880.15
SAKL0D03322g3.270ON76557870.16
SAKL0C04246g1.137ON129739870.16
NDAI0E041807.390ON827143870.17
KNAG0E012905.18ON119670870.17
Suva_2.507.390ON75089870.17
TDEL0G004105.18ON118644870.18
KNAG0B023707.390ON75358870.18
CAGL0L01639g1.137ON114758870.19
Ecym_40095.712ON151730870.19
KNAG0J008003.270ON76544860.19
CAGL0H06721g5.712ON108153870.20
SAKL0E15136g5.712ON1037209870.20
Kwal_55.196455.712ON97030860.21
TPHA0O016402.69ON74666860.22
KLTH0H07370g8.202ON78175860.23
CAGL0G05247g8.188ON94760860.25
NCAS0A143707.390ON72931850.26
Kpol_1018.937.390ON75585850.28
TPHA0D046605.712ON104526850.34
NCAS0G001705.712ON103030850.34
KLLA0C06974g8.742ON44665830.39
CAGL0G02563gsingletonON63129840.41
Smik_5.3188.202ON90968840.41
AFR296C5.712ON116949840.44
KNAG0L022005.712ON116126840.44
TPHA0E008707.390ON71531830.44
CAGL0M11198g8.742ON46164830.45
KNAG0C035807.390ON77641830.47
YIL156W (UBP7)5.712ON107126830.56
NDAI0F002005.712ON110526830.57
Skud_2.387.390ON74831820.57
KLLA0E20351g7.390ON69731820.59
Smik_9.135.712ON106026830.60
TBLA0D006207.390ON117175820.62
Skud_5.2898.202ON91069820.64
TDEL0C015707.390ON76579820.64
Suva_9.305.712ON106226820.67
KLTH0E00814g5.712ON97430820.68
ZYRO0F01276g3.270ON77663820.74
TPHA0C027708.188ON97068820.75
Kpol_1064.488.742ON466124810.81
YER151C (UBP3)8.202ON91269810.85
KNAG0D019308.188ON98694810.85
ZYRO0B03300g7.390ON81366810.86
KLTH0H07678g8.188ON86152810.88
Skud_9.125.712ON106426810.88
NCAS0B042808.188ON92259810.91
SAKL0F12430g7.390ON75431810.93
Kpol_1032.288.188ON88258810.94
TDEL0A016208.202ON79571800.99
KLTH0C06732g7.390ON71431801.0
KAFR0C025908.188ON97885801.3
TBLA0B019308.202ON101969801.3
KAFR0K018107.390ON71451791.3
Kpol_1055.318.202ON82284791.6
Suva_2.2288.188ON92762791.6
TDEL0D064303.575ON536116781.6
YDR069C (DOA4)8.188ON92662791.6
Skud_4.3238.188ON92662791.6
Suva_4.2953.270ON78251781.8
ZYRO0B16544g5.712ON104451782.0
Smik_4.3078.188ON92962782.0
KAFR0A042108.742ON440127772.0
Skud_11.3385.712ON71230782.1
CAGL0A04477g7.390ON77031782.1
NCAS0A038408.202ON91768782.2
SAKL0H18986g8.188ON89351772.5
KNAG0G015908.188ON671136772.7
CAGL0I05522g7.390ON72431772.8
Suva_5.2808.202ON90569772.9
YER144C (UBP5)8.188ON80547763.2
KNAG0G029308.742ON459170763.3
Skud_2.1773.270ON78251763.4
NDAI0A036808.188ON111647754.2
KAFR0B023708.202ON82968754.7
KAFR0H001505.712ON65626745.1
Kwal_26.91518.742ON45464745.4
TPHA0K002405.581ON174102715.9
CAGL0I06765g8.188ON88744746.2
Ecym_55448.202ON83466746.3
SAKL0H04994g8.742ON45448736.9
CAGL0H05335g8.540ON48351737.0
YKR098C (UBP11)5.712ON71741737.2
TBLA0E025703.270ON78564737.4
NCAS0I016203.270ON79556737.4
Ecym_62488.742ON46664737.6
KLTH0E04356g4.199ON40779727.6
NDAI0C059008.188ON82672737.7
AGR139C8.202ON78970737.9
TPHA0D043508.202ON854118738.1
Kwal_14.20088.188ON42483728.1
TBLA0F036108.188ON114472738.3
Suva_11.3355.712ON72440738.5
ZYRO0B11044g8.202ON82668729.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_15.301
         (1272 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_15.301 Chr15 complement(515941..519759) [3819 bp, 1272 aa] ...  2623   0.0  
YOR124C Chr15 complement(554824..558642) [3819 bp, 1272 aa] {ON}...  2281   0.0  
Skud_15.286 Chr15 complement(511346..515182) [3837 bp, 1278 aa] ...  2235   0.0  
Suva_8.176 Chr8 complement(312595..316407) [3813 bp, 1270 aa] {O...  2186   0.0  
ZYRO0G01606g Chr7 complement(123893..127810) [3918 bp, 1305 aa] ...  1441   0.0  
NCAS0H02100 Chr8 complement(406897..410706) [3810 bp, 1269 aa] {...  1438   0.0  
TDEL0D02580 Chr4 (493355..497173) [3819 bp, 1272 aa] {ON} Anc_5....  1404   0.0  
NDAI0C01550 Chr3 (327953..331840) [3888 bp, 1295 aa] {ON} Anc_5....  1375   0.0  
Kpol_1062.23 s1062 (51365..55165) [3801 bp, 1266 aa] {ON} (51365...  1370   0.0  
SAKL0G02728g Chr7 complement(223607..227320) [3714 bp, 1237 aa] ...  1339   0.0  
KNAG0B04190 Chr2 (795803..799591) [3789 bp, 1262 aa] {ON} Anc_5....  1339   0.0  
KAFR0D05070 Chr4 complement(996195..999878) [3684 bp, 1227 aa] {...  1333   0.0  
TBLA0A06470 Chr1 (1588461..1592423) [3963 bp, 1320 aa] {ON} Anc_...  1298   0.0  
KLTH0F15862g Chr6 (1288742..1292467) [3726 bp, 1241 aa] {ON} sim...  1271   0.0  
Kwal_55.21393 s55 (816177..819878) [3702 bp, 1233 aa] {ON} YOR12...  1261   0.0  
TPHA0E01710 Chr5 (343977..347828) [3852 bp, 1283 aa] {ON} Anc_5....  1257   0.0  
CAGL0K10252g Chr11 complement(998144..1001947) [3804 bp, 1267 aa...  1251   0.0  
Ecym_4514 Chr4 complement(1025172..1028912) [3741 bp, 1246 aa] {...  1176   0.0  
KLLA0E02377g Chr5 complement(218647..222309) [3663 bp, 1220 aa] ...  1119   0.0  
ACL164C Chr3 complement(67792..71961) [4170 bp, 1389 aa] {ON} Sy...   749   0.0  
Kpol_1016.1 s1016 (585..4340) [3756 bp, 1251 aa] {ON} (585..4340...   734   0.0  
TPHA0J02620 Chr10 complement(580898..584575) [3678 bp, 1225 aa] ...   633   0.0  
KLTH0H13354g Chr8 complement(1165485..1166953,1167017..1167035) ...    54   2e-06
KAFR0C04520 Chr3 complement(901847..903330,903422..903437) [1500...    52   9e-06
TBLA0C01200 Chr3 complement(258492..259981,260188..260209) [1512...    52   1e-05
SAKL0D10120g Chr4 complement(845029..846491,846566..846581) [147...    52   1e-05
Kwal_34.16268 s34 (268814..270163) [1350 bp, 449 aa] {ON} YFR010...    51   2e-05
TDEL0D02400 Chr4 (467340..467361,467436..468898) [1485 bp, 494 a...    50   2e-05
KLLA0A10791g Chr1 complement(934135..935573,935718..935733) [145...    50   3e-05
ZYRO0G01188g Chr7 (95655..95676,95759..97239) [1503 bp, 500 aa] ...    49   6e-05
Kpol_2001.54 s2001 complement(144924..148595) [3672 bp, 1223 aa]...    50   6e-05
Ecym_2717 Chr2 (1388844..1390295) [1452 bp, 483 aa] {ON} similar...    48   1e-04
AEL029W Chr5 (580062..581402) [1341 bp, 446 aa] {ON} Syntenic ho...    48   1e-04
Ecym_8140 Chr8 complement(295730..299524) [3795 bp, 1264 aa] {ON...    48   2e-04
NDAI0G00780 Chr7 (164452..165912) [1461 bp, 486 aa] {ON}               47   2e-04
KAFR0I02600 Chr9 (525365..529006) [3642 bp, 1213 aa] {ON} Anc_5....    48   2e-04
Suva_13.495 Chr13 (857778..861470) [3693 bp, 1230 aa] {ON} YMR30...    47   3e-04
SAKL0E07106g Chr5 complement(584164..586539) [2376 bp, 791 aa] {...    47   4e-04
TPHA0P00680 Chr16 (139640..141823) [2184 bp, 727 aa] {ON} Anc_7....    47   4e-04
Suva_6.276 Chr6 complement(481843..485613) [3771 bp, 1256 aa] {O...    47   4e-04
Smik_13.521 Chr13 (857682..861377) [3696 bp, 1231 aa] {ON} YMR30...    47   4e-04
YMR304W Chr13 (874987..878679) [3693 bp, 1230 aa] {ON}  UBP15Ubi...    47   4e-04
Skud_13.478 Chr13 (848446..852141) [3696 bp, 1231 aa] {ON} YMR30...    47   5e-04
TPHA0A02510 Chr1 (536076..536097,536233..537728) [1518 bp, 505 a...    46   5e-04
NDAI0B03430 Chr2 complement(868578..871148) [2571 bp, 856 aa] {ON}     46   5e-04
NCAS0I03140 Chr9 complement(576993..580598) [3606 bp, 1201 aa] {...    46   8e-04
KNAG0A05450 Chr1 (806796..809090) [2295 bp, 764 aa] {ON} Anc_2.3...    46   8e-04
ZYRO0C17908g Chr3 complement(1393864..1397478) [3615 bp, 1204 aa...    46   9e-04
KNAG0C01940 Chr3 complement(375973..377472) [1500 bp, 499 aa] {O...    45   0.001
NCAS0D00600 Chr4 (102081..103562) [1482 bp, 493 aa] {ON} Anc_1.3...    45   0.001
Skud_6.94 Chr6 complement(173619..175118) [1500 bp, 499 aa] {ON}...    45   0.001
YFR010W Chr6 (165067..166566) [1500 bp, 499 aa] {ON}  UBP6Ubiqui...    45   0.001
Kpol_1003.53 s1003 (121699..124065) [2367 bp, 788 aa] {ON} (1216...    45   0.002
YJL197W Chr10 (63805..67569) [3765 bp, 1254 aa] {ON}  UBP12Ubiqu...    45   0.002
KAFR0L01730 Chr12 (316860..318965) [2106 bp, 701 aa] {ON} Anc_7....    45   0.002
Smik_7.314 Chr7 (526664..528163) [1500 bp, 499 aa] {ON} YFR010W ...    44   0.002
CAGL0H10582g Chr8 complement(1029876..1032248) [2373 bp, 790 aa]...    44   0.002
Skud_4.133 Chr4 (238225..240588) [2364 bp, 787 aa] {ON} YDL122W ...    44   0.002
Kpol_534.23 s534 (53632..53653,53786..55254) [1491 bp, 496 aa] {...    44   0.002
Suva_5.217 Chr5 (329688..331952) [2265 bp, 754 aa] {ON} YER098W ...    44   0.002
YDL122W Chr4 (242552..244981) [2430 bp, 809 aa] {ON}  UBP1Ubiqui...    44   0.002
Smik_4.115 Chr4 (219167..221539) [2373 bp, 790 aa] {ON} YDL122W ...    44   0.002
Smik_2.49 Chr2 complement(87575..89812) [2238 bp, 745 aa] {ON} Y...    44   0.002
Suva_4.125 Chr4 (231011..233392) [2382 bp, 793 aa] {ON} YDL122W ...    44   0.002
TDEL0C05640 Chr3 complement(1005536..1009072) [3537 bp, 1178 aa]...    44   0.003
TDEL0G02370 Chr7 (456393..458636) [2244 bp, 747 aa] {ON} Anc_2.3...    44   0.003
KAFR0A06910 Chr1 complement(1393653..1395689) [2037 bp, 678 aa] ...    44   0.003
Smik_5.244 Chr5 (364470..366719) [2250 bp, 749 aa] {ON} YER098W ...    44   0.003
AGR389C Chr7 complement(1444377..1446704) [2328 bp, 775 aa] {ON}...    44   0.003
TPHA0G00850 Chr7 (158945..161293) [2349 bp, 782 aa] {ON} Anc_2.3...    44   0.003
TBLA0B06080 Chr2 (1437254..1439728) [2475 bp, 824 aa] {ON} Anc_2...    44   0.003
Smik_10.37 Chr10 (61787..65530) [3744 bp, 1247 aa] {ON} YJL197W ...    44   0.003
NCAS0B06130 Chr2 complement(1159264..1161576) [2313 bp, 770 aa] ...    44   0.003
ZYRO0A02420g Chr1 (190417..192654) [2238 bp, 745 aa] {ON} simila...    44   0.003
NDAI0A01670 Chr1 complement(368070..370610) [2541 bp, 846 aa] {O...    44   0.003
Kwal_27.11444 s27 complement(802766..805039) [2274 bp, 757 aa] {...    44   0.004
Skud_5.223 Chr5 (351514..353760) [2247 bp, 748 aa] {ON} YER098W ...    44   0.004
KLTH0G10934g Chr7 (919304..921580) [2277 bp, 758 aa] {ON} simila...    44   0.004
NDAI0H03550 Chr8 complement(865851..867359) [1509 bp, 502 aa] {O...    43   0.004
Skud_10.22 Chr10 (38735..42502) [3768 bp, 1255 aa] {ON} YJL197W ...    44   0.004
Klac_YGOB_Anc_5.18b Chr3 (1201452..1202573,1202576..1204954) [35...    43   0.006
CAGL0M13783g Chr13 (1354198..1357788) [3591 bp, 1196 aa] {ON} si...    43   0.007
CAGL0K10494g Chr11 (1023698..1025185) [1488 bp, 495 aa] {ON} hig...    42   0.007
NCAS0D02390 Chr4 complement(451930..455565) [3636 bp, 1211 aa] {...    43   0.007
KLLA0D08459g Chr4 complement(718046..720298) [2253 bp, 750 aa] {...    43   0.007
KAFR0D02160 Chr4 (432966..435506) [2541 bp, 846 aa] {ON} Anc_5.7...    42   0.008
AFR627C Chr6 complement(1572814..1576677) [3864 bp, 1287 aa] {ON...    43   0.008
TBLA0J00600 Chr10 (129182..133570) [4389 bp, 1462 aa] {ON} Anc_1...    43   0.008
Kwal_33.13628 s33 (324581..328063) [3483 bp, 1160 aa] {ON} YJL19...    42   0.009
KAFR0A07580 Chr1 complement(1528362..1530770) [2409 bp, 802 aa] ...    42   0.009
Suva_6.83 Chr6 complement(143456..144958) [1503 bp, 500 aa] {ON}...    42   0.009
KNAG0F01220 Chr6 (219798..222152) [2355 bp, 784 aa] {ON} Anc_2.6...    42   0.010
SAKL0H00418g Chr8 (50575..54147) [3573 bp, 1190 aa] {ON} similar...    42   0.011
YER098W Chr5 (355466..357730) [2265 bp, 754 aa] {ON}  UBP9Ubiqui...    42   0.012
KLTH0B09944g Chr2 complement(826050..829619) [3570 bp, 1189 aa] ...    42   0.012
Kpol_1045.41 s1045 complement(95233..97371) [2139 bp, 712 aa] {O...    42   0.013
KNAG0C02180 Chr3 (429789..433484) [3696 bp, 1231 aa] {ON} Anc_1....    42   0.014
TDEL0B03670 Chr2 complement(656511..657902) [1392 bp, 463 aa] {O...    41   0.015
Suva_14.156 Chr14 (285613..287979) [2367 bp, 788 aa] {ON} YNL186...    42   0.015
NCAS0E02610 Chr5 complement(520877..523030) [2154 bp, 717 aa] {O...    42   0.015
KLLA0C03476g Chr3 (314815..318573) [3759 bp, 1252 aa] {ON} simil...    42   0.016
TBLA0C07020 Chr3 (1694706..1698449) [3744 bp, 1247 aa] {ON} Anc_...    42   0.017
NCAS0G01800 Chr7 (319652..322279) [2628 bp, 875 aa] {ON} Anc_2.69      41   0.019
ABL145W Chr2 (124839..127088) [2250 bp, 749 aa] {ON} Syntenic ho...    41   0.024
TPHA0A02540 Chr1 (543606..547466) [3861 bp, 1286 aa] {ON} Anc_1....    41   0.024
NDAI0B00480 Chr2 complement(89965..93726) [3762 bp, 1253 aa] {ON...    41   0.025
Smik_14.144 Chr14 (268784..271075) [2292 bp, 763 aa] {ON} YNL186...    41   0.025
NDAI0F03410 Chr6 complement(820002..822614) [2613 bp, 870 aa] {O...    41   0.026
TPHA0L02290 Chr12 (479360..482941) [3582 bp, 1193 aa] {ON} Anc_5...    41   0.026
Kpol_513.25 s513 (71125..74697) [3573 bp, 1190 aa] {ON} (71125.....    41   0.029
TDEL0B02080 Chr2 (369534..372611) [3078 bp, 1025 aa] {ON} Anc_5....    41   0.029
TBLA0B09760 Chr2 complement(2316180..2318876) [2697 bp, 898 aa] ...    40   0.030
CAGL0J11352g Chr10 complement(1103473..1105788) [2316 bp, 771 aa...    40   0.030
KLTH0F03674g Chr6 (321662..325258) [3597 bp, 1198 aa] {ON} simil...    40   0.031
NDAI0E00810 Chr5 complement(163826..165307) [1482 bp, 493 aa] {O...    40   0.032
TBLA0E01760 Chr5 complement(430209..433847) [3639 bp, 1212 aa] {...    40   0.032
Ecym_4685 Chr4 complement(1332993..1335329) [2337 bp, 778 aa] {O...    40   0.033
Kwal_26.9598 s26 complement(1283781..1287356) [3576 bp, 1191 aa]...    40   0.041
Kwal_33.14430 s33 (669559..671094) [1536 bp, 511 aa] {ON} YNL186...    40   0.043
KLLA0E08801g Chr5 (784991..787306) [2316 bp, 771 aa] {ON} simila...    40   0.043
ZYRO0A05962g Chr1 complement(474545..475942) [1398 bp, 465 aa] {...    40   0.044
AGR370W Chr7 (1416579..1418801) [2223 bp, 740 aa] {ON} Syntenic ...    40   0.044
Kpol_1044.24 s1044 (56564..58738) [2175 bp, 724 aa] {ON} (56564....    40   0.046
Skud_14.148 Chr14 (278827..281157) [2331 bp, 776 aa] {ON} YNL186...    40   0.049
TDEL0A01100 Chr1 (186399..188384) [1986 bp, 661 aa] {ON} Anc_2.6...    40   0.053
Ecym_5671 Chr5 complement(1362706..1366236) [3531 bp, 1176 aa] {...    40   0.055
NCAS0G03680 Chr7 complement(682617..684065) [1449 bp, 482 aa] {O...    39   0.059
ZYRO0C09812g Chr3 complement(743861..745969) [2109 bp, 702 aa] {...    40   0.061
NDAI0I02530 Chr9 (584472..588065) [3594 bp, 1197 aa] {ON} Anc_5....    40   0.061
SAKL0E13002g Chr5 complement(1070150..1072369) [2220 bp, 739 aa]...    39   0.073
NCAS0B00580 Chr2 (86690..88090) [1401 bp, 466 aa] {ON} Anc_8.742       39   0.075
TBLA0D01070 Chr4 complement(275843..277294) [1452 bp, 483 aa] {O...    39   0.080
KLTH0B07150g Chr2 complement(574195..576465) [2271 bp, 756 aa] {...    39   0.085
KAFR0C00410 Chr3 complement(85302..87611) [2310 bp, 769 aa] {ON}...    39   0.091
Kwal_27.10842 s27 complement(522190..524325) [2136 bp, 711 aa] {...    39   0.097
ZYRO0D07062g Chr4 complement(609322..612903) [3582 bp, 1193 aa] ...    39   0.099
YBL067C Chr2 complement(93639..95882) [2244 bp, 747 aa] {ON}  UB...    39   0.10 
KAFR0F01560 Chr6 (310936..314451) [3516 bp, 1171 aa] {ON} Anc_1....    39   0.11 
YMR223W Chr13 (716715..718130) [1416 bp, 471 aa] {ON}  UBP8Ubiqu...    39   0.11 
AGL357W Chr7 (33383..36883) [3501 bp, 1166 aa] {ON} Syntenic hom...    39   0.11 
Skud_13.392 Chr13 (690758..692179) [1422 bp, 473 aa] {ON} YMR223...    39   0.12 
YNL186W Chr14 (289498..291876) [2379 bp, 792 aa] {ON}  UBP10Ubiq...    39   0.12 
Smik_13.431 Chr13 (700800..702215) [1416 bp, 471 aa] {ON} YMR223...    38   0.13 
Suva_13.407 Chr13 (697513..698928) [1416 bp, 471 aa] {ON} YMR223...    38   0.13 
KLLA0A00396g Chr1 (29717..32755) [3039 bp, 1012 aa] {ON} similar...    39   0.15 
SAKL0D03322g Chr4 (270137..272434) [2298 bp, 765 aa] {ON} simila...    38   0.16 
SAKL0C04246g Chr3 (412865..416758) [3894 bp, 1297 aa] {ON} simil...    38   0.16 
NDAI0E04180 Chr5 complement(941527..944010) [2484 bp, 827 aa] {O...    38   0.17 
KNAG0E01290 Chr5 complement(254460..258050) [3591 bp, 1196 aa] {...    38   0.17 
Suva_2.50 Chr2 complement(90700..92952) [2253 bp, 750 aa] {ON} Y...    38   0.17 
TDEL0G00410 Chr7 complement(82945..86505) [3561 bp, 1186 aa] {ON...    38   0.18 
KNAG0B02370 Chr2 complement(463599..465860) [2262 bp, 753 aa] {O...    38   0.18 
CAGL0L01639g Chr12 (178104..181547) [3444 bp, 1147 aa] {ON} simi...    38   0.19 
Ecym_4009 Chr4 (19798..24351) [4554 bp, 1517 aa] {ON} similar to...    38   0.19 
KNAG0J00800 Chr10 complement(134836..137133) [2298 bp, 765 aa] {...    38   0.19 
CAGL0H06721g Chr8 complement(667816..671061) [3246 bp, 1081 aa] ...    38   0.20 
SAKL0E15136g Chr5 complement(1258870..1261983) [3114 bp, 1037 aa...    38   0.20 
Kwal_55.19645 s55 (62575..65487) [2913 bp, 970 aa] {ON} YIL156W ...    38   0.21 
TPHA0O01640 Chr15 complement(325844..328084) [2241 bp, 746 aa] {...    38   0.22 
KLTH0H07370g Chr8 (655985..658330) [2346 bp, 781 aa] {ON} some s...    38   0.23 
CAGL0G05247g Chr7 complement(491024..493867) [2844 bp, 947 aa] {...    38   0.25 
NCAS0A14370 Chr1 (2830136..2832325) [2190 bp, 729 aa] {ON} Anc_7...    37   0.26 
Kpol_1018.93 s1018 (248094..250361) [2268 bp, 755 aa] {ON} (2480...    37   0.28 
TPHA0D04660 Chr4 complement(1017401..1020538) [3138 bp, 1045 aa]...    37   0.34 
NCAS0G00170 Chr7 (22237..25329) [3093 bp, 1030 aa] {ON} Anc_5.712      37   0.34 
KLLA0C06974g Chr3 complement(604344..605684) [1341 bp, 446 aa] {...    37   0.39 
CAGL0G02563g Chr7 complement(235498..237393) [1896 bp, 631 aa] {...    37   0.41 
Smik_5.318 Chr5 complement(474889..477618) [2730 bp, 909 aa] {ON...    37   0.41 
AFR296C Chr6 complement(972519..976028) [3510 bp, 1169 aa] {ON} ...    37   0.44 
KNAG0L02200 Chr12 complement(394140..397625) [3486 bp, 1161 aa] ...    37   0.44 
TPHA0E00870 Chr5 complement(174245..176392) [2148 bp, 715 aa] {O...    37   0.44 
CAGL0M11198g Chr13 (1102767..1104152) [1386 bp, 461 aa] {ON} sim...    37   0.45 
KNAG0C03580 Chr3 complement(699604..701934) [2331 bp, 776 aa] {O...    37   0.47 
YIL156W Chr9 (48091..51306) [3216 bp, 1071 aa] {ON}  UBP7Ubiquit...    37   0.56 
NDAI0F00200 Chr6 (35966..39283) [3318 bp, 1105 aa] {ON} Anc_5.712      37   0.57 
Skud_2.38 Chr2 complement(77293..79539) [2247 bp, 748 aa] {ON} Y...    36   0.57 
KLLA0E20351g Chr5 (1810593..1812686) [2094 bp, 697 aa] {ON} simi...    36   0.59 
Smik_9.13 Chr9 (25877..29059) [3183 bp, 1060 aa] {ON} YIL156W (R...    37   0.60 
TBLA0D00620 Chr4 complement(159706..163221) [3516 bp, 1171 aa] {...    36   0.62 
Skud_5.289 Chr5 complement(460660..463392) [2733 bp, 910 aa] {ON...    36   0.64 
TDEL0C01570 Chr3 complement(269169..271466) [2298 bp, 765 aa] {O...    36   0.64 
Suva_9.30 Chr9 (41061..42434,42912..44726) [3189 bp, 1062 aa] {O...    36   0.67 
KLTH0E00814g Chr5 (80059..82983) [2925 bp, 974 aa] {ON} similar ...    36   0.68 
ZYRO0F01276g Chr6 (102883..105213) [2331 bp, 776 aa] {ON} simila...    36   0.74 
TPHA0C02770 Chr3 (604690..607602) [2913 bp, 970 aa] {ON} Anc_8.1...    36   0.75 
Kpol_1064.48 s1064 (88495..89895) [1401 bp, 466 aa] {ON} (88495....    36   0.81 
YER151C Chr5 complement(469686..472424) [2739 bp, 912 aa] {ON}  ...    36   0.85 
KNAG0D01930 Chr4 (324705..327665) [2961 bp, 986 aa] {ON} Anc_8.1...    36   0.85 
ZYRO0B03300g Chr2 (273903..276344) [2442 bp, 813 aa] {ON} simila...    36   0.86 
KLTH0H07678g Chr8 (677217..679802) [2586 bp, 861 aa] {ON} simila...    36   0.88 
Skud_9.12 Chr9 (25211..28402) [3192 bp, 1064 aa] {ON} YIL156W (R...    36   0.88 
NCAS0B04280 Chr2 (777104..779872) [2769 bp, 922 aa] {ON} Anc_8.188     36   0.91 
SAKL0F12430g Chr6 (969369..971633) [2265 bp, 754 aa] {ON} simila...    36   0.93 
Kpol_1032.28 s1032 complement(57514..60162) [2649 bp, 882 aa] {O...    36   0.94 
TDEL0A01620 Chr1 (291670..294057) [2388 bp, 795 aa] {ON} Anc_8.2...    35   0.99 
KLTH0C06732g Chr3 complement(584097..586241) [2145 bp, 714 aa] {...    35   1.0  
KAFR0C02590 Chr3 complement(503330..506266) [2937 bp, 978 aa] {O...    35   1.3  
TBLA0B01930 Chr2 (439859..442918) [3060 bp, 1019 aa] {ON} Anc_8....    35   1.3  
KAFR0K01810 Chr11 (375304..377448) [2145 bp, 714 aa] {ON} Anc_7....    35   1.3  
Kpol_1055.31 s1055 complement(78247..80715) [2469 bp, 822 aa] {O...    35   1.6  
Suva_2.228 Chr2 complement(385322..388105) [2784 bp, 927 aa] {ON...    35   1.6  
TDEL0D06430 Chr4 complement(1151544..1153154) [1611 bp, 536 aa] ...    35   1.6  
YDR069C Chr4 complement(584939..587719) [2781 bp, 926 aa] {ON}  ...    35   1.6  
Skud_4.323 Chr4 complement(560596..563376) [2781 bp, 926 aa] {ON...    35   1.6  
Suva_4.295 Chr4 complement(520439..522787) [2349 bp, 782 aa] {ON...    35   1.8  
ZYRO0B16544g Chr2 complement(1342476..1345610) [3135 bp, 1044 aa...    35   2.0  
Smik_4.307 Chr4 complement(551719..554508) [2790 bp, 929 aa] {ON...    35   2.0  
KAFR0A04210 Chr1 (843659..844981) [1323 bp, 440 aa] {ON} Anc_8.7...    34   2.0  
Skud_11.338 Chr11 complement(614651..616789) [2139 bp, 712 aa] {...    35   2.1  
CAGL0A04477g Chr1 (442089..444401) [2313 bp, 770 aa] {ON} simila...    35   2.1  
NCAS0A03840 Chr1 (780031..782784) [2754 bp, 917 aa] {ON} Anc_8.2...    35   2.2  
SAKL0H18986g Chr8 (1683752..1686433) [2682 bp, 893 aa] {ON} simi...    34   2.5  
KNAG0G01590 Chr7 complement(354369..356384) [2016 bp, 671 aa] {O...    34   2.7  
CAGL0I05522g Chr9 complement(521749..523923) [2175 bp, 724 aa] {...    34   2.8  
Suva_5.280 Chr5 complement(441123..443840) [2718 bp, 905 aa] {ON...    34   2.9  
YER144C Chr5 complement(457806..460223) [2418 bp, 805 aa] {ON}  ...    34   3.2  
KNAG0G02930 Chr7 (644555..645934) [1380 bp, 459 aa] {ON} Anc_8.7...    34   3.3  
Skud_2.177 Chr2 complement(322000..324348) [2349 bp, 782 aa] {ON...    34   3.4  
NDAI0A03680 Chr1 (837931..841281) [3351 bp, 1116 aa] {ON}              33   4.2  
KAFR0B02370 Chr2 complement(460558..463047) [2490 bp, 829 aa] {O...    33   4.7  
KAFR0H00150 Chr8 (14149..16119) [1971 bp, 656 aa] {ON} Anc_5.712...    33   5.1  
Kwal_26.9151 s26 complement(1095026..1096390) [1365 bp, 454 aa] ...    33   5.4  
TPHA0K00240 Chr11 (39455..39889,39976..40065) [525 bp, 174 aa] {...    32   5.9  
CAGL0I06765g Chr9 (655806..658469) [2664 bp, 887 aa] {ON} simila...    33   6.2  
Ecym_5544 Chr5 (1102256..1104760) [2505 bp, 834 aa] {ON} similar...    33   6.3  
SAKL0H04994g Chr8 complement(445232..446596) [1365 bp, 454 aa] {...    33   6.9  
CAGL0H05335g Chr8 complement(512683..514134) [1452 bp, 483 aa] {...    33   7.0  
YKR098C Chr11 complement(633026..635179) [2154 bp, 717 aa] {ON} ...    33   7.2  
TBLA0E02570 Chr5 complement(646995..649352) [2358 bp, 785 aa] {O...    33   7.4  
NCAS0I01620 Chr9 complement(299269..301656) [2388 bp, 795 aa] {O...    33   7.4  
Ecym_6248 Chr6 (468203..469603) [1401 bp, 466 aa] {ON} similar t...    33   7.6  
KLTH0E04356g Chr5 complement(394583..395791,395863..395877) [122...    32   7.6  
NDAI0C05900 Chr3 complement(1350639..1353119) [2481 bp, 826 aa] ...    33   7.7  
AGR139C Chr7 complement(1010460..1012829) [2370 bp, 789 aa] {ON}...    33   7.9  
TPHA0D04350 Chr4 complement(934597..937161) [2565 bp, 854 aa] {O...    33   8.1  
Kwal_14.2008 s14 (571638..572912) [1275 bp, 424 aa] {ON} YDR069C...    32   8.1  
TBLA0F03610 Chr6 (890140..893574) [3435 bp, 1144 aa] {ON} Anc_8....    33   8.3  
Suva_11.335 Chr11 complement(617850..620024) [2175 bp, 724 aa] {...    33   8.5  
ZYRO0B11044g Chr2 complement(869260..871740) [2481 bp, 826 aa] {...    32   9.0  

>Smik_15.301 Chr15 complement(515941..519759) [3819 bp, 1272 aa] {ON}
            YOR124C (REAL)
          Length = 1272

 Score = 2623 bits (6799), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1272/1272 (100%), Positives = 1272/1272 (100%)

Query: 1    MANEDRELQNAIEDHQSEPSNQDKNNSASNGAVIEECPLYETSASHQSAPVDFDDGKHLL 60
            MANEDRELQNAIEDHQSEPSNQDKNNSASNGAVIEECPLYETSASHQSAPVDFDDGKHLL
Sbjct: 1    MANEDRELQNAIEDHQSEPSNQDKNNSASNGAVIEECPLYETSASHQSAPVDFDDGKHLL 60

Query: 61   YPDIATSLPLKTSDRLLDDILCDTIFLNSTDPSVIEKGLQTTGILRESMLSYSSFRSSIR 120
            YPDIATSLPLKTSDRLLDDILCDTIFLNSTDPSVIEKGLQTTGILRESMLSYSSFRSSIR
Sbjct: 61   YPDIATSLPLKTSDRLLDDILCDTIFLNSTDPSVIEKGLQTTGILRESMLSYSSFRSSIR 120

Query: 121  PNALGSVTDQVVIQTKIEYDSYSCPKYNKIHVFQAVILNPSLTEQHVSSFDDIVKIPIYH 180
            PNALGSVTDQVVIQTKIEYDSYSCPKYNKIHVFQAVILNPSLTEQHVSSFDDIVKIPIYH
Sbjct: 121  PNALGSVTDQVVIQTKIEYDSYSCPKYNKIHVFQAVILNPSLTEQHVSSFDDIVKIPIYH 180

Query: 181  LKVTVKIRQELERLKKHVGVTQFHSIDFLHEYDRVDFSTFDSSDPNLMDYGIYVSDDTNK 240
            LKVTVKIRQELERLKKHVGVTQFHSIDFLHEYDRVDFSTFDSSDPNLMDYGIYVSDDTNK
Sbjct: 181  LKVTVKIRQELERLKKHVGVTQFHSIDFLHEYDRVDFSTFDSSDPNLMDYGIYVSDDTNK 240

Query: 241  LILIEIFKPEFDSPEEHESFTINAIKRRYSDMCLNNESLDKNNTPSQADCFYTLFKIFKG 300
            LILIEIFKPEFDSPEEHESFTINAIKRRYSDMCLNNESLDKNNTPSQADCFYTLFKIFKG
Sbjct: 241  LILIEIFKPEFDSPEEHESFTINAIKRRYSDMCLNNESLDKNNTPSQADCFYTLFKIFKG 300

Query: 301  PLTRKSKTEPVKTIDSGNLALNTHLNPEWLTSKYGFQVSSEIDEETNERFTEYLPPDMVD 360
            PLTRKSKTEPVKTIDSGNLALNTHLNPEWLTSKYGFQVSSEIDEETNERFTEYLPPDMVD
Sbjct: 301  PLTRKSKTEPVKTIDSGNLALNTHLNPEWLTSKYGFQVSSEIDEETNERFTEYLPPDMVD 360

Query: 361  YVDDLKVRKIRESFVRKCLQLLFWGQLSTSLLAPNSPLKNTKSVKGLSCLQTSFSSLPWF 420
            YVDDLKVRKIRESFVRKCLQLLFWGQLSTSLLAPNSPLKNTKSVKGLSCLQTSFSSLPWF
Sbjct: 361  YVDDLKVRKIRESFVRKCLQLLFWGQLSTSLLAPNSPLKNTKSVKGLSCLQTSFSSLPWF 420

Query: 421  HLLGESRSRILLNSNESHSPLDAEPHFVNLSVSHYYTDRDIIRNYESLSSLDPKNIGLYF 480
            HLLGESRSRILLNSNESHSPLDAEPHFVNLSVSHYYTDRDIIRNYESLSSLDPKNIGLYF
Sbjct: 421  HLLGESRSRILLNSNESHSPLDAEPHFVNLSVSHYYTDRDIIRNYESLSSLDPKNIGLYF 480

Query: 481  DALTYIANRKGAYQLIAYCGKQDIIGQEALENALLVFKIEPKECNIAELNEATLLSIYKF 540
            DALTYIANRKGAYQLIAYCGKQDIIGQEALENALLVFKIEPKECNIAELNEATLLSIYKF
Sbjct: 481  DALTYIANRKGAYQLIAYCGKQDIIGQEALENALLVFKIEPKECNIAELNEATLLSIYKF 540

Query: 541  ETSNKSQVTSGHLTNLKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDTLSIDESVDED 600
            ETSNKSQVTSGHLTNLKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDTLSIDESVDED
Sbjct: 541  ETSNKSQVTSGHLTNLKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDTLSIDESVDED 600

Query: 601  IIKTAYSVKINDSPGLKLDCDRALYTIAISKKSLDLFNFLTDECPQFLTYYGAEQLDYQE 660
            IIKTAYSVKINDSPGLKLDCDRALYTIAISKKSLDLFNFLTDECPQFLTYYGAEQLDYQE
Sbjct: 601  IIKTAYSVKINDSPGLKLDCDRALYTIAISKKSLDLFNFLTDECPQFLTYYGAEQLDYQE 660

Query: 661  ALKLLQVNENASDETILKIFKQKWFDESVYEPDQFLTLKAALTKISIERNSNLISNFLLT 720
            ALKLLQVNENASDETILKIFKQKWFDESVYEPDQFLTLKAALTKISIERNSNLISNFLLT
Sbjct: 661  ALKLLQVNENASDETILKIFKQKWFDESVYEPDQFLTLKAALTKISIERNSNLISNFLLT 720

Query: 721  GTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYILDYQKTVENFNDHLSNS 780
            GTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYILDYQKTVENFNDHLSNS
Sbjct: 721  GTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYILDYQKTVENFNDHLSNS 780

Query: 781  GHVRRIGGRKISKGEVERSVQFIYQLRNLFYAMVHSRERCVTPSKELAYLAFAPSNIEVE 840
            GHVRRIGGRKISKGEVERSVQFIYQLRNLFYAMVHSRERCVTPSKELAYLAFAPSNIEVE
Sbjct: 781  GHVRRIGGRKISKGEVERSVQFIYQLRNLFYAMVHSRERCVTPSKELAYLAFAPSNIEVE 840

Query: 841  FEVEGNKPADGAAIPIGLKEEATQESCTTKENDPKSIGSKMEDNTNRDTHRNPSNTEKNE 900
            FEVEGNKPADGAAIPIGLKEEATQESCTTKENDPKSIGSKMEDNTNRDTHRNPSNTEKNE
Sbjct: 841  FEVEGNKPADGAAIPIGLKEEATQESCTTKENDPKSIGSKMEDNTNRDTHRNPSNTEKNE 900

Query: 901  PNNVQIVGGDDTTDLNSLTRVAKISSDQLENALEMGRQQDVTECIGNVLFQIESGSEPIK 960
            PNNVQIVGGDDTTDLNSLTRVAKISSDQLENALEMGRQQDVTECIGNVLFQIESGSEPIK
Sbjct: 901  PNNVQIVGGDDTTDLNSLTRVAKISSDQLENALEMGRQQDVTECIGNVLFQIESGSEPIK 960

Query: 961  YDEDNEQYDLVKQLFYGTTKQSIVPLSATNKVRTKVERFLSLLINIGDHPKDIYDAFDSY 1020
            YDEDNEQYDLVKQLFYGTTKQSIVPLSATNKVRTKVERFLSLLINIGDHPKDIYDAFDSY
Sbjct: 961  YDEDNEQYDLVKQLFYGTTKQSIVPLSATNKVRTKVERFLSLLINIGDHPKDIYDAFDSY 1020

Query: 1021 FKDEYLTMEEYGDVTRTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKEVIYMDR 1080
            FKDEYLTMEEYGDVTRTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKEVIYMDR
Sbjct: 1021 FKDEYLTMEEYGDVTRTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKEVIYMDR 1080

Query: 1081 YADTENPLLLAKKNETEEMKQKLRVMKNRQRELLSRDNSGLTRKDAFLESIKLLESSVVE 1140
            YADTENPLLLAKKNETEEMKQKLRVMKNRQRELLSRDNSGLTRKDAFLESIKLLESSVVE
Sbjct: 1081 YADTENPLLLAKKNETEEMKQKLRVMKNRQRELLSRDNSGLTRKDAFLESIKLLESSVVE 1140

Query: 1141 KTTLKTEVKIDVINTLRTNVNNIDNELMSLYNNINNLEEKISHQFDDFKEYGYSLFSVFI 1200
            KTTLKTEVKIDVINTLRTNVNNIDNELMSLYNNINNLEEKISHQFDDFKEYGYSLFSVFI
Sbjct: 1141 KTTLKTEVKIDVINTLRTNVNNIDNELMSLYNNINNLEEKISHQFDDFKEYGYSLFSVFI 1200

Query: 1201 HRGEASYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNFNEGNTATPYFLVYVKQGQ 1260
            HRGEASYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNFNEGNTATPYFLVYVKQGQ
Sbjct: 1201 HRGEASYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNFNEGNTATPYFLVYVKQGQ 1260

Query: 1261 EADIEPLKRILQ 1272
            EADIEPLKRILQ
Sbjct: 1261 EADIEPLKRILQ 1272

>YOR124C Chr15 complement(554824..558642) [3819 bp, 1272 aa] {ON}
            UBP2Ubiquitin-specific protease that removes ubiquitin
            from ubiquitinated proteins; interacts with Rsp5p and is
            required for MVB sorting of membrane proteins; can cleave
            polyubiquitin and has isopeptidase activity
          Length = 1272

 Score = 2281 bits (5911), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1100/1273 (86%), Positives = 1176/1273 (92%), Gaps = 2/1273 (0%)

Query: 1    MANEDRELQNAIEDHQSEPSNQDKNNSASNGAVIEECPLYETSASHQSAPVDFDDGKHLL 60
            M NED ELQ AIE+H ++  NQDK N+  NG+VIE+ PLY TS + QS P D DDGKHLL
Sbjct: 1    MPNEDNELQKAIENHHNQLLNQDKENADRNGSVIEDLPLYGTSINQQSTPGDVDDGKHLL 60

Query: 61   YPDIATSLPLKTSDRLLDDILCDTIFLNSTDPSVIEKGLQTTGILRESMLSYSSFRSSIR 120
            YPDIAT+LPLKTSDRLLDDILCDTIFLNSTDP V++KGLQ+ GIL+ESMLSYS+FRSSIR
Sbjct: 61   YPDIATNLPLKTSDRLLDDILCDTIFLNSTDPKVMQKGLQSRGILKESMLSYSTFRSSIR 120

Query: 121  PNALGSVTDQVVIQTKIEYDSYSCPKYNKIHVFQAVILNPSLTEQHVSSFDDIVKIPIYH 180
            PN LGS+TDQVV QTK EYDS SCPKYNKIHVFQAVI NPSL EQ +S+FDDIVKIPIYH
Sbjct: 121  PNCLGSLTDQVVFQTKSEYDSISCPKYNKIHVFQAVIFNPSLAEQQISTFDDIVKIPIYH 180

Query: 181  LKVTVKIRQELERLKKHVGVTQFHSIDFLHEYDRVDFSTFDSSDPNLMDYGIYVSDDTNK 240
            LKV+VK+RQELERLKKHVGVTQFHS+D LHEYDRVD STFDSSDPNL+DYGIYVSDDTNK
Sbjct: 181  LKVSVKVRQELERLKKHVGVTQFHSLDHLHEYDRVDLSTFDSSDPNLLDYGIYVSDDTNK 240

Query: 241  LILIEIFKPEFDSPEEHESFTINAIKRRYSDMCLNNESLDKNNTPSQADCFYTLFKIFKG 300
            LILIEIFKPEF+SPEEHESFT +AIK+RY+ MC+ NESLDK+ TPSQ DCFYTLFKIFKG
Sbjct: 241  LILIEIFKPEFNSPEEHESFTADAIKKRYNAMCVKNESLDKSETPSQVDCFYTLFKIFKG 300

Query: 301  PLTRKSKTEPVKTIDSGNLALNTHLNPEWLTSKYGFQVSSEIDEETNERFTEYLPPDMVD 360
            PLTRKSK EP KTIDSGNLALNTHLNPEWLTSKYGFQ SSEIDEETNE FTEY+PPDMVD
Sbjct: 301  PLTRKSKAEPTKTIDSGNLALNTHLNPEWLTSKYGFQASSEIDEETNEIFTEYVPPDMVD 360

Query: 361  YVDDLKVRKIRESFVRKCLQLLFWGQLSTSLLAPNSPLKNTKSVKGLSCLQTSFSSLPWF 420
            YV+DL+ RKIRESFVRKCLQL+FWGQLSTSLLAPNSPLKNTKSVKG+S LQTSFS+LPWF
Sbjct: 361  YVNDLETRKIRESFVRKCLQLIFWGQLSTSLLAPNSPLKNTKSVKGMSSLQTSFSTLPWF 420

Query: 421  HLLGESRSRILLNSNE-SHSPLDAEPHFVNLSVSHYYTDRDIIRNYESLSSLDPKNIGLY 479
            HLLGESR+RILLNSNE +HSPLDAEPHF+NLSVSHYYTDRDIIRNYESLSSLDP+NIGLY
Sbjct: 421  HLLGESRARILLNSNEQTHSPLDAEPHFINLSVSHYYTDRDIIRNYESLSSLDPENIGLY 480

Query: 480  FDALTYIANRKGAYQLIAYCGKQDIIGQEALENALLVFKIEPKECNIAELNEATLLSIYK 539
            FDALTYIANRKGAYQLIAYCGKQDIIGQEALENALL+FKI PKECNI+ELNEATLLSIYK
Sbjct: 481  FDALTYIANRKGAYQLIAYCGKQDIIGQEALENALLMFKINPKECNISELNEATLLSIYK 540

Query: 540  FETSNKSQVTSGHLTNLKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDTLSIDESVDE 599
            +ETSNKSQVTS HLTNLKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDTLSIDESVDE
Sbjct: 541  YETSNKSQVTSNHLTNLKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDTLSIDESVDE 600

Query: 600  DIIKTAYSVKINDSPGLKLDCDRALYTIAISKKSLDLFNFLTDECPQFLTYYGAEQLDYQ 659
            DIIKTAYSVKINDSPGLKLDCDRALYTIAISK+SLDLFNFLT+ECPQF  YYG E+LDYQ
Sbjct: 601  DIIKTAYSVKINDSPGLKLDCDRALYTIAISKRSLDLFNFLTEECPQFSNYYGPEKLDYQ 660

Query: 660  EALKLLQVNENASDETILKIFKQKWFDESVYEPDQFLTLKAALTKISIERNSNLISNFLL 719
            EALKLLQVNENASDETILKIFKQKWFDE+VYEPDQFL L+AALTKISIERNS LI+NFLL
Sbjct: 661  EALKLLQVNENASDETILKIFKQKWFDENVYEPDQFLILRAALTKISIERNSTLITNFLL 720

Query: 720  TGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYILDYQKTVENFNDHLSN 779
            TGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRY+L+YQKTVENFNDHLSN
Sbjct: 721  TGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYVLEYQKTVENFNDHLSN 780

Query: 780  SGHVRRIGGRKISKGEVERSVQFIYQLRNLFYAMVHSRERCVTPSKELAYLAFAPSNIEV 839
            SGH+RRIGGR+IS+GEVERS+QFIYQLRNLFYAMVH+RERCVTPSKELAYLAFAPSN+EV
Sbjct: 781  SGHIRRIGGREISRGEVERSIQFIYQLRNLFYAMVHTRERCVTPSKELAYLAFAPSNVEV 840

Query: 840  EFEVEGNKPADGAAIPIGLKEEATQESCTTKENDPKSIGSKMEDNTNRDTHRNPSNTEKN 899
            EFEVEGNK  D   +    K+E T ++ TTK  D   I  +MED  N D   + +N +KN
Sbjct: 841  EFEVEGNKVVDQTGVLSDSKKETTDDAFTTKIKDTSLIDLEMEDGLNGDVGTD-ANRKKN 899

Query: 900  EPNNVQIVGGDDTTDLNSLTRVAKISSDQLENALEMGRQQDVTECIGNVLFQIESGSEPI 959
            E N+ ++   +DTT L S TRVAKISSDQLENALEMGRQQDVTECIGNVLFQIESGSEPI
Sbjct: 900  ESNDAEVSENEDTTGLTSPTRVAKISSDQLENALEMGRQQDVTECIGNVLFQIESGSEPI 959

Query: 960  KYDEDNEQYDLVKQLFYGTTKQSIVPLSATNKVRTKVERFLSLLINIGDHPKDIYDAFDS 1019
            +YDEDNEQYDLVKQLFYGTTKQSIVPLSATNKVRTKVERFLSLLINIGDHPKDIYDAFDS
Sbjct: 960  RYDEDNEQYDLVKQLFYGTTKQSIVPLSATNKVRTKVERFLSLLINIGDHPKDIYDAFDS 1019

Query: 1020 YFKDEYLTMEEYGDVTRTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKEVIYMD 1079
            YFKDEYLTMEEYGDV RTVAVTTFPTILQVQIQRVYYDRER MPFKSIEPLPFKEVIYMD
Sbjct: 1020 YFKDEYLTMEEYGDVIRTVAVTTFPTILQVQIQRVYYDRERLMPFKSIEPLPFKEVIYMD 1079

Query: 1080 RYADTENPLLLAKKNETEEMKQKLRVMKNRQRELLSRDNSGLTRKDAFLESIKLLESSVV 1139
            RYADTENPLLLAKK ETEEMKQKL+VMKNRQRELLSRD+SGLTRKDAFLESIKLLES  +
Sbjct: 1080 RYADTENPLLLAKKKETEEMKQKLKVMKNRQRELLSRDDSGLTRKDAFLESIKLLESDTI 1139

Query: 1140 EKTTLKTEVKIDVINTLRTNVNNIDNELMSLYNNINNLEEKISHQFDDFKEYGYSLFSVF 1199
            +KT LK E   DVI TLR NV NIDNELM LYN+IN+LEEKISHQFDDFKEYGYSLFSVF
Sbjct: 1140 KKTPLKIEAANDVIKTLRNNVQNIDNELMKLYNDINSLEEKISHQFDDFKEYGYSLFSVF 1199

Query: 1200 IHRGEASYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNFNEGNTATPYFLVYVKQG 1259
            IHRGEASYGHYWIYIKDRN NG+WRKYNDET+SEVQE+EVFNFNEGNTATPYFLVYVKQG
Sbjct: 1200 IHRGEASYGHYWIYIKDRNRNGIWRKYNDETISEVQEEEVFNFNEGNTATPYFLVYVKQG 1259

Query: 1260 QEADIEPLKRILQ 1272
            QE DIEPLKRIL+
Sbjct: 1260 QEGDIEPLKRILK 1272

>Skud_15.286 Chr15 complement(511346..515182) [3837 bp, 1278 aa] {ON}
            YOR124C (REAL)
          Length = 1278

 Score = 2235 bits (5792), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1083/1278 (84%), Positives = 1172/1278 (91%), Gaps = 6/1278 (0%)

Query: 1    MANEDRELQNAIEDHQSEPSNQDKNNSASNGAVIEECPLYETSASHQSAPVDFDDGKHLL 60
            M  ED ELQ AIE HQS+ SNQ+KNN+ ++   I++ PLY T AS QSAPV  DDGKHLL
Sbjct: 1    MPYEDNELQTAIEGHQSQLSNQEKNNTPNDDTFIDDSPLYGTRASLQSAPVAVDDGKHLL 60

Query: 61   YPDIATSLPLKTSDRLLDDILCDTIFLNSTDPSVIEKGLQTTGILRESMLSYSSFRSSIR 120
            YPDIATSLPLKTSDRLLDD+LCDTIFLNSTDP+VIEKGLQT+GILRESMLSYSSFRSSIR
Sbjct: 61   YPDIATSLPLKTSDRLLDDVLCDTIFLNSTDPNVIEKGLQTSGILRESMLSYSSFRSSIR 120

Query: 121  PNALGSVTDQVVIQTKIEYDSYSCPKYNKIHVFQAVILNPSLTEQHVSSFDDIVKIPIYH 180
            PNALGS+TDQV IQTK EYDS SCP+YNKI+VFQAVILNPSL+EQ +SSFDDIV+IPIYH
Sbjct: 121  PNALGSLTDQVTIQTKTEYDSISCPRYNKIYVFQAVILNPSLSEQQISSFDDIVRIPIYH 180

Query: 181  LKVTVKIRQELERLKKHVGVTQFHSIDFLHEYDRVDFSTFDSSDPNLMDYGIYVSDDTNK 240
            LKVTVKIRQELERLKKHVGVTQFHS+D LHEYDRVD STFDSSDP LMDYGIYVSDDTNK
Sbjct: 181  LKVTVKIRQELERLKKHVGVTQFHSLDHLHEYDRVDLSTFDSSDPKLMDYGIYVSDDTNK 240

Query: 241  LILIEIFKPEFDSPEEHESFTINAIKRRYSDMCLNNESLDKNNTPSQADCFYTLFKIFKG 300
            LILIEIF+PEF+SPEEHESFT +AIK+RY+D+CL NESL+K   PSQ DCFYTLFKIFKG
Sbjct: 241  LILIEIFQPEFNSPEEHESFTTDAIKKRYNDLCLKNESLNKKEAPSQPDCFYTLFKIFKG 300

Query: 301  PLTRKSKTEPVKTIDSGNLALNTHLNPEWLTSKYGFQVSSEIDEETNERFTEYLPPDMVD 360
            PLTRKSK EP+KTIDSGNL LNTHLN EWLTSKYGFQ SSEIDEETN+ FTEY+PPDMV 
Sbjct: 301  PLTRKSKEEPIKTIDSGNLVLNTHLNAEWLTSKYGFQASSEIDEETNDPFTEYVPPDMVG 360

Query: 361  YVDDLKVRKIRESFVRKCLQLLFWGQLSTSLLAPNSPLKNTKSVKGLSCLQTSFSSLPWF 420
            YV D   RKIRESFV+KCLQL+FWGQLS SLL PNS LKNTKSVKGLS LQTSFS+ PWF
Sbjct: 361  YVGDWNKRKIRESFVKKCLQLIFWGQLSASLLTPNSSLKNTKSVKGLSSLQTSFSTSPWF 420

Query: 421  HLLGESRSRILLNSNE-SHSPLDAEPHFVNLSVSHYYTDRDIIRNYESLSSLDPKNIGLY 479
            HLLGESR+RILLNSNE +HSPLDAE HF+NLSVSHYYTDRDIIRNYE+LSSLDP NIGLY
Sbjct: 421  HLLGESRARILLNSNEQAHSPLDAEQHFINLSVSHYYTDRDIIRNYEALSSLDPDNIGLY 480

Query: 480  FDALTYIANRKGAYQLIAYCGKQDIIGQEALENALLVFKIEPKECNIAELNEATLLSIYK 539
            FDALTYIANRKGAYQLIAYCGKQ+IIGQEALENAL+ FKI+PKE NIAELNEATLLSIYK
Sbjct: 481  FDALTYIANRKGAYQLIAYCGKQNIIGQEALENALVTFKIDPKEFNIAELNEATLLSIYK 540

Query: 540  FETSNKSQVTSGHLTNLKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDTLSIDESVDE 599
            FETSNKS+VTS HLTN KNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDTLSIDESVDE
Sbjct: 541  FETSNKSKVTSNHLTNFKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDTLSIDESVDE 600

Query: 600  DIIKTAYSVKINDSPGLKLDCDRALYTIAISKKSLDLFNFLTDECPQFLTYYGAEQLDYQ 659
            DIIKTAYS+KINDSPGLKLDCDRALYTIAISK+SLDLFNFLTDECPQFL YYG E+L YQ
Sbjct: 601  DIIKTAYSIKINDSPGLKLDCDRALYTIAISKRSLDLFNFLTDECPQFLKYYGPEKLHYQ 660

Query: 660  EALKLLQVNENASDETILKIFKQKWFDESVYEPDQFLTLKAALTKISIERNSNLISNFLL 719
            EALKLLQVNENASDET+LKIFKQKW+DESV+EPDQFL L+AALT+ISIERNSNLI+NFLL
Sbjct: 661  EALKLLQVNENASDETVLKIFKQKWYDESVFEPDQFLILRAALTRISIERNSNLITNFLL 720

Query: 720  TGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYILDYQKTVENFNDHLSN 779
            TGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYIL+YQKT++NFNDHLSN
Sbjct: 721  TGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYILEYQKTLDNFNDHLSN 780

Query: 780  SGHVRRIGGRKISKGEVERSVQFIYQLRNLFYAMVHSRERCVTPSKELAYLAFAPSNIEV 839
            SGHVRRIGGR+IS+GEVERS+QFIYQLRNLFYAMVHSRERCVTPSKELAYLAFAPSN+EV
Sbjct: 781  SGHVRRIGGREISRGEVERSIQFIYQLRNLFYAMVHSRERCVTPSKELAYLAFAPSNVEV 840

Query: 840  EFEVEGNK-PADGAAIPIGLKEEATQESCTT-KENDPKSIGSKMEDNTNRDTHRNPSNT- 896
            EFEVEGNK  ++GAAI    K E TQE+ TT +E DP  I  +MED TN D  ++  N  
Sbjct: 841  EFEVEGNKVGSNGAAISADSKGEVTQEAATTSEEKDPSLIDLEMEDKTNSDVDKDIENVK 900

Query: 897  --EKNEPNNVQIVGGDDTTDLNSLTRVAKISSDQLENALEMGRQQDVTECIGNVLFQIES 954
              E NE N+++I  G++ TDL S TRVAKI SDQLENALEMGRQQDVTECIGNVLFQIES
Sbjct: 901  ANEANEANDIEITVGENITDLASPTRVAKIGSDQLENALEMGRQQDVTECIGNVLFQIES 960

Query: 955  GSEPIKYDEDNEQYDLVKQLFYGTTKQSIVPLSATNKVRTKVERFLSLLINIGDHPKDIY 1014
            GSEPI+YDEDNEQYDL+KQLFYGTTKQSIVPLSAT+KVRTKVERFLSLL+NIGDHPKDIY
Sbjct: 961  GSEPIRYDEDNEQYDLIKQLFYGTTKQSIVPLSATDKVRTKVERFLSLLVNIGDHPKDIY 1020

Query: 1015 DAFDSYFKDEYLTMEEYGDVTRTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKE 1074
            DAFDSYFKDEYLTMEEYGDV RTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKE
Sbjct: 1021 DAFDSYFKDEYLTMEEYGDVKRTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKE 1080

Query: 1075 VIYMDRYADTENPLLLAKKNETEEMKQKLRVMKNRQRELLSRDNSGLTRKDAFLESIKLL 1134
            VIYMDRY+DTENPLLLAKK ETE+MKQ L+VMKNRQRELL RD SGLTRKDAFLESIKLL
Sbjct: 1081 VIYMDRYSDTENPLLLAKKEETEQMKQNLKVMKNRQRELLDRDESGLTRKDAFLESIKLL 1140

Query: 1135 ESSVVEKTTLKTEVKIDVINTLRTNVNNIDNELMSLYNNINNLEEKISHQFDDFKEYGYS 1194
            ES++V      +E   DVI  L++N+ +IDNELMSLYN+IN+LE+KISHQFDDF+EYGYS
Sbjct: 1141 ESNIVVTEASNSEDNKDVIRILKSNIIDIDNELMSLYNDINSLEDKISHQFDDFEEYGYS 1200

Query: 1195 LFSVFIHRGEASYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNFNEGNTATPYFLV 1254
            LFSVFIHRGEASYGHYWIYIKDRN+ GVWRKYNDET+SEVQE+EVFNFNEGNTATPYFLV
Sbjct: 1201 LFSVFIHRGEASYGHYWIYIKDRNYGGVWRKYNDETISEVQEEEVFNFNEGNTATPYFLV 1260

Query: 1255 YVKQGQEADIEPLKRILQ 1272
            YVKQGQE+DIEPLKRIL+
Sbjct: 1261 YVKQGQESDIEPLKRILE 1278

>Suva_8.176 Chr8 complement(312595..316407) [3813 bp, 1270 aa] {ON}
            YOR124C (REAL)
          Length = 1270

 Score = 2186 bits (5664), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1056/1273 (82%), Positives = 1153/1273 (90%), Gaps = 4/1273 (0%)

Query: 1    MANEDRELQNAIEDHQSEPSNQDKNNSASNGAVIEECPLYETSASHQSAPVDFDDGKHLL 60
            M NED ELQNAIE  Q+  SN +K ++  N   I++CPLYE SAS QS   D DDGKHLL
Sbjct: 1    MPNEDNELQNAIEGDQNILSNHEKGHTVDNTTSIDDCPLYEASASQQSTRADVDDGKHLL 60

Query: 61   YPDIATSLPLKTSDRLLDDILCDTIFLNSTDPSVIEKGLQTTGILRESMLSYSSFRSSIR 120
            YPDIAT LPLKTSDRLLDDILCDT F NSTDPSVIE+GLQT+GIL++SMLSYS+FRS IR
Sbjct: 61   YPDIATYLPLKTSDRLLDDILCDTAFFNSTDPSVIERGLQTSGILKKSMLSYSNFRSRIR 120

Query: 121  PNALGSVTDQVVIQTKIEYDSYSCPKYNKIHVFQAVILNPSLTEQHVSSFDDIVKIPIYH 180
            P+ALGS+TDQVV+QTK EYDS SCP+YNKI V QAVI NPSL EQ +++FDDIVKIPIYH
Sbjct: 121  PDALGSLTDQVVLQTKTEYDSISCPQYNKIQVLQAVIFNPSLPEQQIAAFDDIVKIPIYH 180

Query: 181  LKVTVKIRQELERLKKHVGVTQFHSIDFLHEYDRVDFSTFDSSDPNLMDYGIYVSDDTNK 240
            LKVTVKIRQELERLKKHVGVTQFH++D LHEYD  D STFDSSDPNL DYGIYVSDDTNK
Sbjct: 181  LKVTVKIRQELERLKKHVGVTQFHALDHLHEYDLADLSTFDSSDPNLKDYGIYVSDDTNK 240

Query: 241  LILIEIFKPEFDSPEEHESFTINAIKRRYSDMCLNNESLDKNNTPSQADCFYTLFKIFKG 300
            LILIEIF PEFDSPEE +SFT  AI++RY+D+CL NESL++N TPSQ DCFYTLFKIFKG
Sbjct: 241  LILIEIFNPEFDSPEERDSFTTAAIQKRYNDVCLKNESLNENETPSQPDCFYTLFKIFKG 300

Query: 301  PLTRKSKTEPVKTIDSGNLALNTHLNPEWLTSKYGFQVSSEIDEETNERFTEYLPPDMVD 360
            PL RKS  +P+KTIDSGN+ LNTHLNPEWLTSKYGFQ SSEIDEETNE FTEY+PPDMVD
Sbjct: 301  PLARKSTADPIKTIDSGNIVLNTHLNPEWLTSKYGFQASSEIDEETNESFTEYVPPDMVD 360

Query: 361  YVDDLKVRKIRESFVRKCLQLLFWGQLSTSLLAPNSPLKNTKSVKGLSCLQTSFSSLPWF 420
            YV D K+RKIRES+VRKCLQL+FWGQLS SLLAPNS LKNTKSVKGLS +QTSFS LPWF
Sbjct: 361  YVGDWKIRKIRESYVRKCLQLIFWGQLSASLLAPNSLLKNTKSVKGLSSIQTSFSILPWF 420

Query: 421  HLLGESRSRILLNSNE-SHSPLDAEPHFVNLSVSHYYTDRDIIRNYESLSSLDPKNIGLY 479
             LLGESR+RILLN NE +HSPLDAEPHF+NLSVSHYYTDRDIIRNYE+LSSLDP+NIGLY
Sbjct: 421  QLLGESRARILLNFNEQAHSPLDAEPHFINLSVSHYYTDRDIIRNYEALSSLDPENIGLY 480

Query: 480  FDALTYIANRKGAYQLIAYCGKQDIIGQEALENALLVFKIEPKECNIAELNEATLLSIYK 539
            FDALTYIANRKGAYQ+IAYCGKQDIIGQEALENAL+VFKI+PK+ +IAELNEATLLSIYK
Sbjct: 481  FDALTYIANRKGAYQIIAYCGKQDIIGQEALENALMVFKIDPKDYDIAELNEATLLSIYK 540

Query: 540  FETSNKSQVTSGHLTNLKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDTLSIDESVDE 599
            FETSNK++  S HLTNLKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDTL+IDESVDE
Sbjct: 541  FETSNKNKAASNHLTNLKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDTLAIDESVDE 600

Query: 600  DIIKTAYSVKINDSPGLKLDCDRALYTIAISKKSLDLFNFLTDECPQFLTYYGAEQLDYQ 659
            DIIKTAYS+KINDSPGLKLDCDRALYTIAISK+SLDLFNFLTDECPQF  YYG E+LDYQ
Sbjct: 601  DIIKTAYSIKINDSPGLKLDCDRALYTIAISKRSLDLFNFLTDECPQFQNYYGPEKLDYQ 660

Query: 660  EALKLLQVNENASDETILKIFKQKWFDESVYEPDQFLTLKAALTKISIERNSNLISNFLL 719
            EALKLLQVNENASDETILKIFK KWFDE+VYEPDQFL LKAALTKISIERNSNLI+NFLL
Sbjct: 661  EALKLLQVNENASDETILKIFKGKWFDENVYEPDQFLILKAALTKISIERNSNLITNFLL 720

Query: 720  TGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYILDYQKTVENFNDHLSN 779
            TGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLR YIL+YQKT+ NFNDHLSN
Sbjct: 721  TGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRSYILNYQKTLNNFNDHLSN 780

Query: 780  SGHVRRIGGRKISKGEVERSVQFIYQLRNLFYAMVHSRERCVTPSKELAYLAFAPSNIEV 839
            S HVRR+GGR+IS+GEVERS+QFI+QLRNLFYAMVHSRERCVTPSKELAYLAFAPSN+EV
Sbjct: 781  SEHVRRVGGREISEGEVERSIQFIHQLRNLFYAMVHSRERCVTPSKELAYLAFAPSNVEV 840

Query: 840  EFEVEGNKPADGAAIPIGLKEEATQESCTTKENDPKSIGSKMEDNTNRDTHRNPSNTEKN 899
            EFEVEGNK ++ A I   LKEE T  +    E DP  I  ++++NTN D  ++ +N EK 
Sbjct: 841  EFEVEGNKESNDATI---LKEEETGGANAINEQDPILIDFEVDENTNGDVEKDENNHEKT 897

Query: 900  EPNNVQIVGGDDTTDLNSLTRVAKISSDQLENALEMGRQQDVTECIGNVLFQIESGSEPI 959
            E N+V+I+  DD TDL S TRVAKISSDQLENALEMGRQQDVTECIGNVLFQIESGSEPI
Sbjct: 898  ESNDVEIIMTDDATDLASPTRVAKISSDQLENALEMGRQQDVTECIGNVLFQIESGSEPI 957

Query: 960  KYDEDNEQYDLVKQLFYGTTKQSIVPLSATNKVRTKVERFLSLLINIGDHPKDIYDAFDS 1019
            +YDEDNEQYDL+KQLFYGTTKQ IVPLSAT+KVRTKVERFLSLL+NIGDHPKDIYDAFDS
Sbjct: 958  RYDEDNEQYDLIKQLFYGTTKQCIVPLSATDKVRTKVERFLSLLVNIGDHPKDIYDAFDS 1017

Query: 1020 YFKDEYLTMEEYGDVTRTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKEVIYMD 1079
            YF+DEYLTM EYGDV RTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKEVIYMD
Sbjct: 1018 YFRDEYLTMAEYGDVKRTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKEVIYMD 1077

Query: 1080 RYADTENPLLLAKKNETEEMKQKLRVMKNRQRELLSRDNSGLTRKDAFLESIKLLESSVV 1139
            RYADT+N  LLAKK ETE++KQK + MKNRQRELL+RD SGLTRKDAFLE+IKLLESS+V
Sbjct: 1078 RYADTDNLTLLAKKEETEQLKQKSKDMKNRQRELLNRDGSGLTRKDAFLETIKLLESSIV 1137

Query: 1140 EKTTLKTEVKIDVINTLRTNVNNIDNELMSLYNNINNLEEKISHQFDDFKEYGYSLFSVF 1199
            E T L  E K ++I TL+  V +IDNELMSLY++IN+LE+KISHQFDDFKEYGYSLFSVF
Sbjct: 1138 ENTVLNIEDKKNLIKTLKNKVTDIDNELMSLYSDINSLEDKISHQFDDFKEYGYSLFSVF 1197

Query: 1200 IHRGEASYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNFNEGNTATPYFLVYVKQG 1259
            IHRGEASYGHYWIYIKDRN NGVWRKYNDET+SEV E+EVFNFNEGNTATPYFLVYVKQG
Sbjct: 1198 IHRGEASYGHYWIYIKDRNQNGVWRKYNDETISEVPEEEVFNFNEGNTATPYFLVYVKQG 1257

Query: 1260 QEADIEPLKRILQ 1272
            QEADIEPLKRIL+
Sbjct: 1258 QEADIEPLKRILE 1270

>ZYRO0G01606g Chr7 complement(123893..127810) [3918 bp, 1305 aa] {ON}
            similar to uniprot|Q01476 Saccharomyces cerevisiae
            YOR124C UBP2 Ubiquitin-specific protease that removes
            ubiquitin from ubiquitinated proteins cleaves at the C
            terminus of ubiquitin fusions capable of cleaving
            polyubiquitin and possesses isopeptidase activity
          Length = 1305

 Score = 1441 bits (3729), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 721/1260 (57%), Positives = 920/1260 (73%), Gaps = 56/1260 (4%)

Query: 54   DDGKHLLYPDIATSLPLKTSDRLLDDILCDTIFLNSTDPSVIEKGLQTTGILRESMLSYS 113
            D GK  LYP+ A   P KT+DRLLDDIL D  F+NS D S++   L + GIL+  +LSYS
Sbjct: 58   DSGKVPLYPEAAARFPFKTADRLLDDILHDLSFINSDDHSILYSDL-SNGILKSPVLSYS 116

Query: 114  SFRSSIRPNALGSVTDQVVIQTKIEYDSYSCPKYNKIHVFQAVILNPSLTEQHVSSFDDI 173
                  R   LGS+ DQVV+QTK EYDS SCP++N + VF  V+++  +T+Q+V++F+++
Sbjct: 117  RKVGKTRAYNLGSLVDQVVLQTKFEYDSVSCPQHNHLQVFMGVLID--VTQQNVATFNNL 174

Query: 174  VKIPIYHLKVTVKIRQELERLKKHVGVTQFHSIDF--LHEYDRVDFSTFDSSDPNLMDYG 231
              +PI+HLKVTVK R  LER KK  G+T +HS+D   +H YD+ D  TFDS DP L+DY 
Sbjct: 175  ATLPIFHLKVTVKTRDVLERTKKKAGITHYHSLDESEIHPYDKQDLLTFDSKDPQLLDYA 234

Query: 232  IYVSDDTNKLILIEIFKPEFDSPEEHESFTINAIKRRYSDMCLNNESLDKNNTPSQADCF 291
            IYVS D+NKLILIEIFKPEFDS EE ++F   +I  RY   C   +SLD    P+Q DC 
Sbjct: 235  IYVSSDSNKLILIEIFKPEFDSDEERDAFKEESINNRYEMACNRFDSLDPTRIPTQPDCI 294

Query: 292  YTLFKIFKGPLTRKSKTEPVKTIDSGNLALNTHLNPEWLTSKYGFQVSSEIDEETNERFT 351
             TLFKIFKGPL RKS  EP KTI+  N++LN+H++P WLTSKYGF++  E DEET E   
Sbjct: 295  NTLFKIFKGPLNRKSSEEPRKTINPNNVSLNSHIDPTWLTSKYGFELHVEKDEETGEDIL 354

Query: 352  EYLPPDMVDYVDDLKVRKIRESFVRKCLQLLFWGQLSTSLLAPNSPLKNTKSVKGLSCLQ 411
            EY PPD+ +Y  D KVR++RESF R+CL+L+F G++S  LL+  +  +N K  +  S +Q
Sbjct: 355  EYAPPDLTNYHRDWKVRRLRESFTRRCLELIFLGRVSIRLLSQEAVNRNPKVYRIFSMMQ 414

Query: 412  TSFSSLPWFHLLGESRSRILLNSNESHSPLDAEPHFVNLSVSHYYTDRDIIRNYESLSSL 471
            T+FS++ WF LLGE R+   + S ES SPLD++ HF++LS  + Y DRDIIRNYE+  +L
Sbjct: 415  TNFSTMFWFQLLGEYRA---IFSTESSSPLDSDHHFIDLSACYNYIDRDIIRNYEAQCTL 471

Query: 472  DPKNIGLYFDALTYIANRKGAYQLIAYCGKQDIIGQEALENALLVFKIEPKECNIAELNE 531
            DP+N+G+Y DAL +IANRKGAYQLIAYCGKQD +GQEAL++AL VF+I+ KE +   LN+
Sbjct: 472  DPENVGVYVDALNFIANRKGAYQLIAYCGKQDFVGQEALDHALGVFQIDSKEFDPHNLND 531

Query: 532  ATLLSIYKFETSNKSQVTSGHLTNLKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDTL 591
            + LLSIYK E++  S         LKN+LRLLAK+ KS KLKFY D+EPYR ++QAY+ L
Sbjct: 532  SVLLSIYKNESA--STRNPNRHAELKNSLRLLAKFKKSPKLKFYADYEPYRNVTQAYEIL 589

Query: 592  SIDESVDEDIIKTAYSVKINDSPGLKLDCDRALYTIAISKKSLDLFNFLTDECPQFLTYY 651
             +DESVD+DII+TAY+VK+NDSPGLK+DCDRALYTIA+  +SL LFNFL  +  +F  Y+
Sbjct: 590  EVDESVDDDIIQTAYTVKVNDSPGLKIDCDRALYTIAVHSRSLALFNFLVQQSEEFQEYF 649

Query: 652  GAEQLDYQEALKLLQVNENASDETILKIFKQKWFDESVYEPDQFLTLKAALTKISIERNS 711
            G +Q  YQ+AL +LQVNENA D+TIL+IF++KW+ E V++ DQFL LK AL+KI  ERNS
Sbjct: 650  GPDQFSYQDALSVLQVNENAGDDTILEIFQRKWYKEPVFDADQFLKLKGALSKIGFERNS 709

Query: 712  NLISNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYILDYQKTVE 771
             LIS+F+ TGT+D + LP ENWPTG+NNIGNTCYLNSLLQYYFSI+ LR+Y+LDY+ TV+
Sbjct: 710  KLISHFIDTGTVDASCLPAENWPTGLNNIGNTCYLNSLLQYYFSISSLRQYVLDYRNTVQ 769

Query: 772  NFNDHLSNSGHV-RRIGGRKISKGEVERSVQFIYQLRNLFYAMVHSRERCVTPSKELAYL 830
            +F   L+N  +  RRIGGR+I++ EVERSVQF+YQLR+LF +M+H+++RCVTP KELAYL
Sbjct: 770  HF---LNNQEYASRRIGGREITEAEVERSVQFVYQLRDLFDSMIHAQDRCVTPRKELAYL 826

Query: 831  AFAPSNIEVEFEVEGNKPADGAAIPIGLKEEATQESCTTKENDPKSIG------------ 878
            AF PS + VEFE+     A+  A P+   E+    +  ++ + P +              
Sbjct: 827  AFVPSGLGVEFELPNASQANANA-PV---EKENYVNIDSEPSPPPNDEPLLIDLDDDSDP 882

Query: 879  ---SKMEDNTNRDTHRNPSNTEKNEPNNV--------------QIVGGD---------DT 912
               SK+  N+N D   N  +  +   N+V              ++   D           
Sbjct: 883  NNHSKLNKNSNDDGKINEFDNSQAGENDVDVDISMTDSPAEEEKVTKADSGSSSNNSNKA 942

Query: 913  TDLNSLTRVAKISSDQLENALEMGRQQDVTECIGNVLFQIESGSEPIKYDEDNEQYDLVK 972
              +N+ TRVAKISSDQLENALEMGRQQDVTECIGNVLFQ+ES S+PI   +DNEQ DLVK
Sbjct: 943  VAMNTSTRVAKISSDQLENALEMGRQQDVTECIGNVLFQLESASDPISLGDDNEQNDLVK 1002

Query: 973  QLFYGTTKQSIVPLSATNKVRTKVERFLSLLINIGDHPKDIYDAFDSYFKDEYLTMEEYG 1032
            QLFYG  KQ+I+PL    +VRTK ERFLSLL+NIGDHPKDIYDA D YF+DEYL +EEYG
Sbjct: 1003 QLFYGNIKQNIIPLKDETQVRTKYERFLSLLVNIGDHPKDIYDALDLYFRDEYLKLEEYG 1062

Query: 1033 DVTRTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKEVIYMDRYADTENPLLLAK 1092
            DV RTVAVT FPTILQ+QIQRVYYDRERFMPFKS+ PLPF E IYMDRY+DT NP+L+ +
Sbjct: 1063 DVKRTVAVTDFPTILQIQIQRVYYDRERFMPFKSVAPLPFNETIYMDRYSDTNNPVLINR 1122

Query: 1093 KNETEEMKQKLRVMKNRQRELLSRDNSGLTRKDAFLESIKLLESSVVEKTTLKTEVKIDV 1152
            K ETE++ Q+L  +K RQRELLS++  GL+RK A +E+   L+S V+E   ++ + +  +
Sbjct: 1123 KRETEKLVQELNGLKGRQRELLSKNELGLSRKGALIETSNFLKSDVLETQGIQIDNRTGL 1182

Query: 1153 INTLRTNVNNIDNELMSLYNNINNLEEKISHQFDDFKEYGYSLFSVFIHRGEASYGHYWI 1212
               L   V  I++EL  LY+NI  LE KISHQFDDFK  GYSLF+VFIHRGEASYGHYWI
Sbjct: 1183 AQELDNIVLGINDELSQLYHNITQLESKISHQFDDFKSIGYSLFAVFIHRGEASYGHYWI 1242

Query: 1213 YIKDRNHNGVWRKYNDETVSEVQEDEVFNFNEGNTATPYFLVYVKQGQEADIEPLKRILQ 1272
            YIKDR  +G+WRKYNDET++EV E EVFNF+EGNTATPYFLVYVKQG E +IEPLKR+L+
Sbjct: 1243 YIKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTATPYFLVYVKQGHEQEIEPLKRVLE 1302

>NCAS0H02100 Chr8 complement(406897..410706) [3810 bp, 1269 aa] {ON}
            Anc_5.443 YOR124C
          Length = 1269

 Score = 1438 bits (3722), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 716/1242 (57%), Positives = 914/1242 (73%), Gaps = 35/1242 (2%)

Query: 54   DDGKHLLYPDIATSLPLKTSDRLLDDILCDTIFLNSTDPSVIEKG----LQTTGILRESM 109
            DDGK LLYP++    P+KT++RL+DDI+ D  FL         +G    +   GIL++SM
Sbjct: 36   DDGKQLLYPNVENHFPMKTAERLIDDIIADLSFLTGIAVDNGSRGDIDTMLGNGILKQSM 95

Query: 110  LSYSSFRSSIRPNALGSVTDQVVIQTKIEYDSYSCPKYNKIHVFQAVILNPSLTEQHVSS 169
            L+YS  ++      +GS+ DQV +QTK EY S +CP+ NK+ VF  V+ N S     +++
Sbjct: 96   LNYSKVKNQPGSFEMGSLIDQVTLQTKYEYKSVTCPELNKLQVFFGVLFNNS---TQITN 152

Query: 170  FDDIVKIPIYHLKVTVKIRQELERLKKHVGVTQFHSIDFLHEYDRVDFSTFDSSDPNLMD 229
             D++ + PIYHLKVTVK R  LE  KKH GVTQFH +D LH YD+ D  TF+  DPNL+D
Sbjct: 153  LDEVTQFPIYHLKVTVKTRNHLELTKKHAGVTQFHLVDQLHVYDKQDIPTFNPEDPNLLD 212

Query: 230  YGIYVSDDTNKLILIEIFKPEFDSPEEHESFTINAIKRRYSDMCLNNESLDKNNTPSQAD 289
            Y IYVS+DTNKLILIE+FKPEF S +E ESF    I  RY   C   ++L+ N  P+Q D
Sbjct: 213  YAIYVSNDTNKLILIEVFKPEFQSADEIESFKSENINERYQKACEQFDTLNPNEPPTQLD 272

Query: 290  CFYTLFKIFKGPLTRKSKTEPVKTIDSGNLALNTHLNPEWLTSKYGFQVSSEIDEETNER 349
            C  TLFK+FKGPL+RKS  EP KTIDS N  LN+H+NPEWLTSKYGF +  + D    ++
Sbjct: 273  CLNTLFKVFKGPLSRKSSDEPSKTIDSTNKTLNSHINPEWLTSKYGFNIVVDEDLPNAQQ 332

Query: 350  FTEYLPPDMVDYVDDLKVRKIRESFVRKCLQLLFWGQLSTSLLAPNSPLKNTKSVKGLSC 409
              EY PP++V+YV+D +VR++RE+++R+CLQL+FWG+LS +L   +  LKN+KS K ++ 
Sbjct: 333  SVEYEPPELVNYVEDFEVRRLRETYIRRCLQLIFWGKLSINLRINDPTLKNSKSYKSINA 392

Query: 410  LQTSFSSLPWFHLLGESRSRILLNSNESHSPLDAEPHFVNLSVSHYYTDRDIIRNYESLS 469
            LQT+F+  P   L   S    L+   ES SPLD   HF+NLS  ++YTDRD+IRNYE L 
Sbjct: 393  LQTNFTITPLLQLFKGSGQNFLMGP-ESRSPLDFNFHFINLSACYHYTDRDVIRNYERLC 451

Query: 470  SLDPKNIGLYFDALTYIANRKGAYQLIAYCGKQDIIGQEALENALLVFKIEPKECNIAEL 529
             LDP+N+G+YFDAL YIAN KG+YQLIAYCGKQDI+GQEAL+ AL  F ++P E +I ++
Sbjct: 452  HLDPQNVGVYFDALNYIANTKGSYQLIAYCGKQDIVGQEALDQALKSFNLDPMEVDITKI 511

Query: 530  NEATLLSIYKFETSNKSQVTSGHLTNLKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYD 589
            N++ LL++YK    N+ ++++  + NLKNA+RL AK   S KLKFY+DHEPYR ++QAY+
Sbjct: 512  NDSVLLTLYK----NELKISTSDIPNLKNAMRLFAKVKHSSKLKFYIDHEPYRRVAQAYE 567

Query: 590  TLSIDESVDEDIIKTAYSVKINDSPGLKLDCDRALYTIAISKKSLDLFNFLTDECPQFLT 649
            TL IDESVD+DI++TAY +K+ DSPGL +DCDRALYTIAI K+SL LF FL + CP F  
Sbjct: 568  TLDIDESVDDDIVQTAYDIKVVDSPGLTMDCDRALYTIAIHKRSLLLFTFLIERCPDFQE 627

Query: 650  YYGAEQLDYQEALKLLQVNENASDETILKIFKQKWFDESVYEPDQFLTLKAALTKISIER 709
            YY  ++  Y +AL + QVNENA+DE I+K F+ +WF+ESV+EP+ F+    AL +I ++R
Sbjct: 628  YYCPDRFTYHDALSMFQVNENAADELIIKNFQARWFNESVFEPESFVICVHALVEIGLQR 687

Query: 710  NSNLISNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYILDYQKT 769
            NS+LISNFL TG IDPN LP ++WP GINNIGNTCYLNSLLQYYFSIAPLR Y+L Y KT
Sbjct: 688  NSSLISNFLQTGKIDPNCLPIKDWPAGINNIGNTCYLNSLLQYYFSIAPLRNYVLQYSKT 747

Query: 770  VENFNDHLSNSGHVRRIGGRKISKGEVERSVQFIYQLRNLFYAMVHSRERCVTPSKELAY 829
            +E+F    +N+  VRRIGGR++S  EVERS+QFIYQLR+LF+AMV+S ERCVTP +ELAY
Sbjct: 748  IEDFKTLENNASTVRRIGGREVSNNEVERSIQFIYQLRDLFHAMVYSNERCVTPRRELAY 807

Query: 830  LAFAPSNIEVEFEVEGNKPADGAAIPIGLKEEATQESCTTKENDPKSIGS---KMEDN-T 885
            LAFAPSNIEVEFE   N+PA     P    E  T E    K+   +S+ S    M DN T
Sbjct: 808  LAFAPSNIEVEFETNENQPATQQDNP----EVTTAELGQDKDEKERSVDSGDISMSDNIT 863

Query: 886  NRDTHRNPSN-TEKNEPNNVQIVGGDDTTDL-------------NSLTRVAKISSDQLEN 931
             +D         E N+  +V  +    T D+              + T+VAKISSDQLEN
Sbjct: 864  PKDAEEEEDQVAESNKNQDVSAIVSSPTKDIIMTDNTDTVVSNEGTSTKVAKISSDQLEN 923

Query: 932  ALEMGRQQDVTECIGNVLFQIESGSEPIKYDE-DNEQYDLVKQLFYGTTKQSIVPLSATN 990
            ALEMGRQQDVTECIGNVLFQ+ESGSEP+   E DNEQ DLVKQLFYG  +Q+IVPL+  +
Sbjct: 924  ALEMGRQQDVTECIGNVLFQLESGSEPLDLHENDNEQDDLVKQLFYGELEQTIVPLANPD 983

Query: 991  KVRTKVERFLSLLINIGDHPKDIYDAFDSYFKDEYLTMEEYGDVTRTVAVTTFPTILQVQ 1050
            + R K+ERFLSLL+NIGDHP+DIYDA D YFKDEYL MEEYGDV RTVAVT FPTILQ+Q
Sbjct: 984  QRRPKLERFLSLLVNIGDHPRDIYDALDLYFKDEYLKMEEYGDVKRTVAVTKFPTILQIQ 1043

Query: 1051 IQRVYYDRERFMPFKSIEPLPFKEVIYMDRYADTENPLLLAKKNETEEMKQKLRVMKNRQ 1110
            IQRVYYDRE+FMPFKSIEPLPF+E IYMDRY+ T+NP L+A+KNET  MK+KL  +K +Q
Sbjct: 1044 IQRVYYDREKFMPFKSIEPLPFEEKIYMDRYSVTDNPELIARKNETLLMKEKLVELKKKQ 1103

Query: 1111 RELLSRDNSGLTRKDAFLESIKLLESSVVEKTTLKTEVKIDVINTLRTNVNNIDNELMSL 1170
            R+LLSR++ GL++KD+++E  KLL S  +E   +    K +++++L+T    ID+EL  L
Sbjct: 1104 RDLLSRNSVGLSKKDSYIELGKLLSSDSLESQGIILPEKDEMVSSLKTLTAGIDDELNQL 1163

Query: 1171 YNNINNLEEKISHQFDDFKEYGYSLFSVFIHRGEASYGHYWIYIKDRNHNGVWRKYNDET 1230
            Y  I+ LEE I+ QF++FK  GYS+F+VFIHRGEASYGHYWIYIKDR+ NG+WRKYNDET
Sbjct: 1164 YAEISQLEETINGQFNEFKGIGYSIFAVFIHRGEASYGHYWIYIKDRSQNGIWRKYNDET 1223

Query: 1231 VSEVQEDEVFNFNEGNTATPYFLVYVKQGQEADIEPLKRILQ 1272
            VSEV E+EV+NF EGNTATPYFLVYVK+G+E +IEPLKRI++
Sbjct: 1224 VSEVPEEEVYNFTEGNTATPYFLVYVKEGEEQEIEPLKRIIE 1265

>TDEL0D02580 Chr4 (493355..497173) [3819 bp, 1272 aa] {ON} Anc_5.443
            YOR124C
          Length = 1272

 Score = 1404 bits (3634), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 692/1233 (56%), Positives = 908/1233 (73%), Gaps = 17/1233 (1%)

Query: 44   ASHQSAPVDFDDGKHLLYPDIATSLPLKTSDRLLDDILCDTIFLNSTDPSVIEKGLQTTG 103
            A H       D GK +LY +++T  P KTSDRLLDD++ D  F+NS D  ++   L   G
Sbjct: 49   ADHLDTLTHRDSGKEVLYREVSTKFPFKTSDRLLDDLIHDLAFINSKDHDILYSDLHN-G 107

Query: 104  ILRESMLSYSSFRSSIRPNALGSVTDQVVIQTKIEYDSYSCPKYNKIHVFQAVILNPSLT 163
            IL+  +L+YS   S + P + G++ DQ+ +QT  EY S SCP +NK++V+  V+++    
Sbjct: 108  ILKAPVLAYSRRISQLYPYSFGTLVDQITLQTSFEYPSISCPGHNKLNVYMGVLIDVPHD 167

Query: 164  EQHVSSFDDIVKIPIYHLKVTVKIRQELERLKKHVGVTQFHSIDF--LHEYDRVDFSTFD 221
             +  SS   + +  +YHLKVTVK R  LE  KK  GVT +H I    LH++DR D   FD
Sbjct: 168  YKITSS--TLSENTVYHLKVTVKTRSILEHTKKKAGVTHYHCISEADLHQFDRQDLE-FD 224

Query: 222  SSDPNLMDYGIYVSDDTNKLILIEIFKPEFDSPEEHESFTINAIKRRYSDMCLNNESLDK 281
             +DP L+D+ IYVS DTNKL+LIE+F PEFD  E+ E ++  AIK RYS+ C   ++LD 
Sbjct: 225  PTDPRLVDHAIYVSSDTNKLVLIEVFLPEFDREEKTECWSGTAIKTRYSEACQRFDTLDP 284

Query: 282  NNTPSQADCFYTLFKIFKGPLTRKSKTEPVKTIDSGNLALNTHLNPEWLTSKYGFQVSSE 341
            +  P+QADC  TL KIF+GPL R++  EP+KTI+S N+ LN+ +NP WLTSKYGF++  E
Sbjct: 285  SEIPTQADCINTLLKIFRGPLNRQNSEEPLKTINSDNVVLNSRINPNWLTSKYGFELHVE 344

Query: 342  IDEETNERFTEYLPPDMVDYVDDLKVRKIRESFVRKCLQLLFWGQLSTSLLAPNSPLKNT 401
             DE T E + E+ PP++ +Y++D KVR++RESF+RKC++L+F G+ +  LL  ++    +
Sbjct: 345  KDESTGESYFEFEPPNLTNYIEDRKVRRLRESFIRKCIELIFLGKTAIELLGKDAK-TTS 403

Query: 402  KSVKGLSCLQTSFSSLPWFHLLGESRSRILLNSNESHSPLDAEPHFVNLSVSHYYTDRDI 461
            K  +  + +Q +FS   WF +LGE RS   + S ES SPLDA  +F+NLS   YY DRDI
Sbjct: 404  KVYRTFNAIQIAFSKTTWFKMLGEHRS---IFSFESASPLDANYNFINLSACFYYIDRDI 460

Query: 462  IRNYESLSSLDPKNIGLYFDALTYIANRKGAYQLIAYCGKQDIIGQEALENALLVFKIEP 521
            I+NYE+  +LDP+N G+YFDALTYIANRKGAYQL+AYCGKQD++GQEAL+ AL +F I+ 
Sbjct: 461  IKNYEAQCALDPENTGIYFDALTYIANRKGAYQLVAYCGKQDVVGQEALDQALKLFGIDS 520

Query: 522  KECNIAELNEATLLSIYKFETSNKSQVTSGHLTNLKNALRLLAKYTKSDKLKFYVDHEPY 581
            K+ ++A ++++ L+SIYK ET   +       T+LKNALRLLAKY KSDKLKF+ D+EPY
Sbjct: 521  KDVDVATIDDSLLVSIYKSET--MANPNENRHTDLKNALRLLAKYKKSDKLKFFADYEPY 578

Query: 582  RALSQAYDTLSIDESVDEDIIKTAYSVKINDSPGLKLDCDRALYTIAISKKSLDLFNFLT 641
            + +S+AY+ L +DESVD+DII+TAYS+ INDSPGLK+DCDRALYTI + K+SL L N+L 
Sbjct: 579  KNVSRAYEILEVDESVDDDIIETAYSISINDSPGLKIDCDRALYTIGVRKRSLRLLNYLL 638

Query: 642  DECPQFLTYYGAEQLDYQEALKLLQVNENASDETILKIFKQKWFDESVYEPDQFLTLKAA 701
             +CP F  YYG   L Y EAL +LQ+NENA DET+L++F++KW  E+ +E D  L LKAA
Sbjct: 639  QQCPDFQLYYGPGTLLYSEALSMLQLNENAGDETVLEVFQRKWHQETAFESDYLLKLKAA 698

Query: 702  LTKISIERNSNLISNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRR 761
            LTKI IERNS LI +F+ TGTID + LP +NWPTG+NNIGNTCYLNSLLQYYFS+APLRR
Sbjct: 699  LTKIGIERNSKLILHFIDTGTIDASCLPADNWPTGLNNIGNTCYLNSLLQYYFSLAPLRR 758

Query: 762  YILDYQKTVENFNDHLSNSGHVRRIGGRKISKGEVERSVQFIYQLRNLFYAMVHSRERCV 821
            Y+L+YQ+T+E+F  H  N   +RRIGGR++S+ EVERSVQF+YQLR+LF AM++S+ERCV
Sbjct: 759  YVLEYQETMEHFRHHTGN--ELRRIGGREVSEAEVERSVQFVYQLRDLFQAMIYSKERCV 816

Query: 822  TPSKELAYLAFAPSNIEVEFE-VEGNKPADGAAIPIGLKEEATQESCTTKENDPKSIGSK 880
            TP KELAYLAFAPSN EVEFE    N   + + I      +      T + ++ ++   +
Sbjct: 817  TPRKELAYLAFAPSNFEVEFEPTTVNAQHEVSKIAESTNNDILMYGPTNRSDNDQTGPIE 876

Query: 881  MEDNTNRDTHRNPSNTEKNEPNNVQIVGGDDTTD--LNSLTRVAKISSDQLENALEMGRQ 938
            ++ ++  +        E +E     I   D   D  +++ TRVAKISSDQLENALEMGRQ
Sbjct: 877  LDSDSGNEDIDVSMTKEPSEEYKEDIPMSDAEKDNIISTSTRVAKISSDQLENALEMGRQ 936

Query: 939  QDVTECIGNVLFQIESGSEPIKYDEDNEQYDLVKQLFYGTTKQSIVPLSATNKVRTKVER 998
            QDVTECIGNVLFQ+ES S+PI  DEDNEQ DLVKQLFYG  KQ+I+PL+ + +++TK+ER
Sbjct: 937  QDVTECIGNVLFQLESASDPINLDEDNEQNDLVKQLFYGKIKQTIIPLAKSTEIQTKIER 996

Query: 999  FLSLLINIGDHPKDIYDAFDSYFKDEYLTMEEYGDVTRTVAVTTFPTILQVQIQRVYYDR 1058
            +LSLL+NIGDHPKDIYDA DSYF DE LTM EYGDV RTVAVT FPTILQ+QIQRVYYDR
Sbjct: 997  YLSLLVNIGDHPKDIYDALDSYFSDERLTMAEYGDVKRTVAVTEFPTILQIQIQRVYYDR 1056

Query: 1059 ERFMPFKSIEPLPFKEVIYMDRYADTENPLLLAKKNETEEMKQKLRVMKNRQRELLSRDN 1118
            ERFMPFKSIEPLPF EV+YMDRY+D+++P ++ KK E+E++K +L  +K RQ+ELLS + 
Sbjct: 1057 ERFMPFKSIEPLPFNEVLYMDRYSDSQDPKMVEKKKESEQLKAQLSRLKIRQKELLSVNE 1116

Query: 1119 SGLTRKDAFLESIKLLESSVVEKTTLKTEVKIDVINTLRTNVNNIDNELMSLYNNINNLE 1178
             GL+RK A++E+I  L+S +++   LK      +I  L+ ++ +ID EL SLY++I  LE
Sbjct: 1117 LGLSRKAAYMETINYLKSDLIKSQELKGLNNDFLIEQLKQSIADIDQELTSLYHDIAKLE 1176

Query: 1179 EKISHQFDDFKEYGYSLFSVFIHRGEASYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDE 1238
              I  QF++FK+ GYSLF+VFIHRGEASYGHYW+YIKDR+ NG WRKYNDET++EV E E
Sbjct: 1177 NTIDKQFEEFKKIGYSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETE 1236

Query: 1239 VFNFNEGNTATPYFLVYVKQGQEADIEPLKRIL 1271
            VFNF EGNTATPYFLVYV+QG E DIEPLKRI+
Sbjct: 1237 VFNFTEGNTATPYFLVYVRQGHEHDIEPLKRII 1269

>NDAI0C01550 Chr3 (327953..331840) [3888 bp, 1295 aa] {ON} Anc_5.443
            YOR124C
          Length = 1295

 Score = 1375 bits (3560), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 692/1243 (55%), Positives = 884/1243 (71%), Gaps = 45/1243 (3%)

Query: 52   DFDDGKHLLYPDIATS-LPLKTSDRLLDDILCDTIFLNSTDPSVIEKGLQTTGILRESML 110
            D D G  LLYPD+ T+  P+KTS+R++DDILCD  F+N  + S         GIL+ESM+
Sbjct: 74   DIDPGNTLLYPDLGTANFPMKTSNRIIDDILCDLSFINGPNLSF------KNGILQESMI 127

Query: 111  SYSSFRSSIRPNALGSVTDQVVIQTKIEYDSYSCPKYNKIHVFQAVILN-PSLTEQHVSS 169
             YS  R + +    GS+ DQV +QTK EY+S +CP  NK+ V   +++N PS    ++++
Sbjct: 128  MYSKERINNQAYLFGSMVDQVALQTKYEYNSLTCPANNKLEVQFGILMNLPS----NITN 183

Query: 170  FDDIV-KIPIYHLKVTVKIRQELERLKKHVGVTQFHSIDF--LHEYDRVDFSTFDSSDPN 226
             D+I+ K+PIYHLK+TVK RQ LE  KK  G+TQ+H +DF  LH +D+ D  TFD  +P+
Sbjct: 184  VDEIISKVPIYHLKITVKTRQLLEVSKKQAGITQYHLLDFEDLHHFDKRDLMTFDPDNPD 243

Query: 227  LMDYGIYVSDDTNKLILIEIFKPEFDSPEEHESFTINAIKRRYSDMCLNNESLDKNNTPS 286
            L+DY IYVS DTN+LILIEIF  EFDS EE ESF    IK RY + C   ++LD    P+
Sbjct: 244  LLDYAIYVSSDTNRLILIEIFSTEFDSREERESFQTATIKSRYQEACKKFDTLDPEAVPT 303

Query: 287  QADCFYTLFKIFKGPLTRKSKTEPVKTIDSGNLALNTHLNPEWLTSKYGFQVSSEIDEET 346
              DC  T+ K+ K PLTRK+  + ++T+ S N  L++H NPEWL  KY F      DE T
Sbjct: 304  GIDCLNTVLKLLKQPLTRKNNNDKIRTVSSNNPILHSHFNPEWLLEKYNFTKHYATDETT 363

Query: 347  NERFTEYLPPDMVDYVDDLKVRKIRESFVRKCLQLLFWGQLSTSLLAPNS--PLKNTKSV 404
             +   EY PPD++ YV   KVR +RE ++R+CLQL+FWG+    L    S   L+ +KS 
Sbjct: 364  GQEVLEYEPPDLISYVQGYKVRSLREKYIRRCLQLIFWGKCLVQLRVDQSDPALRGSKSY 423

Query: 405  KGLSCLQTSFSSLPWFHLLGESRSRILLNS-NESHS-PLDAEPHFVNLSVSHYYTDRDII 462
            +  + L T+ S+ P + LL +S+S  L ++ N+S S  LD   HF+NLS S YYTDRDII
Sbjct: 424  RAFNLLNTTTSTNPLYQLLNDSKSNFLASTRNDSDSMALDQNFHFINLSTSSYYTDRDII 483

Query: 463  RNYESLSSLDPKNIGLYFDALTYIANRKGAYQLIAYCGKQDIIGQEALENALLVFKIEPK 522
            +NYE L +LDP NIG YFDAL+YIANRKG+YQLIAYCGKQD++GQE +  AL  F I+P 
Sbjct: 484  KNYERLIALDPPNIGTYFDALSYIANRKGSYQLIAYCGKQDVVGQENINMALKCFNIDPN 543

Query: 523  ECNIAELNEATLLSIYKFETSNKSQVTSGHLTNLKNALRLLAKYTKSDKLKFYVDHEPYR 582
              N+  ++++ LLSIYK    N+S        NLKNA+RL AK   S +LKFYVDHEPYR
Sbjct: 544  VVNLESIDDSLLLSIYK----NESVKEGADFVNLKNAMRLFAKIRNSPQLKFYVDHEPYR 599

Query: 583  ALSQAYDTLSIDESVDEDIIKTAYSVKINDSPGLKLDCDRALYTIAISKKSLDLFNFLTD 642
             ++QAY+TL ID SVD+DII+TAYS+K  D+PGLK+DCDRALYTIAI ++S+ LFNFL +
Sbjct: 600  NVNQAYETLEIDSSVDDDIIQTAYSIKTVDAPGLKIDCDRALYTIAIQRRSMILFNFLLE 659

Query: 643  ECPQFLTYYGAEQLDYQEALKLLQVNENASDETILKIFKQKWFDESVYEPDQFLTLKAAL 702
             C +F  YY   + DY++AL +LQVNENA+DE ILK F+ KWF+E ++E DQFL  K AL
Sbjct: 660  NCSEFQAYYNIGRYDYRQALGILQVNENANDEVILKNFQTKWFNEQIHEADQFLNYKCAL 719

Query: 703  TKISIERNSNLISNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRY 762
             K+ +ERNS LI+NFL+ G IDP+ LP ENWPTGINNIGNTCYLNSLLQYYFSI+PLR Y
Sbjct: 720  MKLGLERNSKLINNFLMNGVIDPSCLPVENWPTGINNIGNTCYLNSLLQYYFSISPLREY 779

Query: 763  ILDYQKTVENFNDHLSNSGHVRRIGGRKISKGEVERSVQFIYQLRNLFYAMVHSRERCVT 822
            +L Y KT E+F D   N+  +RRIGGR++   EVERS+QFIYQLR+LFYAM+++ +RCVT
Sbjct: 780  VLGYSKTYEDFYDAKRNAKTIRRIGGREVGDNEVERSIQFIYQLRDLFYAMIYTNKRCVT 839

Query: 823  PSKELAYLAFAPSNIEVEFE------------VEGNKPADGAAIPIGLKEEATQESCTTK 870
            P +ELAYLAFAPSN+EVEFE               +K +D   I IG  +E   E+  T+
Sbjct: 840  PRRELAYLAFAPSNVEVEFENGVTDAKEDVSHYNDDKTSD-TLIKIGEGDEDLGEAERTE 898

Query: 871  ENDPKSIGSKMEDNTNRDTHRNPSNTEKNEPNNVQIVGGDDTTDLNSLTRVAKISSDQLE 930
             +  + I    +D        +  N E     N          D+   T+VAKISSDQLE
Sbjct: 899  ASPTEDIYMTDDDMLGAAKATDGINKEDESTEN--------GIDILPSTKVAKISSDQLE 950

Query: 931  NALEMGRQQDVTECIGNVLFQIESGSEPIKYD-EDNEQYDLVKQLFYGTTKQSIVPLSAT 989
            NALEMGRQQDVTECIGNVL+Q+ESGSEP++ + EDNEQ DLVKQLFYG  KQ I+PLS  
Sbjct: 951  NALEMGRQQDVTECIGNVLYQLESGSEPLQINPEDNEQDDLVKQLFYGEIKQDIIPLSGV 1010

Query: 990  NKVRTKVERFLSLLINIGDHPKDIYDAFDSYFKDEYLTMEEYGDVTRTVAVTTFPTILQV 1049
             + R K+ERFLSLL+N+GDHP+DIYDA D YFKDE+LTM+EYG+V RTVA+T FPTILQV
Sbjct: 1011 GETRPKLERFLSLLVNVGDHPRDIYDALDMYFKDEFLTMDEYGEVKRTVAITKFPTILQV 1070

Query: 1050 QIQRVYYDRERFMPFKSIEPLPFKEVIYMDRYADTENPLLLAKKNETEEMKQKLRVMKNR 1109
            QIQRVYYDRERFMPFKSIEPLPF   IYMDRY DT +P +L  +  T +MK +L  +K R
Sbjct: 1071 QIQRVYYDRERFMPFKSIEPLPFSAKIYMDRYVDTADPEILETRERTAKMKAELVQLKKR 1130

Query: 1110 QRELLSRDNSGLTRKDAFLESIKLLESSVVEKTTLKTEVKIDVINTLRTNVNNIDNELMS 1169
            Q+ELLSR+  GL+RK+A+ E++  L+S+ ++   +  E + ++   L+    +ID+EL +
Sbjct: 1131 QQELLSRNEVGLSRKEAYSETVNFLQSNALQLQGIVFEGQDELSTILKKAGTDIDDELST 1190

Query: 1170 LYNNINNLEEKISHQFDDFKEYGYSLFSVFIHRGEASYGHYWIYIKDRNHNGVWRKYNDE 1229
            +YN I  LEE ISHQF+ FK+ GYSLF+VFIHRGEASYGHYW+YIKD N NG+WRKYNDE
Sbjct: 1191 IYNQITQLEETISHQFEQFKKVGYSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDE 1250

Query: 1230 TVSEVQEDEVFNFNEGNTATPYFLVYVKQGQEADIEPLKRILQ 1272
            TVSEV ++EVFNF EGNTATPYFLVYVK+G E DIEPLKRI++
Sbjct: 1251 TVSEVPDEEVFNFTEGNTATPYFLVYVKEGSEKDIEPLKRIIE 1293

>Kpol_1062.23 s1062 (51365..55165) [3801 bp, 1266 aa] {ON}
            (51365..55165) [3801 nt, 1267 aa]
          Length = 1266

 Score = 1370 bits (3545), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 679/1234 (55%), Positives = 904/1234 (73%), Gaps = 35/1234 (2%)

Query: 54   DDGKHLLYPDIATSLPLKTSDRLLDDILCDT--IFLNSTDPSVIEKGLQTTGILRESMLS 111
            DDGK LLYPD     P KTS+RLLD+I+C    I L+  D S  E    + G+L++ +LS
Sbjct: 52   DDGKQLLYPDARDLTPFKTSERLLDEIMCSVPYILLSEKDESFNEF---SNGLLKKQLLS 108

Query: 112  YSSFRSSIRPNALGSVTDQVVIQTKIEYDSYSCPKYNKIHVFQAVILNPSLTEQHVSSFD 171
            YS  R +++P ++G++ DQ+++QTK EY S +CP++N I+V   V+++ +   Q +S+FD
Sbjct: 109  YSKSRHNVQPFSVGTIVDQIILQTKFEYKSTTCPEFNNIYVRLGVLIDTN--HQPLSTFD 166

Query: 172  DIVKIPIYHLKVTVKIRQELERLKKHVGVTQFHSIDFLHEYDRVDFSTFDSSDPNLMDYG 231
            D+  + IYHLK+TVK+R  LER K+HVGV ++H +D LH +D+ D   FD  DP L+D+ 
Sbjct: 167  DVADLKIYHLKITVKVRSFLERTKRHVGVPRYHLLDSLHPFDQQDLLNFDPKDPKLVDHA 226

Query: 232  IYVSDDTNKLILIEIFKPEFDSPEEHESFTINAIKRRYSDMCLNNESLDKNNTPSQADCF 291
            IYVSDDTNKL+L+EIF+PEFDS EE  S T+ AIK R+       ++LDK+  P+Q DC 
Sbjct: 227  IYVSDDTNKLVLLEIFRPEFDSEEERNSLTMGAIKERHIKASKKYDTLDKDEIPTQIDCI 286

Query: 292  YTLFKIFKGPLTRKSKTEPVKTIDSGNLALNTHLNPEWLTSKYGFQVSSEIDEETNERFT 351
             T+FKIFKGPLTRKS  EPVKT+ S N+ LN+ +NP+WL +KYGFQ   E +EET E+  
Sbjct: 287  NTMFKIFKGPLTRKSNDEPVKTLSSDNVVLNSQMNPKWLVTKYGFQELIETEEETEEQLI 346

Query: 352  EYLPPDMVDYVDDLKVRKIRESFVRKCLQLLFWGQLSTSLLAPNSPLKNTKSVKGLSCLQ 411
            +YLPP++VD+  D  VRK RE+  RKCL+L++ G++S SL+ P      +KS++  + LQ
Sbjct: 347  DYLPPNLVDFETDQDVRKSREAVTRKCLELIWLGKISISLMTPEQKESASKSLRTFNLLQ 406

Query: 412  TSFSSLPWFHLLGESRSRILLNSNESHSPLDAEPHFVNLSVSHYYTDRDIIRNYESLSSL 471
            TSFS+L W  +L E+++   +  N     ++ + H ++LS S++YTDRDII+NYE    L
Sbjct: 407  TSFSTLFWSQILDENKNIATMKENPQ---MNLDYHLIDLSASYHYTDRDIIQNYELQCKL 463

Query: 472  DPKNIGLYFDALTYIANRKGAYQLIAYCGKQDIIGQEALENALLVFKIEPKECNIAELNE 531
            DP NIG+YFD+L +IAN +G+Y LI YC KQDI+GQEALE AL  F ++P   ++++ N+
Sbjct: 464  DPANIGIYFDSLHFIANNRGSYTLIGYCDKQDIVGQEALEQALKTFSLDPDTIDLSDTND 523

Query: 532  ATLLSIYKFETSNKSQVTSGHLTNLKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDTL 591
            A  ++IYK E        +  LTNL+NALR+LAK+  S +LKFYVD+EPY ++ +A++ L
Sbjct: 524  AIFMTIYKNEVKLHGNDPT-RLTNLRNALRILAKHKNSSRLKFYVDYEPYSSIQRAFNIL 582

Query: 592  SIDESVDEDIIKTAYSVKINDSPGLKLDCDRALYTIAISKKSLDLFNFLTDECPQFLTYY 651
             +DESVD+DII+TAYS+K+ND+PGLK+DCDRALYT+A+SK+S+ L NFL  ECP F  +Y
Sbjct: 583  EVDESVDDDIIQTAYSIKVNDTPGLKIDCDRALYTVAVSKRSMILINFLFQECPPFQDFY 642

Query: 652  GAEQLDYQEALKLLQVNENASDETILKIFKQKWFDESVYEPDQFLTLKAALTKISIERNS 711
            G +Q  Y EAL+ LQVNENA+D+TIL+IF+++W  +SV + D+ L+LK+ LTKI+ ERNS
Sbjct: 643  GPDQYTYSEALQKLQVNENAADDTILEIFQRRWTSDSVIDADEILSLKSVLTKIAFERNS 702

Query: 712  NLISNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYILDYQKTVE 771
             LIS++L TG ++P  LP +NWP G+NNIGNTCYLNSLLQYYF I+PLR Y+ DYQKT+E
Sbjct: 703  KLISSYLETGVVNPGCLPADNWPAGLNNIGNTCYLNSLLQYYFCISPLRNYVADYQKTLE 762

Query: 772  NFNDHLSNSGHVRRIGGRKISKGEVERSVQFIYQLRNLFYAMVHSRERCVTPSKELAYLA 831
               + L +    RRIGGR+I+K EVERSVQF+YQLR+LF  M+HS  RCVTP+KELAYLA
Sbjct: 763  AVENCLEDGWDKRRIGGREINKVEVERSVQFVYQLRDLFNEMIHSSSRCVTPTKELAYLA 822

Query: 832  FAPSNIEVEFEV-----EGN-KPADGAAI--------PIGLKEEATQESCTTKENDPKSI 877
            FAPSN+EVEF+       GN +  DG  +        P G K     E  +  EN P++ 
Sbjct: 823  FAPSNVEVEFDQPNELQSGNGEDVDGDIVFIDEDISEPKG-KSLVLDEENSKVENSPENQ 881

Query: 878  GSKMEDNTNRDTHRNPSNTEKNEPNNVQIVGGDDTTDLNSLTRVAKISSDQLENALEMGR 937
              +++D+++   H+      +N         G  T   ++ TRVAKIS DQLENALE+GR
Sbjct: 882  LIEIDDSSDSSGHKKVEEISQNP------CFGKST---DTSTRVAKISFDQLENALELGR 932

Query: 938  QQDVTECIGNVLFQIESGSEPIKYDEDNEQYDLVKQLFYGTTKQSIVPLSATNKVRTKVE 997
            QQDVTECIGNVLFQ+ES S PI  +ED+EQYDL+K+LFYG TKQSI+PL   N++R K+E
Sbjct: 933  QQDVTECIGNVLFQLESASNPISLEEDDEQYDLIKKLFYGKTKQSIIPLKNNNEIRNKIE 992

Query: 998  RFLSLLINIGDHPKDIYDAFDSYFKDEYLTMEEYGDVTRTVAVTTFPTILQVQIQRVYYD 1057
            RF+SLL+N+ DHPKD+YDA D YF DEYLTM+EYG+V +++AVT FPTILQ+QIQRVYYD
Sbjct: 993  RFVSLLVNVSDHPKDVYDALDLYFSDEYLTMDEYGEVKKSLAVTEFPTILQIQIQRVYYD 1052

Query: 1058 RERFMPFKSIEPLPFKEVIYMDRYADTENPLLLAKKNETEEMKQKLRVMKNRQRELLSRD 1117
            RERFMPFKSIEPLPF E IYMDRY +T +  LL KK+ET E+K++L  M+ RQ+ELLSR+
Sbjct: 1053 RERFMPFKSIEPLPFSETIYMDRYTETTDADLLKKKDETFELKKQLSEMRKRQKELLSRN 1112

Query: 1118 NSGLTRKDAFLESIKLLESSVVEKTTLKTEVKIDVINTLRTNVNNIDNELMSLYNNINNL 1177
              GL+RK+AF+E+ K L S  +EK  ++TE K  +I+ L   + +ID+EL  LYN+I N+
Sbjct: 1113 ELGLSRKEAFMETRKFLSSDALEKQGIETENKQMLIDRLTGALKDIDDELTKLYNDIVNI 1172

Query: 1178 EEKISHQFDDFKEYGYSLFSVFIHRGEASYGHYWIYIKDRNHNGVWRKYNDETVSEVQED 1237
            E KI  QFD F+  GYSLF+VFIHRGEASYGHYW+YIKD   NG+WRKYNDET++EV E 
Sbjct: 1173 EAKIDRQFDKFQNIGYSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVPEA 1232

Query: 1238 EVFNFNEGNTATPYFLVYVKQGQEADIEPLKRIL 1271
            EVFNF EGNTATPYFLVYVKQ    +IEPLKRI+
Sbjct: 1233 EVFNFTEGNTATPYFLVYVKQENLNEIEPLKRIV 1266

>SAKL0G02728g Chr7 complement(223607..227320) [3714 bp, 1237 aa] {ON}
            similar to uniprot|Q01476 Saccharomyces cerevisiae
            YOR124C UBP2 Ubiquitin-specific protease that removes
            ubiquitin from ubiquitinated proteins cleaves at the C
            terminus of ubiquitin fusions capable of cleaving
            polyubiquitin and possesses isopeptidase activity
          Length = 1237

 Score = 1339 bits (3466), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 673/1235 (54%), Positives = 883/1235 (71%), Gaps = 34/1235 (2%)

Query: 47   QSAPVDFDDGKHLLYPDIATSLPLKTSDRLLDDILCDTIFLNSTDPSVIEKGLQTTGILR 106
            Q  P   DDGK LLYP +  + P KTSDRLLDDI  D  FLNS +  ++   L   G+LR
Sbjct: 27   QEVPPVIDDGKTLLYPGVHLNFPFKTSDRLLDDIRSDMFFLNSEEHDILYSQLHN-GVLR 85

Query: 107  ESMLSYSSFRSSIRPNALGSVTDQVVIQTKIEYDSYSCPKYNKIHVFQAVILNPSLTEQH 166
              ML YS  + + +P ++G + DQV ++TK EY+S +CP+ NKI+VF  V     L +QH
Sbjct: 86   LPMLEYSR-KKTTQPCSVGYLLDQVTLKTKYEYESKTCPELNKINVFMGV-----LVDQH 139

Query: 167  V--SSFDDIVKIPIYHLKVTVKIRQELERLKKHVGVTQFHSIDFLHEYDRVD-FSTFDSS 223
            +   S DD++ +PIYHLK+TVK R  LER+KKHVGVT +H ID LH +D+ D F T +S 
Sbjct: 140  IRPESLDDVINVPIYHLKITVKTRLHLERVKKHVGVTHYHLIDQLHSFDKQDIFMTTESE 199

Query: 224  DPNLMDYGIYVSDDTNKLILIEIFKPEFDSPEEHESFTINAIKRRYSDMCLNNESLDKNN 283
               L+D   YVS DTN+L+ IEIFKPEF + E+   F+   +K RY+  C   + LD  +
Sbjct: 200  --QLVDSATYVSSDTNRLLRIEIFKPEF-TKEDLAIFSQEKVKERYASACEKFQDLDPTS 256

Query: 284  TPSQADCFYTLFKIFKGPLTRKSKTEPVKTIDSGNLALNTHLNPEWLTSKYGFQVSSEID 343
             P+Q +C  TLFKIFKGPL R+S  + +KTI + N  LN+ ++P WLT KY F++    D
Sbjct: 257  VPTQVECLNTLFKIFKGPLNRRSSEDILKTISADNKFLNSQIDPSWLTEKYDFKLVETTD 316

Query: 344  EETNERFTEYLPPDMVDYVDDLKVRKIRESFVRKCLQLLFWGQLSTSLLAPNSPLKNTKS 403
            EET E   E+ PPD+ DYV D  VR  RES+ RKCL+L+F G+ S  LL  +   K++KS
Sbjct: 317  EETGELIREFEPPDLTDYVQDWSVRSKRESYTRKCLELIFLGKTSAQLLPKDILSKDSKS 376

Query: 404  VKGLSCLQTSFSSLPWFHLLGESRSRILLNSNESHSPLDAEPHFVNLSVSHYYTDRDIIR 463
             +  +  QT+FS+  WFHLLG+ R+      +    P D + HF+NLS S YY+D+DII+
Sbjct: 377  -RSFNLYQTNFSTSFWFHLLGDGRN---FQDHNLQQPFDNDYHFINLSASSYYSDKDIIK 432

Query: 464  NYESLSSLDPKNIGLYFDALTYIANRKGAYQLIAYCGKQDIIGQEALENALLVFKIEPKE 523
            NYE+  SLDP+N+G+YFDAL YIAN KG YQLIAYCGKQ+I+G+EAL+ AL VF I+ K+
Sbjct: 433  NYETQISLDPENVGIYFDALNYIANTKGGYQLIAYCGKQNIVGKEALDGALTVFGIDSKD 492

Query: 524  CNIAELNEATLLSIYKFETSNKSQVTSGHLTNLKNALRLLAKYTKSDKLKFYVDHEPYRA 583
             ++  + +  LLSIYK E    S       T+LKNALRLLAK+ +S KLKF+VD+EPY +
Sbjct: 493  TDVKSITDELLLSIYKNELKAAS---VQKRTDLKNALRLLAKFKESKKLKFHVDYEPYTS 549

Query: 584  LSQAYDTLSIDESVDEDIIKTAYSVKINDSPGLKLDCDRALYTIAISKKSLDLFNFLTDE 643
             S+AY  L I ESVD DII+TAY++++ D+PGLK+DCDRALYT+A++K+SL LFNFLT E
Sbjct: 550  TSKAYQLLEIGESVDLDIIQTAYTIRVADAPGLKIDCDRALYTLAVAKRSLVLFNFLTQE 609

Query: 644  CPQFLTYYGAEQLDYQEALKLLQVNENASDETILKIFKQKWFDESVYEPDQFLTLKAALT 703
            CP F  +Y  +   Y+EAL LLQVNENA+D+ IL+IF++KW  E +  PDQFL LK ALT
Sbjct: 610  CPIFQEFYNIDNWSYKEALSLLQVNENATDDVILEIFQRKWSQEPMTSPDQFLILKTALT 669

Query: 704  KISIERNSNLISNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYI 763
            K+ IERNS LI+NF+ TG +D + LP  NWPTG+NNIGNTCYLNSLLQYYFSI+PLR Y+
Sbjct: 670  KLGIERNSKLINNFIDTGIVDVSCLPAGNWPTGLNNIGNTCYLNSLLQYYFSISPLRDYV 729

Query: 764  LDYQKTVENFNDHLSNSG---HVRRIGGRKISKGEVERSVQFIYQLRNLFYAMVHSRERC 820
            L+YQK +  F D    +G     RRIG R++SK EVERSVQF+YQLR+LF  MVH++ER 
Sbjct: 730  LNYQKMLNCFRDIEDATGGEISKRRIGSREVSKPEVERSVQFVYQLRDLFRDMVHTKERF 789

Query: 821  VTPSKELAYLAFAPSNIEVEFEVEGNKPADGAAIPIGLKEEATQESCTTKENDPKSIGSK 880
            VTP+KELAYLAFAPSNIEVEFE     P      P  L E   +        D   I ++
Sbjct: 790  VTPTKELAYLAFAPSNIEVEFEA----PTITTVAPEDLDERTNKLDIIDLAAD--GIDNE 843

Query: 881  MEDNTNR---DTHRNPSNTEKNEPNNVQIVGGDDTTDLNSLTRVAKISSDQLENALEMGR 937
             E  +     D H      E+ E  ++ + G  +   +N+  RVAKISSDQLEN LE+GR
Sbjct: 844  TEKGSKSSLLDVHNQQKPEEQTE--DIIMGGTQEEEAVNASMRVAKISSDQLENTLELGR 901

Query: 938  QQDVTECIGNVLFQIESGSEPIKYDEDNEQYDLVKQLFYGTTKQSIVPLSATNKVRTKVE 997
            QQDVTECIGNVLFQ+ES S+P   +EDNEQ+DL+K+LFYG  KQ ++P+   +K+RTK+E
Sbjct: 902  QQDVTECIGNVLFQLESASDPWSLEEDNEQHDLIKELFYGKIKQHLIPVKNPSKIRTKIE 961

Query: 998  RFLSLLINIGDHPKDIYDAFDSYFKDEYLTMEEYGDVTRTVAVTTFPTILQVQIQRVYYD 1057
            RF+SLL+NIGDHPKDIYDA D YFKD+ L ++E G+V RTVAVT  P ILQ+QIQRVYYD
Sbjct: 962  RFVSLLVNIGDHPKDIYDALDLYFKDDLLQLDEDGEVKRTVAVTNLPKILQIQIQRVYYD 1021

Query: 1058 RERFMPFKSIEPLPFKEVIYMDRYADTENPLLLAKKNETEEMKQKLRVMKNRQRELLSRD 1117
            RERFMPFKSIEPLPF E IYMDRY DT++P++LAK+++T+++K++LR +K+RQ +LLS++
Sbjct: 1022 RERFMPFKSIEPLPFSETIYMDRYMDTDDPVMLAKRDDTKKLKEELRALKDRQHQLLSKN 1081

Query: 1118 NSGLTRKDAFLESIKLLESSVVEKTTLKTEVKIDVINTLRTNVNNIDNELMSLYNNINNL 1177
            ++GL+ K + L++ K L+S V++K  +  E K  ++  + + +  ID EL SLY  I  L
Sbjct: 1082 DTGLSFKGSLLQTKKFLQSEVLDKHEIAVENKGALVCHIDSMITKIDGELSSLYQKITAL 1141

Query: 1178 EEKISHQFDDFKEYGYSLFSVFIHRGEASYGHYWIYIKDRNHNGVWRKYNDETVSEVQED 1237
            E +I++QF++F + GYSLF+ FIHRGEASYGHYWIYIKDR  NG+WRKYNDE+V+EV + 
Sbjct: 1142 EVQIANQFNEFTKIGYSLFAAFIHRGEASYGHYWIYIKDRKKNGIWRKYNDESVTEVPQS 1201

Query: 1238 EVFNFNEGNTATPYFLVYVKQGQEADIEPLKRILQ 1272
            EVFNF EGNTATPYFLVY+K+G E +IEPLKR+++
Sbjct: 1202 EVFNFTEGNTATPYFLVYIKEGHEDEIEPLKRVIK 1236

>KNAG0B04190 Chr2 (795803..799591) [3789 bp, 1262 aa] {ON} Anc_5.443
            YOR124C
          Length = 1262

 Score = 1339 bits (3466), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 681/1236 (55%), Positives = 889/1236 (71%), Gaps = 48/1236 (3%)

Query: 54   DDGKHLLYPDIATSLPLKTSDRLLDDILCDTIFLNSTDPSVIEKGLQTTGILRESMLSYS 113
            DDGKHLLY D+    P+KTSDRL+DDILCD + LN     ++ +  Q+ GIL+   + YS
Sbjct: 52   DDGKHLLYTDLKNGSPMKTSDRLIDDILCD-LSLNGQSQCLLSE--QSQGILKLLPIIYS 108

Query: 114  SFRSSIR-PNALGSVTDQVVIQTKIEYDSYSCPKYNKIHVFQAVILNPSLTEQHVSSFDD 172
              R  ++  + LGS+ DQV+ QTK EY S SCP++NK+ VF  V+LN S       S DD
Sbjct: 109  KQRQQLQNVSILGSLLDQVLFQTKFEYSSVSCPQHNKLQVFLGVLLNVS---SSFESTDD 165

Query: 173  IVKIPIYHLKVTVKIRQELERLKKHVGVTQFHSIDFLHEYDRVDFSTFDSSDPNLMDYGI 232
            +V+ P++HLKVTVK R +LE  KKH GV+QF S+D LH YD+ D  TFD  D  L+DY I
Sbjct: 166  VVRSPLFHLKVTVKTRSQLELYKKHAGVSQFFSVDSLHSYDKEDLGTFDPEDTRLIDYAI 225

Query: 233  YVSDDTNKLILIEIFKPEFDSPEEHESFTINAIKRRYSDMCLNNESLDKNNTPSQADCFY 292
            YVS DTNKL+LIEIF PEF++ EE ESFT++ I++RY D C   +SL+  + P+Q DC  
Sbjct: 226  YVSSDTNKLVLIEIFHPEFNTSEEIESFTVDGIRKRYVDTCSRLDSLNPEDIPNQFDCLN 285

Query: 293  TLFKIFKGPLTRKSKTEPVKTIDSGNLALNTHLNPEWLTSKYGFQVSSEIDEETNERFTE 352
            TL+K FK P+ +   + P++TI + N  LN+H+N  WLT +YGF +   +  E  +   E
Sbjct: 286  TLYKTFKNPINKTDPSAPLQTIKASNPILNSHMNANWLTERYGFTL---LPGENEDDEDE 342

Query: 353  YLPPDMVDYVDDLKVRKIRESFVRKCLQLLFWGQLSTSLLAPNSPLK---NTKSVKGLSC 409
            Y PP+   Y+ D KVRK++E ++RKCLQL+FW +L   ++      K   ++KS K LS 
Sbjct: 343  YEPPNFTTYIMDPKVRKMKECYIRKCLQLIFWAKLMIEVVDNTQRSKLAASSKSFKSLSG 402

Query: 410  LQTSFSSLPWFHLLGESRSRILLNSNESHSPLDAEPHFVNLSVSHYYTDRDIIRNYESLS 469
            +    +S P + L GES++   LNSN+ +   D   HF+ LS S++Y DRDII NYE+ S
Sbjct: 403  IAVQNTSKPLYQLFGESKNA-FLNSNDQNYMWDTNYHFIALSASYHYNDRDIIMNYETYS 461

Query: 470  SLDPKNIGLYFDALTYIANRKGAYQLIAYCGKQDIIGQEALENALLVFKIEPKECNIAEL 529
             +D  NIG+YFDA+ +IANRKG+YQL+AYCGKQ+I+G EALE A+  FK++P   +I +L
Sbjct: 462  VIDKGNIGIYFDAIQFIANRKGSYQLLAYCGKQNIVGHEALEAAMRAFKLDPAAIDINKL 521

Query: 530  NEATLLSIYKFETSNKSQVTSGHLTNLKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYD 589
            + + LLS+YK E    S   + HL++LKNALR+LAK+  +  +KFYVDHEPY+ +SQAY+
Sbjct: 522  DISLLLSMYKHE--QISNQNTSHLSDLKNALRVLAKFKDNRFVKFYVDHEPYKTVSQAYN 579

Query: 590  TLSIDESVDEDIIKTAYSVKINDSPGLKLDCDRALYTIAISKKSLDLFNFLTDECPQFLT 649
             L +DESVD+DII+TAYS+K+NDSPGLK++C RALYTIAI+K+S+ LFN+L +ECP+F  
Sbjct: 580  ELEVDESVDDDIIQTAYSIKVNDSPGLKIECIRALYTIAINKRSMALFNYLIEECPEFQD 639

Query: 650  YYGAEQLDYQEALKLLQVNENASDETILKIFKQKWFDESVYEPDQFLTLKAALTKISIER 709
            +YG E+  Y++AL ++QVNENASDE IL+IF++KW DE + E DQFL+LKAAL K+ IE+
Sbjct: 640  FYGPEKYSYEQALAIIQVNENASDEMILQIFQKKWNDEPLVEYDQFLSLKAALLKLCIEK 699

Query: 710  NSNLISNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYILDYQKT 769
            NS LIS+FL TG IDP+ LP ENWP G+NNIGNTCYLNSLLQYYF+IAPLR YI  YQ T
Sbjct: 700  NSKLISHFLTTGLIDPSCLPVENWPIGLNNIGNTCYLNSLLQYYFAIAPLRNYICSYQST 759

Query: 770  VENFNDHLSNSGHVRRIGGRKISKGEVERSVQFIYQLRNLFYAMVHSRERCVTPSKELAY 829
             E+F    +++   RRIGGR++   EVERS+QF YQLR+LF  M+ S  RCV+P++ELAY
Sbjct: 760  TESFEATDTDAKINRRIGGRQVCASEVERSIQFTYQLRDLFNGMIFSNSRCVSPTQELAY 819

Query: 830  LAFAPSNIEVEFEVEGNKPADGAAIPIGLKEEATQESCTTKENDPKSIGSKMEDNTNRDT 889
            LAF+PSNIEVEF+        G+ I     E     S   K+ D           T+   
Sbjct: 820  LAFSPSNIEVEFDA-------GSGIA---SESGGTFSLNGKDTDAPL--------TDMPL 861

Query: 890  HRNPSNTEKNEP-----NNVQIVGGDDTTD--------LNSLTRVAKISSDQLENALEMG 936
            + + + TE  EP       +  V  D   D        +NS T+VAKI SDQLENALE+G
Sbjct: 862  NEDVTMTEAGEPQLDDTGLLAPVEADVPVDQMKLAKEVINSSTKVAKIGSDQLENALELG 921

Query: 937  RQQDVTECIGNVLFQIESGSEPIKYDEDNEQYDLVKQLFYGTTKQSIVPLSATNKVRTKV 996
            RQQDVTECIGNVL+Q+ES S+PIK DEDNEQYDL+K LFYG T+Q IVPLS +  VR+K 
Sbjct: 922  RQQDVTECIGNVLYQLESASDPIKLDEDNEQYDLIKHLFYGKTRQDIVPLSNSTDVRSKY 981

Query: 997  ERFLSLLINIGDHPKDIYDAFDSYFKDEYLTMEEYGDVTRTVAVTTFPTILQVQIQRVYY 1056
            ERFLSLL+N+ DHPKDIYDA DSYF +EYLT+EEYGDV RTVA+T FPTILQ+QIQRVYY
Sbjct: 982  ERFLSLLVNVSDHPKDIYDALDSYFMEEYLTLEEYGDVRRTVAITEFPTILQIQIQRVYY 1041

Query: 1057 DRERFMPFKSIEPLPFKEVIYMDRYADTENPLLLAKKNETEEMKQKLRVMKNRQRELLSR 1116
            DRERFMPFKSIEP+PF   +YMDRYA T++P++L K+ ET E+K +LR  K RQ+ELLSR
Sbjct: 1042 DRERFMPFKSIEPIPFNSTLYMDRYAATDDPVMLTKRRETSELKTRLRECKVRQQELLSR 1101

Query: 1117 DNSGLTRKDAFLESIKLLESSVVEKT-TLKTEVKIDVINTLRTNVNNIDNELMSLYNNIN 1175
            ++ GL+RK+A+ E++K+L+S  +E+  +++ E +  V++ L   V +ID EL+ LY  I 
Sbjct: 1102 NDMGLSRKEAYTETMKMLQSDFLEQVPSVRGEDQTAVVSGLSDMVASIDEELVQLYTEIG 1161

Query: 1176 NLEEKISHQFDDFKEYGYSLFSVFIHRGEASYGHYWIYIKDRNHNGVWRKYNDETVSEVQ 1235
             LE +I HQFD F++ GYSLF+VFIHRGEASYGHYW+Y+KD  ++G+WRKYNDETVSEV 
Sbjct: 1162 QLETQIDHQFDSFQKVGYSLFAVFIHRGEASYGHYWVYVKDFKNSGIWRKYNDETVSEVP 1221

Query: 1236 EDEVFNFNEGNTATPYFLVYVKQGQEADIEPLKRIL 1271
            E+EVFNF EGN ATPYFLV VKQ  E DIEPL RI+
Sbjct: 1222 EEEVFNFTEGNNATPYFLVLVKQTHEQDIEPLHRII 1257

>KAFR0D05070 Chr4 complement(996195..999878) [3684 bp, 1227 aa] {ON}
            Anc_5.443 YOR124C
          Length = 1227

 Score = 1333 bits (3451), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 692/1246 (55%), Positives = 898/1246 (72%), Gaps = 48/1246 (3%)

Query: 35   EECPLYETSASHQSAPVDFDDGKHLLYPDIATSLPLKTSDRLLDDILCDTIFLNSTDPSV 94
            +E  +  T+A  +S P + DDGK LLYP +  +LP KT DRL+DDI+ D  F+N +D S 
Sbjct: 18   DEQSVSSTTADEKSLPPN-DDGKQLLYPAVGLNLPFKTPDRLIDDIVYDLAFINDSDLSS 76

Query: 95   IEKGLQTTGILRESMLSYSSFRSSIRPN-ALGSVTDQVVIQTKIEYDSYSCPKYNKIHVF 153
                 +  GIL+ S L+YS  R  +RP+  LG+  DQ+ +QTK EY+S SCP +N+I+VF
Sbjct: 77   -----EFKGILKSSPLTYSKRRQELRPSYHLGTFIDQITLQTKYEYESISCPDHNRINVF 131

Query: 154  QAVILNPSLTEQHVSSFDDIVKIPIYHLKVTVKIRQELERLKKHVGVTQFHSIDFLHEYD 213
              V+++ ++  ++ +SFD + + PIYHLKVTVK R +LE LKKHVG++ +H I  LH +D
Sbjct: 132  FGVLIDSNM--ENPTSFDAVAETPIYHLKVTVKTRTKLEHLKKHVGISHYHLITELHPFD 189

Query: 214  RVDFSTFDSSDPNLMDYGIYVSDDTNKLILIEIFKPEFDSPEEHESFTINAIKRRYSDMC 273
            + D  TFD SD NL+D+  YVS DTNKLILIEIFKPEF S EE ESF    I  RY  +C
Sbjct: 190  KQDLLTFDESDENLIDFAAYVSSDTNKLILIEIFKPEFSSEEEIESFKTEHITSRYQLVC 249

Query: 274  LNNESLDKNNTPSQADCFYTLFKIFKGPLTRKSK-TEPVKTIDSGNLALNTHLNPEWLTS 332
               +SL+ +  PSQ DCF TLF++FKGPL RKS   +P+KTI++ N ALN+H++ +WL S
Sbjct: 250  EQYDSLNSDTIPSQVDCFRTLFRVFKGPLDRKSADLDPIKTINATNKALNSHMDSKWLVS 309

Query: 333  KYGFQVSSEIDEETNERFTEYLPPDMVDYVDDLKVRKIRESFVRKCLQLLFWGQLSTSLL 392
            KYGFQ +S  + E N++  EY PPD++D+ +D K+RK+R+S+ RKCLQL FWG+LS  LL
Sbjct: 310  KYGFQENSFQNPEANDQGLEYEPPDLIDHKNDWKIRKLRDSYTRKCLQLAFWGKLSNKLL 369

Query: 393  APNSPLKNTKSVKGLSCLQTSFSSLPWFHLLGESRSRILLNSNESHSPLDAEPHFVNLSV 452
            +  +  K  KS +  + + T  S+   F +  +S +R L   + S SPLD   HF+NLS 
Sbjct: 370  SKANIQKYEKSYRFFNKMHTHTSTTALFQIFNDS-ARRLQQDDTSASPLDNNYHFINLSS 428

Query: 453  SHYYTDRDIIRNYESLSSLDPKNIGLYFDALTYIANRKGAYQLIAYCGKQDIIGQEALEN 512
            S+YYTDRDII+NYE+L ++D  N G+YFDALTYIAN KG+YQLI+YCGKQD++GQE L+N
Sbjct: 429  SYYYTDRDIIQNYETLCNIDTNNKGIYFDALTYIANTKGSYQLISYCGKQDVVGQEVLQN 488

Query: 513  ALLVFKIEPKECNIAELNEATLLSIYKFETSNKSQVTSGHLTNLKNALRLLAKYTKSDKL 572
            +L V  ++    +I  LN++ L SIYK E  N S+     LT LK+A+R++ K  +S KL
Sbjct: 489  SLRVLGLDATSVDIKSLNDSLLFSIYKQE-QNASRGDMQRLTELKSAMRVMIKLMRSKKL 547

Query: 573  KFYVDHEPYRALSQAYDTLSIDESVDEDIIKTAYSVKINDSPGLKLDCDRALYTIAISKK 632
            +F++DHEPY  +  AY+ L IDESVD+DI++TAY+++INDSPGLK+DCD+ALYTIAI  +
Sbjct: 548  QFFIDHEPYPNVMDAYNLLDIDESVDDDIVQTAYTIRINDSPGLKMDCDKALYTIAIRTR 607

Query: 633  SLDLFNFLTDECPQFLTYYGAEQLDYQEALKLLQVNENASDETILKIFKQKWFDESVYEP 692
            S+ LFNFL ++CP F+TYYG + L +Q+AL LLQVNENA+DE ++KIF+Q+W  + + E 
Sbjct: 608  SITLFNFLMEQCPDFITYYGPDCLSFQQALSLLQVNENATDELVIKIFQQRWGQKILNEY 667

Query: 693  DQFLTLKAALTKISIERNSNLISNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQY 752
            DQ L LKAALTKI+ E+NS LIS FL TG ID N L PENWP G+NNIGNTCYLNSLLQY
Sbjct: 668  DQLLILKAALTKIASEKNSKLISYFLETGVIDANLLQPENWPIGLNNIGNTCYLNSLLQY 727

Query: 753  YFSIAPLRRYILDYQKTVENFNDHLSNSGHVRRIGGRKISKGEVERSVQFIYQLRNLFYA 812
            YFSIAPLR YIL+Y+ ++ N+   +  + + RRIGGR++S+ EVERS+QF+YQLR+LF  
Sbjct: 728  YFSIAPLREYILNYKGSISNY--EIDETSNKRRIGGREVSENEVERSIQFMYQLRDLFND 785

Query: 813  MVHSRERCVTPSKELAYLAFAPSNIEVEFEVEGNKPADGAAIPIGLKEEATQESCTTKEN 872
            M++S+ RC+TP  ELAYLAFAPSNIEVEF          AA  +   E  T +    KE 
Sbjct: 786  MIYSKSRCITPKHELAYLAFAPSNIEVEF----------AASEV---ERTTVDLPFDKEG 832

Query: 873  DPKSIGSKMEDNTNRDTHRNPSNTEKNEPNNVQIVGGD------DTTDLNSLTRVAKISS 926
            D   +              + SN   N  NN Q V  D      D    N+ T+ AKISS
Sbjct: 833  DIDLV--------------DLSNDNLNTTNNAQEVTSDISVATEDKVMTNTSTKTAKISS 878

Query: 927  DQLENALEMGRQQDVTECIGNVLFQIESGSEPIKYDEDNEQYDLVKQLFYGTTKQSIVPL 986
            DQLENALEMGRQQDVTECIGNVL+Q+ES S+PIK DED EQYDL+K+LFYG TKQ IVPL
Sbjct: 879  DQLENALEMGRQQDVTECIGNVLYQMESASKPIKLDEDFEQYDLIKELFYGKTKQEIVPL 938

Query: 987  SATNKVRTKVERFLSLLINIGDHPKDIYDAFDSYFKDEYLTMEEYGDVTRTVAVTTFPTI 1046
            S  +K RTK E F SLL+NI DHP+DIYDA +S F  E+L M+EYGDV RTV++T FP I
Sbjct: 939  SDISKTRTKYEGFSSLLVNISDHPRDIYDALESSFASEFLKMDEYGDVQRTVSITNFPKI 998

Query: 1047 LQVQIQRVYYDRERFMPFKSIEPLPFKEVIYMDRYADTENPLLLAKKNETEEMKQKLRVM 1106
            LQ+QIQRVYYDRERFMPFKSIEPLPF   IYMDRYA  +N LL  KKNET+E++ KL+ +
Sbjct: 999  LQIQIQRVYYDRERFMPFKSIEPLPFSNTIYMDRYAALDNELLQTKKNETKELRNKLKTL 1058

Query: 1107 KNRQRELLSRDNSGLTRKDAFLESIKLL-ESSVVEKTTLKTEVKIDVINTLRTNVNNIDN 1165
            K RQ ELL+R+  GL+RK+++LE+I  L + + V    L    +  +I  LR  ++NID+
Sbjct: 1059 KARQVELLNRNELGLSRKESYLETINFLSDEATVTSQGLSVLNRGQIIEKLRKAISNIDS 1118

Query: 1166 ELMSLYNNINNLEEKISHQFDDFKEYGYSLFSVFIHRGEASYGHYWIYIKDRNHNGVWRK 1225
            EL  +Y+ IN +E KI HQFD+F++ GYSLF+VFIHRGEASYGHYW+YIKD   +G+WRK
Sbjct: 1119 ELSQIYDEINLIENKIDHQFDEFRDIGYSLFAVFIHRGEASYGHYWVYIKDPERSGIWRK 1178

Query: 1226 YNDETVSEVQEDEVFNFNEGNTATPYFLVYVKQGQEADIEPLKRIL 1271
            YNDETV+EV E+EVFNF EGNTATPYFLV+VK   + DIEPLKRI+
Sbjct: 1179 YNDETVTEVNEEEVFNFTEGNTATPYFLVFVKDYYKGDIEPLKRII 1224

>TBLA0A06470 Chr1 (1588461..1592423) [3963 bp, 1320 aa] {ON} Anc_5.443
            YOR124C
          Length = 1320

 Score = 1298 bits (3358), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 655/1269 (51%), Positives = 894/1269 (70%), Gaps = 64/1269 (5%)

Query: 54   DDGKHLLYPDIATSLPLKTSDRLLDDILCD---TIFLNSTD------------------- 91
            DDGKH+LY   +     KT+DRLLDD++ D    +F NS++                   
Sbjct: 62   DDGKHILYDSFSNHSFFKTADRLLDDLMIDLSYMLFNNSSEHINDNNNNNDNNHNNNNNT 121

Query: 92   ----PSVIEKGLQTTGILRESMLSYSSFRSSIRPNALGSVTDQVVIQTKIEYDSYSCPKY 147
                    E      GILR     YS  R S    A+G++ DQ+ +QT+ E+ S +CP++
Sbjct: 122  SNSNNDTNEIKTYINGILRLPSHQYSKDRYSKFTFAMGTIVDQINLQTRFEFKSVTCPEF 181

Query: 148  NKIHVFQAVILNPSLTEQHVSSFDDIVKIPIYHLKVTVKIRQELERLKKHVGVTQFHSID 207
            N +HV   V+++ + ++  + +F     +P+YH K+TVK R  LE+ KKHVG++ FH ID
Sbjct: 182  NDVHVLLGVLMD-NRSQAPLGTF-----LPVYHFKITVKTRSYLEKTKKHVGISHFHLID 235

Query: 208  F--LHEYDRVDF--STFDSSDPNLMDYGIYVSDDTNKLILIEIFKPEFDSPEEHESFTIN 263
            F  LHE+D+ D   +  D +  +L+D  I++S+DTNKL+++EIFKPEF+  EE ESF+  
Sbjct: 236  FDDLHEFDKKDLEITNHDINKKSLLDSAIFISEDTNKLVMLEIFKPEFNELEEIESFSQE 295

Query: 264  AIKRRYSDMCLNNESLDKNNTPSQADCFYTLFKIFKGPLTRKSKTEPVKTIDSGNLALNT 323
            +I  RY + C    +LD+   P+Q +C  T+FKIFKGPL  K+  EP+K I++ N  LN+
Sbjct: 296  SIAERYINACSRFPNLDQQKIPTQLECLNTVFKIFKGPLNHKNINEPLKAINADNPLLNS 355

Query: 324  HLNPEWLTSKYGFQVSSEIDEETNERFTEYLPPDMVDYVDDLKVRKIRESFVRKCLQLLF 383
            H NP WL +KYGF  + + + +T E F EYLPP++ DY++D+  R +RES++RKCL+L+F
Sbjct: 356  HWNPNWLLTKYGFIETLDNNPDTQEEFKEYLPPNLADYINDINTRALRESYIRKCLELIF 415

Query: 384  WGQLSTSLLAPNSPLKNTKSVKGLSCLQTSFSSLPWFHLLGESRSRILLNSNESHSPLDA 443
              + + SL+ PN    N+K+++  + LQT F++  W   L E + ++     ++++ LD 
Sbjct: 416  ISKRNISLMGPNDLQYNSKAIRSFNILQTVFTTSFWHQFLYEHKPQL-----DTYNKLDY 470

Query: 444  EPHFVNLSVSHYYTDRDIIRNYESLSSLDPKNIGLYFDALTYIANRKGAYQLIAYCGKQD 503
            E H++NL  S YYT+RDIIRNY  L++LDP NIG+Y+DAL YIA  K +YQLI++  KQD
Sbjct: 471  EYHYINLLTSFYYTERDIIRNYNCLTALDPVNIGIYYDALAYIAQSKNSYQLISFVSKQD 530

Query: 504  IIGQEALENALLVFKIEPKECN-IAELNEATLLSIYKFETSNKSQVTSGHLTNLKNALRL 562
            +IGQEAL  AL +F I+  + + I+ L E+ + +IYK E   ++ ++S  L  +KNALRL
Sbjct: 531  VIGQEALNQALTLFNIDNNDSSAISTLTESMIFTIYKTERK-QANISSARLAEMKNALRL 589

Query: 563  LAKYTKSDKLKFYVDHEPYRALSQAYDTLSIDESVDEDIIKTAYSVKINDSPGLKLDCDR 622
            LAKY  SD+LKFY D+EPY + SQ Y+TL +DESVD+DII+TAY++K+ND+PGLK+DCDR
Sbjct: 590  LAKYKHSDRLKFYADYEPYFSASQGYNTLEVDESVDDDIIQTAYTIKVNDAPGLKIDCDR 649

Query: 623  ALYTIAISKKSLDLFNFLTDECPQFLTYYGAEQLDYQEALKLLQVNENASDETILKIFKQ 682
            AL T+A  +KSL LF FL  ECPQF  +YG ++ DY +AL  LQVNENA+DETIL+IF+Q
Sbjct: 650  ALLTVATRRKSLALFKFLLQECPQFTEFYGVDRFDYFQALNTLQVNENATDETILEIFQQ 709

Query: 683  KWFDESVYEPDQFLTLKAALTKISIERNSNLISNFLLTGTIDPNSLPPENWPTGINNIGN 742
            +W ++   + D  L L++AL+KI+ E+NS LISNF+ TG +DP  LP ENWP G+NNIGN
Sbjct: 710  RWSNDKSLDYDSMLNLQSALSKIAYEKNSKLISNFIDTGIVDPTCLPVENWPAGLNNIGN 769

Query: 743  TCYLNSLLQYYFSIAPLRRYILDYQKTVENFNDHLSNSGHV---RRIGGRKISKGEVERS 799
            TCYLNSLLQYYFSI PLR +IL YQ T+++F + +  +  +   RRIGGR++++ EVERS
Sbjct: 770  TCYLNSLLQYYFSIKPLRDFILQYQMTMKHFQNEIVLNKQLEKRRRIGGREVNELEVERS 829

Query: 800  VQFIYQLRNLFYAMVHSRERCVTPSKELAYLAFAPSNIEVEFEVEGNKPADG----AAIP 855
            VQFIYQ+R+LF  M+ S+ RCV+P +ELAYLAF PSNIEVEFE    +   G    A   
Sbjct: 830  VQFIYQVRDLFKEMIFSQMRCVSPRQELAYLAFMPSNIEVEFESASTEDDMGDKSNAQDA 889

Query: 856  IGLKEEATQES--CTTKEN----DPKSIGSKMEDNTNRD-----THRNPSNTEKNEPNNV 904
            + L++EA  ++    T+ N    +P +  S   D    D     T+ +  + E ++ N  
Sbjct: 890  VVLQDEAKNDTDINLTEVNLIDLEPATKVSTSNDQPTMDAIEILTNSDNKSKELSKTNPF 949

Query: 905  QIVGGDDTTDLNSLTRVAKISSDQLENALEMGRQQDVTECIGNVLFQIESGSEPIKYD-E 963
            + V  ++  D+   TRVAKISSDQLENA EMGRQQDVTECIGNVLFQ+E+G +PI  D E
Sbjct: 950  REVSPNE--DITISTRVAKISSDQLENAFEMGRQQDVTECIGNVLFQLETGFDPISLDNE 1007

Query: 964  DNEQYDLVKQLFYGTTKQSIVPLSATNKVRTKVERFLSLLINIGDHPKDIYDAFDSYFKD 1023
            DNEQYDLVK+LFYG TKQSI+PL+  +  R KVERFLSLL+NI DHPKDIYDA + YF D
Sbjct: 1008 DNEQYDLVKELFYGKTKQSIIPLNHNSNERIKVERFLSLLVNITDHPKDIYDALNQYFAD 1067

Query: 1024 EYLTMEEYGDVTRTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKEVIYMDRYAD 1083
            E+LTMEEYGDV +T+++T +P ILQ+QIQRVYYDRERFMPFKSIEPLPF++VIYMDRYA+
Sbjct: 1068 EFLTMEEYGDVKKTLSMTEYPKILQIQIQRVYYDRERFMPFKSIEPLPFEQVIYMDRYAE 1127

Query: 1084 TENPLLLAKKNETEEMKQKLRVMKNRQRELLSRDNSGLTRKDAFLESIKLLESSVVEKTT 1143
            + +P L++KK ET ++K KL+  + RQ+ELLS++  GL+RK+A +E+IK L+S V+ +  
Sbjct: 1128 SSDPELISKKEETAQLKLKLKEYRARQKELLSKNELGLSRKEAMMETIKFLKSPVILENG 1187

Query: 1144 LKTEVKIDVINTLRTNVNNIDNELMSLYNNINNLEEKISHQFDDFKEYGYSLFSVFIHRG 1203
            + T  K  ++  L+  V+ I+NEL +LYN IN L+ +I HQFDDFK+  YSLF+VFIHRG
Sbjct: 1188 IDTTNKDVLVRELQQYVDGINNELSNLYNKINQLQNRIDHQFDDFKKLAYSLFAVFIHRG 1247

Query: 1204 EASYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNFNEGNTATPYFLVYVKQGQEAD 1263
            EASYGHYW+YIKD + NG+WRKYNDE+V+EV E EVFNF EGNTATPYFLVYVKQ   +D
Sbjct: 1248 EASYGHYWVYIKDHSKNGIWRKYNDESVTEVPEQEVFNFTEGNTATPYFLVYVKQDSLSD 1307

Query: 1264 IEPLKRILQ 1272
            IEPLKRI+Q
Sbjct: 1308 IEPLKRIIQ 1316

>KLTH0F15862g Chr6 (1288742..1292467) [3726 bp, 1241 aa] {ON} similar
            to uniprot|Q01476 Saccharomyces cerevisiae YOR124C UBP2
            Ubiquitin-specific protease that removes ubiquitin from
            ubiquitinated proteins cleaves at the C terminus of
            ubiquitin fusions capable of cleaving polyubiquitin and
            possesses isopeptidase activity
          Length = 1241

 Score = 1271 bits (3289), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 644/1249 (51%), Positives = 872/1249 (69%), Gaps = 36/1249 (2%)

Query: 36   ECPLYETSASHQSAPVD----------FDDGKHLLYPDIATSLPLKTSDRLLDDILCDTI 85
            E P+YE + S  S P+D           D+GK LLYPD  +  P KTS+RLLD+I  +  
Sbjct: 9    EAPVYEPADSI-SKPIDDGGLEDGGSTQDNGKALLYPDAGSLFPFKTSERLLDEIKAELA 67

Query: 86   FLNSTDPSVIEKGLQTTGILRESMLSYSSFRSSIRPNALGSVTDQVVIQTKIEYDSYSCP 145
            + NS    ++   L + G+L+  +L YS  +    P ++G + DQVV++T+ EY+S +CP
Sbjct: 68   YRNSNGHDILYSALHS-GVLKLPVLEYSR-KPVPDPFSIGHLLDQVVLKTRYEYESRTCP 125

Query: 146  KYNKIHVFQAVILNPSLTEQHVSSFDDIVKIPIYHLKVTVKIRQELERLKKHVGVTQFHS 205
              NK+ VF  V+++PS+  +     +D+   PIYHLK+TVK R  LE  +K  GV Q+H 
Sbjct: 126  GLNKVSVFMGVLVSPSIVPREP---EDLAAAPIYHLKLTVKTRMHLEHTRKQAGVCQYHM 182

Query: 206  IDFLHEYDRVDFSTFDSSDPNLMDYGIYVSDDTNKLILIEIFKPEFDSPEEHESFTINAI 265
            +  LH  D+ D    + SDP+L+D  +YVS DTNKL+ IEIFKPEF S E+  +F+ ++I
Sbjct: 183  LSELHPSDKQDLFLAEESDPSLLDSAMYVSSDTNKLVCIEIFKPEF-SHEDLATFSPDSI 241

Query: 266  KRRYSDMCLNNESLDKNNTPSQADCFYTLFKIFKGPLTRKSKTEPVKTIDSGNLALNTHL 325
            +RR+++ C     LD    PSQA+CF TL KIFKGPL R+S  + +KTI + N  LN+ +
Sbjct: 242  RRRFAEACGKFPDLDPEKVPSQAECFSTLLKIFKGPLNRRSPDDVLKTISADNKFLNSQI 301

Query: 326  NPEWLTSKYGFQVSSEIDEETNERFTEYLPPDMVDYVDDLKVRKIRESFVRKCLQLLFWG 385
             P WLT ++ FQ+      E  E   EY PPD+ DYV++L VRK+RE + RKCL+L+F G
Sbjct: 302  EPAWLTERFQFQLCETQASEEPETALEYQPPDLTDYVNNLSVRKLREEYTRKCLELVFLG 361

Query: 386  QLSTSLLAPNSPLKNTKSVKGLSCLQTSFSSLPWFHLLGESRSRILLNSNESHSPLDAEP 445
            +++ +L++ +   +++++ +     Q S+S   +FHLLGE+R  +   + E    +D   
Sbjct: 362  KMAVALMSKDDVAQDSRA-RSFHLYQISYSPSFFFHLLGETRGVMDYGTQE----IDKNY 416

Query: 446  HFVNLSVSHYYTDRDIIRNYESLSSLDPKNIGLYFDALTYIANRKGAYQLIAYCGKQDII 505
            HF+NLS  HYY+D+DII+NYE+ + LDP+NIG+YFDAL +IAN KG+YQLI YC KQD++
Sbjct: 417  HFINLSACHYYSDKDIIKNYETQARLDPENIGIYFDALNFIANFKGSYQLITYCRKQDVV 476

Query: 506  GQEALENALLVFKIEPKECNIAELNEATLLSIYKFETSNKSQVTSGHLTNLKNALRLLAK 565
            G+EAL++AL +F I+  + +++ + +  LL IY+ E+S  SQ      ++LKN+LRL+AK
Sbjct: 477  GKEALDSALSLFGIDASDTDLSTVPDDLLLGIYRKESSQASQQKR---SSLKNSLRLIAK 533

Query: 566  YTKSDKLKFYVDHEPYRALSQAYDTLSIDESVDEDIIKTAYSVKINDSPGLKLDCDRALY 625
              KS  L+FY  +EPY    QAY  L ++ESVD DII+TAY+VK+ DSPGLK+DCDRA+Y
Sbjct: 534  AKKSQILQFYTAYEPYDNTYQAYSLLEVNESVDVDIIQTAYTVKVTDSPGLKIDCDRAIY 593

Query: 626  TIAISKKSLDLFNFLTDECPQFLTYYGAEQLDYQEALKLLQVNENASDETILKIFKQKWF 685
            TIA+S++S+ LFNFL ++CP F  +Y A++L YQEAL LLQVNENASD+ IL++F++KW 
Sbjct: 594  TIAVSRRSMPLFNFLAEQCPAFNEFYSADKLTYQEALNLLQVNENASDDVILEVFQRKWH 653

Query: 686  DESVYEPDQFLTLKAALTKISIERNSNLISNFLLTGTIDPNSLPPENWPTGINNIGNTCY 745
             E V  PDQFL   +ALTKI   RNS LI+ +L TG ID + LP  NWPTG+NNIGNTCY
Sbjct: 654  QEPVSSPDQFLISSSALTKIGQVRNSLLINRYLETGIIDVSCLPAGNWPTGLNNIGNTCY 713

Query: 746  LNSLLQYYFSIAPLRRYILDYQKTVENFNDHLSNSGHVRRIGGRKISKGEVERSVQFIYQ 805
            LNSLLQYYF I+PLR+ I++YQKT+  F+  + +    RRIGGR++S+ EVERS+QF+YQ
Sbjct: 714  LNSLLQYYFCISPLRQSIVEYQKTLSEFHQSIGHLESKRRIGGREVSEAEVERSIQFVYQ 773

Query: 806  LRNLFYAMVHSRERCVTPSKELAYLAFAPSNIEVEFEVEGNKPADGAAIPIGLKEEATQE 865
            LR+LF  MVH+  R VTP+KELAYLAFAPSNIEVEFE     P+ G+      +EE   +
Sbjct: 774  LRDLFTDMVHTENRYVTPTKELAYLAFAPSNIEVEFE---GTPSSGSVGEAEDEEEGAIK 830

Query: 866  SCTTKENDPKSIGSKMEDNTNRDTHRNPSNTEKNEPNNVQIVGGDDTTD----LNSLTRV 921
              TT+  D  S+ +  +D    D    PS +E      V     D   D    + + TRV
Sbjct: 831  E-TTEVIDLTSVPNAEQDIEMLDP--VPSESEMIVEQFVDSPKDDKKQDAAEAIGTSTRV 887

Query: 922  AKISSDQLENALEMGRQQDVTECIGNVLFQIESGSEPIKYDEDNEQYDLVKQLFYGTTKQ 981
            AKISSDQLENALEMGRQQDVTECIGNVLFQ+ES SEP   D D EQ DL+KQLF+G  +Q
Sbjct: 888  AKISSDQLENALEMGRQQDVTECIGNVLFQLESASEPTCLDTDGEQQDLIKQLFFGKLRQ 947

Query: 982  SIVPLSATNKVRTKVERFLSLLINIGDHPKDIYDAFDSYFKDEYLTMEEYGDVTRTVAVT 1041
             + PL+   KVRTK+ERF+SLL+N+GDHPKD+YDA D YFK++ L +E+ GDV R+VA+ 
Sbjct: 948  VLTPLNDPTKVRTKIERFVSLLVNVGDHPKDVYDALDQYFKNDVLQLED-GDVNRSVAIK 1006

Query: 1042 TFPTILQVQIQRVYYDRERFMPFKSIEPLPFKEVIYMDRYADTENPLLLAKKNETEEMKQ 1101
              P +LQ+QIQRVYYDRERFMPFKSIEPLPF++ IYMDRY DTE+P++L K+ E   +K+
Sbjct: 1007 ELPAVLQIQIQRVYYDRERFMPFKSIEPLPFEDSIYMDRYMDTEDPVMLKKREEAATLKK 1066

Query: 1102 KLRVMKNRQRELLSRDNSGLTRKDAFLESIKLLESSVVEKTTLKTEVKIDVINTLRTNVN 1161
            +L  +K +QR LL ++ SG++ K + LE+ + L+S V+E   +++  K   I T+ + + 
Sbjct: 1067 ELVTLKEKQRSLLDKNGSGMSFKSSLLETKRFLQSDVLENNDIESPNKEQSIQTIDSMLL 1126

Query: 1162 NIDNELMSLYNNINNLEEKISHQFDDFKEYGYSLFSVFIHRGEASYGHYWIYIKDRNHNG 1221
             ID EL S+Y+ I  LE+K+S  FDDFK+ GYSLF+VFIHRGEASYGHYWIYIKD   NG
Sbjct: 1127 KIDEELASVYHRIAFLEQKLSSHFDDFKQEGYSLFAVFIHRGEASYGHYWIYIKDSGKNG 1186

Query: 1222 VWRKYNDETVSEVQEDEVFNFNEGNTATPYFLVYVKQGQEADIEPLKRI 1270
            +WRKYNDE+V+E  E EVFNF+EGNTATPYFLVYVK GQE+ IEPL R+
Sbjct: 1187 IWRKYNDESVTEAPESEVFNFSEGNTATPYFLVYVKNGQESQIEPLHRV 1235

>Kwal_55.21393 s55 (816177..819878) [3702 bp, 1233 aa] {ON} YOR124C
            (UBP2) - Ubiquitin-specific protease [contig 130] FULL
          Length = 1233

 Score = 1261 bits (3262), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 639/1227 (52%), Positives = 857/1227 (69%), Gaps = 43/1227 (3%)

Query: 54   DDGKHLLYPDIATSLPLKTSDRLLDDILCDTIFLNSTDPSVIEKGLQTTGILRESMLSYS 113
            D GK LLY D     P KTS+RLLDDI  +  + NS +  ++   L   G+LR  +L YS
Sbjct: 36   DTGKTLLYADAGNLFPFKTSERLLDDIKLELAYKNSIEHDILYSELHK-GVLRLPILEYS 94

Query: 114  SFRSSIRPNALGSVTDQVVIQTKIEYDSYSCPKYNKIHVFQAVILNPSLTEQHVSSFDDI 173
               +    N +G + DQVV++T+ EYDS +CP  NKI VF  V+LN S   Q    +DD+
Sbjct: 95   RKPTDDVYN-IGHLVDQVVLKTRYEYDSKTCPGLNKITVFMGVLLNSS---QMPKIYDDV 150

Query: 174  VKIPIYHLKVTVKIRQELERLKKHVGVTQFHSIDFLHEYDRVDFSTFDSSDPNLMDYGIY 233
             +  +YHLKVTVK R  LER +K  GV Q+H +  LH +D+ D    D+ DP+L+D  +Y
Sbjct: 151  TQASVYHLKVTVKTRLHLERTRKQAGVPQYHLLPELHPFDKEDLLLTDAEDPHLIDSVMY 210

Query: 234  VSDDTNKLILIEIFKPEFDSPEEHESFTINAIKRRYSDMCLNNESLDKNNTPSQADCFYT 293
            VS DTNKLI IEIFKPEF   +  E F  +AIK+RYS  C     LD +  PSQA+CF T
Sbjct: 211  VSSDTNKLICIEIFKPEFSQADLTE-FCPDAIKKRYSSACDKYPDLDPDMIPSQAECFST 269

Query: 294  LFKIFKGPLTRKSKTEPVKTIDSGNLALNTHLNPEWLTSKYGFQVSSEIDEETNERFTEY 353
            L KIFKGPL R+   + +KTI + N  LN+ L+P+WLT K+ F++    D +      E+
Sbjct: 270  LLKIFKGPLNRRGPEDVLKTISADNKFLNSQLDPKWLTEKFAFKLCQANDTDEAGSAMEF 329

Query: 354  LPPDMVDYVDDLKVRKIRESFVRKCLQLLFWGQLSTSLLAPNSPLKNTKSVKGLSCLQTS 413
             PPD+ +YVDD+ VR++RES+ RKCL+L+F G++S+SL+      K++++ +     QTS
Sbjct: 330  QPPDLTNYVDDVSVRELRESYTRKCLELIFLGKMSSSLMTKEDIAKDSRA-RSFQLYQTS 388

Query: 414  FSSLPWFHLLGESRSRILLNSNESHSPLDAEPHFVNLSVSHYYTDRDIIRNYESLSSLDP 473
             S   +FHLL E+R  +   S E    +D   +F+NLS  +YYTD+DII+NYE+ + LD 
Sbjct: 389  NSLSFFFHLLNETRGVMDYGSQE----IDRNYNFMNLSSCYYYTDKDIIKNYETQALLDR 444

Query: 474  KNIGLYFDALTYIANRKGAYQLIAYCGKQDIIGQEALENALLVFKIEPKECNIAELNEAT 533
            +NIG+YFDALTYIAN KG+Y LIAYC KQD++G+EAL++AL +F I+P + ++  + +  
Sbjct: 445  ENIGIYFDALTYIANLKGSYALIAYCRKQDVVGKEALDSALSLFGIDPSDTSLMTIPDEL 504

Query: 534  LLSIYKFETSNKSQVTSGHLTNLKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDTLSI 593
            LL +Y+ E S  S  T  H T LKNALRLLAK   S  L+FY  +EPY  + QAY  L +
Sbjct: 505  LLGVYRKECSQGS--TQKHAT-LKNALRLLAKAKNSSTLQFYAAYEPYDNVHQAYSLLEV 561

Query: 594  DESVDEDIIKTAYSVKINDSPGLKLDCDRALYTIAISKKSLDLFNFLTDECPQFLTYYGA 653
            DESVD D+I+TAY++K+ DSPGLK+DCDRA+YT+A++K+S+ LFNFL ++CP F  +Y A
Sbjct: 562  DESVDVDVIQTAYTIKVADSPGLKIDCDRAIYTLAVTKRSMPLFNFLVEQCPVFEEFYSA 621

Query: 654  EQLDYQEALKLLQVNENASDETILKIFKQKWFDESVYEPDQFLTLKAALTKISIERNSNL 713
            ++L Y +AL LLQVNENASD+ IL++F++KW  E+V  PDQFL   +ALTKI   RNS L
Sbjct: 622  DKLTYHDALSLLQVNENASDDIILEVFQRKWNHETVLSPDQFLKSSSALTKIGQVRNSLL 681

Query: 714  ISNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYILDYQKTVENF 773
            I+ +L TGTID   LP  NWPTG+NNIGNTCYLNSLLQYYF I+PLR++I+DYQKT+  F
Sbjct: 682  INRYLETGTIDVRCLPARNWPTGLNNIGNTCYLNSLLQYYFCISPLRQFIVDYQKTLAEF 741

Query: 774  NDHLSNSGHVRRIGGRKISKGEVERSVQFIYQLRNLFYAMVHSRERCVTPSKELAYLAFA 833
            +D + N G  RRIGGR++S+ EVERSVQF+YQLR+LF  M+H+  R VTP KELAYLAFA
Sbjct: 742  HDSIGNLGSKRRIGGREVSESEVERSVQFVYQLRDLFTDMIHTESRFVTPRKELAYLAFA 801

Query: 834  PSNIEVEFE-------VEGNKPADGAAIPIGLKEEATQESCTTK--ENDPKSIGSKMEDN 884
            PSNIEVEFE        + N   D   I +  + EA+++    K  E++ + + +++   
Sbjct: 802  PSNIEVEFEGTPTVEPAKENSENDVEVIDLTAEGEASEDVDMLKPAESETQVVTTQL--- 858

Query: 885  TNRDTHRNPSNTEKNEPNNVQIVGGDDTTDLNSLTRVAKISSDQLENALEMGRQQDVTEC 944
             N DT  N  +    EP             + S TRVAKIS+DQLENALEMGRQQDVTEC
Sbjct: 859  -NEDTVMN--DVIATEP-------------MVSSTRVAKISTDQLENALEMGRQQDVTEC 902

Query: 945  IGNVLFQIESGSEPIKYDEDNEQYDLVKQLFYGTTKQSIVPLSATNKVRTKVERFLSLLI 1004
            IGNVLFQ+ES S+PI  D D EQ DL+K+LF+G  KQ + PL   +K+RTK+ERF+SLL+
Sbjct: 903  IGNVLFQLESASDPINLDSDGEQRDLIKELFFGKLKQDLAPLKDPSKIRTKIERFVSLLV 962

Query: 1005 NIGDHPKDIYDAFDSYFKDEYLTMEEYGDVTRTVAVTTFPTILQVQIQRVYYDRERFMPF 1064
            N+GDHPK++YDA D YFKD+ L +E+ GDV RT+A+   P +LQ+QIQRVYYDRE+FMPF
Sbjct: 963  NVGDHPKNVYDALDQYFKDDVLQLED-GDVKRTLAIKELPVVLQIQIQRVYYDREKFMPF 1021

Query: 1065 KSIEPLPFKEVIYMDRYADTENPLLLAKKNETEEMKQKLRVMKNRQRELLSRDNSGLTRK 1124
            KSIEPLPF++ IYMDRY DT++  +  K+ E  + K +L  +K RQ+ LL ++ +G++ K
Sbjct: 1022 KSIEPLPFRDTIYMDRYMDTQDAEMQQKRQEAAKYKNELESLKLRQKALLEKNGNGMSFK 1081

Query: 1125 DAFLESIKLLESSVVEKTTLKTEVKIDVINTLRTNVNNIDNELMSLYNNINNLEEKISHQ 1184
             + LE+ + LES V+E+  ++ + K   +  + + +  IDNEL  +Y+ I  L++K+S  
Sbjct: 1082 TSLLETERFLESGVLEQNAIEIQKKDSALKAIESMLLKIDNELSEIYSRITALDQKLSSH 1141

Query: 1185 FDDFKEYGYSLFSVFIHRGEASYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNFNE 1244
            FD+FKE GYSLF+VFIHRGEASYGHYW+YIKD N NG+WRKYNDETV+E  E+EVFNF E
Sbjct: 1142 FDNFKELGYSLFAVFIHRGEASYGHYWLYIKDHNRNGIWRKYNDETVTEAPENEVFNFTE 1201

Query: 1245 GNTATPYFLVYVKQGQEADIEPLKRIL 1271
            GNTATPYFLVYVK G E++I+PL R++
Sbjct: 1202 GNTATPYFLVYVKNGHESEIQPLHRVI 1228

>TPHA0E01710 Chr5 (343977..347828) [3852 bp, 1283 aa] {ON} Anc_5.443
            YOR124C
          Length = 1283

 Score = 1257 bits (3252), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 647/1237 (52%), Positives = 865/1237 (69%), Gaps = 40/1237 (3%)

Query: 52   DFDDGKHLLYPDIATSLPLKTSDRLLDDILCDTIFLNSTDPSVIEKGLQ-----TTGILR 106
            + DDG  LLY ++    PLKTS+R+LDDIL +   +   +       L+        IL+
Sbjct: 66   ELDDGSKLLYQNLMNMSPLKTSERILDDILSNIPLMKVINSKENCNTLRYNEQFNNSILK 125

Query: 107  ESMLSYSSFRSSIRPNALGSVTDQVVIQTKIEYDSYSCPKYNKIHVFQAVILNPSLTEQH 166
            + M+ YS  R+++ P+++GS+ DQ+VIQ+K EY S +CP +NKI VF  V+++ +   Q 
Sbjct: 126  QPMIEYSKLRATVHPDSIGSIVDQIVIQSKFEYKSVTCPNHNKIEVFMGVLIDST---QK 182

Query: 167  VSSFDDIVKIPIYHLKVTVKIRQELERLKKHVGVTQFHSIDFLHEYDRVDFSTFDSSDPN 226
             ++ DD+  I I H+K+TVK R  LER ++ +G+++FH +  LH +D+ D  TFD +  N
Sbjct: 183  ANTLDDLSNIIINHVKITVKTRTVLERTRRLMGLSKFHLVKELHPFDQKDLLTFDKNAAN 242

Query: 227  LMDYGIYVSDDTNKLILIEIFKPEFDSPEEHESFTINAIKRRYSDMCLNNESLDKNNTPS 286
            L+D+ IYVS+DTNKLILIEIF PEFDS EE   FT N I +RY       E     + P+
Sbjct: 243  LIDHAIYVSEDTNKLILIEIFNPEFDSQEERGLFTPNVINQRYLHSLAEGEEPSTEDIPT 302

Query: 287  QADCFYTLFKIFKGPLTRKSKTEPVKTIDSGNLALNTHLNPEWLTSKYGFQVSSEIDEET 346
              +C  TLFK+FKGPLTRKS  +P+K I+S N  L  H+NPEWL SKYGF +  E D ET
Sbjct: 303  GIECINTLFKVFKGPLTRKSSNDPIKRINSDNPILRLHMNPEWLVSKYGFNMVLEKDVET 362

Query: 347  NERFTEYLPPDMVDYVDDLKVRKIRESFVRKCLQLLFWGQLSTSLLAPNSPLKNTKSVKG 406
             + FTEY PPD+ DYV + + RKIRES  RKCL+L+F+G++  +LL+     K++KS++ 
Sbjct: 363  GDEFTEYEPPDLTDYVSNQQTRKIRESVTRKCLELIFFGKMMINLLSKEELEKSSKSLRT 422

Query: 407  LSCLQTSFSSLPWFHLLGESRSRILLNSNESHSPLDAEPHFVNLSVSHYYTDRDIIRNYE 466
             + LQTSFS+  +F LL + R   L   N+S+  +D   HF+NLSVS++Y++RDII+ +E
Sbjct: 423  FNLLQTSFST-SFFKLLIQERGVGLPIENQSNYNIDY--HFINLSVSYHYSERDIIQMFE 479

Query: 467  SLSSLDPKNIGLYFDALTYIANRKGAYQLIAYCGKQDIIGQEALENALLVFKIEPKECNI 526
             +S +DP NIG Y+D+L +IAN KG+YQLIAYC K DI+GQE+LE A+  F ++     +
Sbjct: 480  VISKVDPDNIGHYYDSLQFIANAKGSYQLIAYCSKLDIVGQESLETAIKTFNLDLSVTAL 539

Query: 527  AELNEATLLSIYKFETSNKSQVTSGHLTNLKNALRLLAKYTKSDKLKFYVDHEPYRALSQ 586
            + L ++ ++SIY+ E  NKS     H+ NL+NAL++LA Y KS KLKF+VD+EPY     
Sbjct: 540  SSLEDSVIMSIYQAELKNKSLSQERHV-NLRNALQVLASYKKSKKLKFFVDYEPYLNTRT 598

Query: 587  AYDTLSIDESVDEDIIKTAYSVKINDSPGLKLDCDRALYTIAISKKSLDLFNFLTDECPQ 646
            AY+ L IDES+D+DII+TAYS+K+ND+PGLKLDCDRALYTIAI+++S+ LFNFL +    
Sbjct: 599  AYNMLEIDESIDDDIIQTAYSIKVNDAPGLKLDCDRALYTIAIARRSISLFNFLLENNLI 658

Query: 647  FLTYYGAEQLDYQEALKLLQVNENASDETILKIFKQKWFDESVYEPDQFLTLKAALTKIS 706
            F  YY A+   Y  AL LLQVNENASDE IL++F++KWF+E++   D  L LKAALTKI+
Sbjct: 659  FQEYYTADTFSYTSALSLLQVNENASDENILEVFQKKWFEEAMVAFDHLLKLKAALTKIA 718

Query: 707  IERNSNLISNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYILDY 766
             +RNS LISNFL TG IDP+ LP ENWPTG+NNIGNTCYLNSLLQYYF+I+PLR  I++Y
Sbjct: 719  FQRNSKLISNFLETGVIDPSCLPAENWPTGLNNIGNTCYLNSLLQYYFAISPLRDEIINY 778

Query: 767  QKTVENFNDHLSNSGHVRRIGGRKISKGEVERSVQFIYQLRNLFYAMVHSRERCVTPSKE 826
             KTV++  ++L   G  RR+GGR  +  EVERSVQF+YQLR+LF  M++S  RCVTP KE
Sbjct: 779  TKTVDDIENNLQLQGITRRVGGRVTNTIEVERSVQFVYQLRDLFSEMIYSHSRCVTPKKE 838

Query: 827  LAYLAFAPSNIEVEFEVEGNKPADGAAIPIGLKEEATQESCTTKENDPKSIGSKMEDNTN 886
            LAYLAFAPSN+EVEF+ E  K              + +++ +T+  D  + G    DN  
Sbjct: 839  LAYLAFAPSNVEVEFDSEDGK--------------SQRDNISTETVDVGADGKN--DNLL 882

Query: 887  RDTHRNPSNTEKNEPNNVQI-------VGGDDTTDLNSL-----TRVAKISSDQLENALE 934
             D   N     ++E   V +       +  ++   +N+L     TRVAKIS DQLENALE
Sbjct: 883  VDFDSNIGANGRDEKLLVDLDSNISDKIKEEEVKKINTLKPVTSTRVAKISPDQLENALE 942

Query: 935  MGRQQDVTECIGNVLFQIESGSEPIKYDEDNEQYDLVKQLFYGTTKQSIVPLSATNKVRT 994
            MGRQQDVTECIGNVL Q+ES S P+  D+D EQ DL+K  F   TKQSI+PL  +   R 
Sbjct: 943  MGRQQDVTECIGNVLNQLESASIPLSLDDDEEQNDLLKNCFLVKTKQSIIPLEKSKPPRN 1002

Query: 995  KVERFLSLLINIGDHPKDIYDAFDSYFKDEYLTMEEYGDVTRTVAVTTFPTILQVQIQRV 1054
            K+ERFLSLL+NIGDHPK+IYDA D YF DE L MEEYG+V +T+++T FP+ILQ+QIQRV
Sbjct: 1003 KIERFLSLLVNIGDHPKNIYDALDLYFNDELLQMEEYGEVRKTLSITEFPSILQIQIQRV 1062

Query: 1055 YYDRERFMPFKSIEPLPFKEVIYMDRYADTENPLLLAKKNETEEMKQKLRVMKNRQRELL 1114
            YYDRE+F+PFKSIEPLPF  V+YMDRYA+ +N  L+  KN+   MK++L  MK RQ+ELL
Sbjct: 1063 YYDREKFIPFKSIEPLPFGNVLYMDRYAELDNKELIDTKNKARIMKKELANMKKRQKELL 1122

Query: 1115 SRDNSGLTRKDAFLESIKLLESSVVEKTTLKTEVKIDVINTLRTNVNNIDNELMSLYNNI 1174
            SR+  GL+RK++ +E+ +LL S V++   +   +K  +I+ +  N+  ID EL +L+NNI
Sbjct: 1123 SRNELGLSRKESLIETKRLLMSDVLDNNGIDVPMKTSLISQIEANLLEIDRELTTLFNNI 1182

Query: 1175 NNLEEKISHQFDDFKEYGYSLFSVFIHRGEASYGHYWIYIKDRNHNGVWRKYNDETVSEV 1234
             ++E  IS+ F +F+   Y+LF+VFIHRGEASYGHYW YIKD   N +WRKYNDET++EV
Sbjct: 1183 RDMELNISNMFKEFQSIKYNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETITEV 1242

Query: 1235 QEDEVFNFNEGNTATPYFLVYVKQGQEADIEPLKRIL 1271
             + EVFNF EGNTATPYFLVYVK     DIEPLKRI+
Sbjct: 1243 PDSEVFNFIEGNTATPYFLVYVKNENIDDIEPLKRIV 1279

>CAGL0K10252g Chr11 complement(998144..1001947) [3804 bp, 1267 aa]
            {ON} similar to uniprot|Q01476 Saccharomyces cerevisiae
            YOR124c UBP2 ubiquitin-specific proteinase
          Length = 1267

 Score = 1251 bits (3236), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 655/1257 (52%), Positives = 878/1257 (69%), Gaps = 68/1257 (5%)

Query: 54   DDGKHLLYPDIATSLPLKTSDRLLDDILCDTIFLNSTDPSVIEKGLQTTGILRESMLSYS 113
            DDG+ LLYP+I T LPLKTSDRLLDDILC   FL S D            IL  + L YS
Sbjct: 39   DDGRQLLYPNIGTHLPLKTSDRLLDDILCSVGFLTSGD---------NKSILNSNTLEYS 89

Query: 114  SFRSSIRPNALGSVTDQVVIQTKIEYDSYSCPKYNKIHVFQAVILNPSLTEQ-HVSSFDD 172
              R  I+ +A+G   DQV+IQTK EY S SCP++NKI V   +++     E+       +
Sbjct: 90   KQRPHIKGSAVGFFQDQVIIQTKYEYPSKSCPEHNKIFVIMGILIGTDYLEKAEKKQISE 149

Query: 173  IVKIPIYHLKVTVKIRQELERLKKHVGVTQFHSIDFLHEYDRVDFSTFDSSDPNLMDYGI 232
            + +IPIYH+K++VK+R  LE  KK VGV++++ +D LH+YDRVDF ++D +D  L+D  +
Sbjct: 150  VTEIPIYHVKISVKVRSILENSKKLVGVSRYYKLDQLHDYDRVDFPSYDPTDSKLLDSAL 209

Query: 233  YVSDDTNKLILIEIFKPEFDSPEEHESFTINAIKRRYSDMCLNNESLDKNNTPSQADCFY 292
            Y +DDTNK++LIEI+KPEFD  ++  S +   IK R++        L K  +P+Q D   
Sbjct: 210  YATDDTNKIVLIEIYKPEFDPEDKDLSVSSVQIKNRFAQAKEKFPQLAKEESPTQLDSIN 269

Query: 293  TLFKIFKGPLTRKSKTEPVKTIDSGNLALNTHLNPEWLTSKYGFQVSSEIDEETNERFTE 352
            TLFK+FKGPL RKS   P K+I++ +  L +++NP  L + +GF  ++E     N    E
Sbjct: 270  TLFKLFKGPLKRKSDDAPQKSIEAEHPLLISNMNPSALVTHFGFTYTNE-----NIPGGE 324

Query: 353  YLPPDMVDYVDDLKVRKIRESFVRKCLQLLFWGQLSTSLLAPN--SPLKNTKSVKGLSCL 410
            Y+ PD+V+Y+ D  ++K+R++F RKCL+L+ +G +  S L  N  S  + +K  + L  +
Sbjct: 325  YMAPDLVNYLGDPNIQKLRDTFTRKCLELIAYGNIIISSLPQNITSTAEFSKKYRILRTI 384

Query: 411  QTSFSSLPWFHLLGESRSR--ILLNSNES-------------HSPLDAEPHFVNLSVSHY 455
            Q  FS   W  LLG+ +SR   LLN NE              +SP D + +F NLSV  +
Sbjct: 385  QPEFSLFSWLQLLGDFKSRNIELLNVNEHKGYHLQEAQKRVYYSPFDIDSNFTNLSVCLH 444

Query: 456  YTDRDIIRNYESLSSLDPKNIGLYFDALTYIANRKGAYQLIAYCGKQDIIGQEALENALL 515
            Y +RDII+NYE L +LD  NIG+YFD+L+ +ANRKG+YQL++YCGKQD+IGQEAL+N+L 
Sbjct: 445  YAERDIIQNYERLITLDEPNIGIYFDSLSVVANRKGSYQLLSYCGKQDVIGQEALQNSLA 504

Query: 516  VFKIEPKECNIAELNEATLLSIYKFETSNKSQVTSGHLTNLKNALRLLAKYTKSDKLKFY 575
            VF I+  +  +  L+E  LLS+YK E   K    +  +++LKNALRLLAKY  SD LKFY
Sbjct: 505  VFGIDYTKVTLESLDENLLLSVYKHEW--KENPDNNRISDLKNALRLLAKYFTSDYLKFY 562

Query: 576  VDHEPYRALSQAYDTLSIDESVDEDIIKTAYSVKINDSPGLKLDCDRALYTIAISKKSLD 635
            VD+EPYR + +AYD L IDESVDEDII+TAY++KIND+PGLK+DCDRALYTIA S++SL 
Sbjct: 563  VDYEPYRIIQKAYDLLEIDESVDEDIIQTAYTIKINDAPGLKIDCDRALYTIAYSRRSLM 622

Query: 636  LFNFLTDECPQFLTYYGAEQLDYQEALKLLQVNENASDETILKIFKQKWFDESVYEPDQF 695
            LFNFL D+CP+F  YYGA+ L Y ++ ++LQ+NEN ++  +L +F+QKW +  + EPDQ 
Sbjct: 623  LFNFLFDQCPEFQRYYGAQSLGYHQSFEILQINENITEPNLLHVFQQKWKNTLLEEPDQL 682

Query: 696  LTLKAALTKISIERNSNLISNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFS 755
            L  +AALTKI++ERNSNL+ NFL TG I+PNSLP ENWPTGINNIGNTCYLNSLLQ+YF+
Sbjct: 683  LKYRAALTKIALERNSNLLLNFLETGNINPNSLPAENWPTGINNIGNTCYLNSLLQFYFA 742

Query: 756  IAPLRRYILDYQKTVENFNDHLSNSGHVRRIGGRKISKGEVERSVQFIYQLRNLFYAMVH 815
            I+PLR YI+ YQKT+ + + +  +    RRIGGR++ K E+ERSVQF+YQLR+L+  M+ 
Sbjct: 743  ISPLREYIVQYQKTIADLSSNPDSIISKRRIGGRQVGKNEIERSVQFLYQLRDLYNDMIF 802

Query: 816  SRERCVTPSKELAYLAFAPSNIEVEFE----------VEG-NKPADGAAIPIGLKEEATQ 864
            S +RCVTP +ELAYLAFAPS+I+VEFE          +EG N   D   +P         
Sbjct: 803  SSQRCVTPKRELAYLAFAPSSIDVEFENAKTKSPISNIEGSNSTTDSQPMP--------- 853

Query: 865  ESCTTKENDPKSIGSKMEDNTNRDTHRNPSNTEKNE----PNNVQIVGGDDTTDLN---- 916
               +T EN   ++  + E+  N + + + +N E N+     ++++++  D   + N    
Sbjct: 854  ---STGENIDHNMDIEQEERNNEEIN-STNNIESNDLVSNNHDIEMLDTDKENEGNMEIE 909

Query: 917  -SLTRVAKISSDQLENALEMGRQQDVTECIGNVLFQIESGSEPIKYDEDNEQYDLVKQLF 975
             +  +VAKI  +QLENALE+GRQQDVTECIGNVLFQ+ES S P    ED+EQ DL+K+LF
Sbjct: 910  DTAIKVAKIDPEQLENALELGRQQDVTECIGNVLFQLESSSSPTSLSEDHEQNDLIKELF 969

Query: 976  YGTTKQSIVPLSATNKVRTKVERFLSLLINIGDHPKDIYDAFDSYFKDEYLTMEEYGDVT 1035
            +G T Q I PL A +  RTKVERF+SLL+NI DHPKD+YDA D YFK+EYLTMEEYG+V 
Sbjct: 970  FGETNQHIKPLKADSVTRTKVERFVSLLVNIADHPKDVYDALDLYFKEEYLTMEEYGEVK 1029

Query: 1036 RTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKEVIYMDRYADTENPLLLAKKNE 1095
            R +A+  FPTILQ+QIQRVYYDRERFMP+KSIEPLPF+  IY+DRYADT++  LL K+ E
Sbjct: 1030 RELAIKKFPTILQIQIQRVYYDRERFMPYKSIEPLPFESDIYLDRYADTDDVKLLQKREE 1089

Query: 1096 TEEMKQKLRVMKNRQRELLSRDNSGLTRKDAFLESIKLLESSVVEKTTLKTEVKIDVINT 1155
            T E+K++LR  K RQ+ELLSR+  GL+R+DA+ E+   L S V++ T +       +   
Sbjct: 1090 TAELKRQLRSFKERQKELLSRNELGLSRRDAYKETANFLRSEVLQNTNISISDPDLLATK 1149

Query: 1156 LRTNVNNIDNELMSLYNNINNLEEKISHQFDDFKEYGYSLFSVFIHRGEASYGHYWIYIK 1215
            L  + + + +EL  LY  I NLEEKI+HQFDDF E+GY+LF+VFIHRGEASYGHYW+YIK
Sbjct: 1150 LEESASKVADELSDLYVKITNLEEKINHQFDDFTEHGYTLFAVFIHRGEASYGHYWVYIK 1209

Query: 1216 DRNHNGVWRKYNDETVSEVQEDEVFNFNEGNTATPYFLVYVKQGQEADIEPLKRILQ 1272
            D   N +WRKYNDETV+EV E+EV NF EGNTATPYF+V+VK+G E DIEPLKR+++
Sbjct: 1210 DF-VNSIWRKYNDETVTEVPEEEVMNFTEGNTATPYFIVFVKKGHEKDIEPLKRMIE 1265

>Ecym_4514 Chr4 complement(1025172..1028912) [3741 bp, 1246 aa] {ON}
            similar to Ashbya gossypii ACL164C
          Length = 1246

 Score = 1176 bits (3043), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 623/1242 (50%), Positives = 836/1242 (67%), Gaps = 57/1242 (4%)

Query: 56   GKHLLYPDIATSLPLKTSDRLLDDILCDTIFLNSTDPSVIEKGLQTTGILRESMLSYSSF 115
            GK +LYP ++ + P KTSDRLLDDI        ST   V+E G++  G+L+  ML YS  
Sbjct: 30   GKTVLYPLVSGNYPFKTSDRLLDDI-------RSTLSFVLE-GVRGNGVLKSPMLDYSKE 81

Query: 116  RSSIRPNALGSVTDQVVIQTKIEYDSYSCP------KYNKIHVFQAVILNPSLTEQHVSS 169
            R  +R  ++G + DQV++QT  EY S          K++KI+VF  ++ +P +    + S
Sbjct: 82   RGELRAWSIGYLLDQVLLQTSYEYASLGGSGGGGGDKHSKINVFMGLLCDPMVK---LCS 138

Query: 170  FDDIVKIPIYHLKVTVKIRQELERLKKHVGVTQFHSIDFLHEYDRVDFSTFDSSDPNLMD 229
             DDIV    YHL+VTVK R  LER K+  G+ Q+H ++ LH  D+ D   F+  D  ++D
Sbjct: 139  EDDIVNYSGYHLRVTVKTRLHLERAKRQFGIAQYHLVNDLHPADKQDLCFFEDDDECVID 198

Query: 230  YGIYVSDDTNKLILIEIFKPEFDSPEEHESFTINAIKRRYSDMCLNNESLDKNNTPSQAD 289
               YVS  TN+L+ IEI KPEF + EE   FT ++I++RY  +C     L++ N P+QA+
Sbjct: 199  SATYVSSGTNRLVRIEILKPEF-TAEEWSEFTPDSIRKRYLSICEKYPDLNRENVPNQAE 257

Query: 290  CFYTLFKIFKGPLTRKSKTEPVKTIDSGNLALNTHLNPEWLTSKYGFQVSSEIDEETNER 349
            C  TLFK+FK PL+R+   + +KTI + N  LN+ L+P WL  K+GF++  E+ EE   +
Sbjct: 258  CLNTLFKVFKNPLSRQDSDDELKTISAENKVLNSQLDPNWLVDKFGFELC-EVQEEDGRK 316

Query: 350  FTEYLPPDMVDYVDDLKVRKIRESFVRKCLQLLFWGQLSTSLLAPNSPLKNTKSVKGLSC 409
              EY PPD  +YV+D  VR +RE ++RK L+LLF G+ S  LL P   +  +  ++    
Sbjct: 317  EYEYKPPDFTNYVNDWNVRHLRERYIRKSLELLFVGKQSIRLL-PKEVVAASSKLRSFQL 375

Query: 410  LQTSFSSLPWFHLLGESRSRILLNSNESHSPLDAEPHFVNLSVSHYYTDRDIIRNYESLS 469
             QT FS   WF LLGE   R   N  + H P D  PHF+NLSV++YY DRDIIRNYES  
Sbjct: 376  YQTHFSHTFWFQLLGEF-DRNDFNQQQQH-PYDTNPHFINLSVNYYYGDRDIIRNYESQI 433

Query: 470  SLDPKNIGLYFDALTYIANRKGAYQLIAYCGKQDIIGQEALENALLVFKIEPKECNIAEL 529
             LDPKN G+Y+D LT+IAN KG++QL+ +  KQ+I+GQEAL +AL +F I+P E +  ++
Sbjct: 434  LLDPKNAGIYYDDLTFIANVKGSHQLLTFTLKQNIVGQEALNSALRLFHIDPSETDPKQI 493

Query: 530  NEATLLSIYKFETSNKSQVTSGHLTNLKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYD 589
             +  LLS YK E   K   T  H  +L+NALRLLAKY +S+KLKFYV+ EP++  SQAY 
Sbjct: 494  PDEMLLSCYKEEC--KYGNTRQH-ADLRNALRLLAKYKQSEKLKFYVELEPFQQESQAYS 550

Query: 590  TLSIDESVDEDIIKTAYSVKINDSPGLKLDCDRALYTIAISKKSLDLFNFLTDECPQFLT 649
             L IDESVD DII+TAY++K++D+PGLK+DCDRALYT+AI+K+S+DLFN+L   CP+F  
Sbjct: 551  ILEIDESVDIDIIETAYTIKVSDAPGLKVDCDRALYTLAIAKRSMDLFNYLLQRCPRFQQ 610

Query: 650  YYGAEQLDYQEALKLLQVNENASDETILKIFKQKWFDESVYEPDQFLTLKAALTKISIER 709
            +Y      Y  AL+ LQVN NA+D+ IL+IF++KW +E V  PDQFL LK AL KI+ ER
Sbjct: 611  FYHISYWSYTSALQYLQVNVNATDDLILEIFRRKWAEEPVISPDQFLNLKVALMKIAHER 670

Query: 710  NSNLISNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYILDYQKT 769
            NS LI++FL TG ID N L   NWPTG+NNIGNTCYLNSLLQYYF+I+PLR YI +Y+ T
Sbjct: 671  NSKLINHFLETGIIDTNYLTSGNWPTGLNNIGNTCYLNSLLQYYFTISPLRDYIQNYEDT 730

Query: 770  VENFNDHLSNSGHV--RRIGGRKISKGEVERSVQFIYQLRNLFYAMVHSRERCVTPSKEL 827
              +   +++ SG +  RRIGGR ++K EVERSVQF+YQLR+LF  M HS+ERCVTPS+EL
Sbjct: 731  ASDLLLNMNQSGAMTKRRIGGRAVNKPEVERSVQFVYQLRDLFNDMAHSKERCVTPSREL 790

Query: 828  AYLAFAPSNIEVEFEVEGNKPADGAAIPI-------------------GLKEEATQESCT 868
            AYL+F+PS   VEFE     P     I +                    ++ EA  E   
Sbjct: 791  AYLSFSPSTTNVEFESAAQVPFRDTTILLEQEPPNEDTEVFDISIEGSNVETEAAAEDII 850

Query: 869  TKENDPKSIGSKMEDNTNRDTHRNPSNTEKNEPNNVQIVGGDDTTDLNSLTRVAKISSDQ 928
              +N    I +K E ++   +    S+ + N  +N+     ++   + S T VAKIS DQ
Sbjct: 851  ADDN----IDTKDESSSLSPSTSTSSSQKGNSMSNIV----EENEPITS-TCVAKISPDQ 901

Query: 929  LENALEMGRQQDVTECIGNVLFQIESGSEPIKYDEDNEQYDLVKQLFYGTTKQSIVPLSA 988
            LEN LE+GRQQDVTECIGNVL+QIES S P+ +DE +EQYDLVKQLFYG  KQ ++P+  
Sbjct: 902  LENTLEIGRQQDVTECIGNVLYQIESASVPLNFDEGHEQYDLVKQLFYGKLKQDLIPIEN 961

Query: 989  TNKVRTKVERFLSLLINIGDHPKDIYDAFDSYFKDEYLTM-EEYGDVTRTVAVTTFPTIL 1047
              K RTK ERF+SLL+N+GDHPKDIYDA D YF+D+ L + ++   V R+VAV   PTIL
Sbjct: 962  PEKRRTKFERFMSLLVNVGDHPKDIYDALDLYFRDDLLALGDDNARVRRSVAVEELPTIL 1021

Query: 1048 QVQIQRVYYDRERFMPFKSIEPLPFKEVIYMDRYADTENPLLLAKKNETEEMKQKLRVMK 1107
            Q+QIQRVYYDRE+ MPFKS EPLPF E +YMDRY  +    LLAKK E+ ++ + L  +K
Sbjct: 1022 QIQIQRVYYDREKLMPFKSTEPLPFGEKLYMDRYMASTESELLAKKQESLQLHETLEAIK 1081

Query: 1108 NRQRELLSRDNSGLTRKDAFLESIKLLESSVVEKTTLKTEV-KIDVINTLRTNVNNIDNE 1166
             R++++LS++++GLT KD+  E+   LESSV+ ++  K  + K ++I  L +    ID E
Sbjct: 1082 QRRKKILSKNDAGLTLKDSLKETKIFLESSVLAESEGKIRIEKRNLIKQLDSFSLEIDKE 1141

Query: 1167 LMSLYNNINNLEEKISHQFDDFKEYGYSLFSVFIHRGEASYGHYWIYIKDRNHNGVWRKY 1226
            L +L + I ++E  ISH+FD F  +GY+LF+VFIHRGEASYGHYW+YIKDR ++G+WRKY
Sbjct: 1142 LSNLDDKIKDMENSISHKFDQFTNFGYNLFAVFIHRGEASYGHYWVYIKDRKNSGIWRKY 1201

Query: 1227 NDETVSEVQEDEVFNFNEGNTATPYFLVYVKQGQEADIEPLK 1268
            NDE+V+EV E EVF+F E NTATPYFLVY+K G E +IEPLK
Sbjct: 1202 NDESVTEVPESEVFDFTEDNTATPYFLVYIKDGHEHEIEPLK 1243

>KLLA0E02377g Chr5 complement(218647..222309) [3663 bp, 1220 aa] {ON}
            uniprot|O42726 Kluyveromyces lactis UBP2 Ubiquitin
            carboxyl-terminal hydrolase 2
          Length = 1220

 Score = 1119 bits (2894), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 588/1225 (48%), Positives = 790/1225 (64%), Gaps = 52/1225 (4%)

Query: 54   DDGKHLLYPDIATSLPLKTSDRLLDDILCDTIFLNSTDPSVIEKGLQTTGILRESMLSYS 113
            DDGK LLY DI+ S P KT DR+LDDI     FL     SV          +++ ML YS
Sbjct: 39   DDGKTLLYGDISKSFPFKTCDRILDDIRISPWFLKKFGSSV----------MKQPMLQYS 88

Query: 114  SFRSSIRPNALGSVTDQVVIQTKIEYDSYSCPKYNKIHVFQAVILNPSLTEQHVSSFDDI 173
              R  ++P  L  + DQV ++++ +YDS +CP  N I V  A++++P+ T    + FDDI
Sbjct: 89   RERQQLQPWNLVHLIDQVNLRSRYDYDSMTCPGKNTISVMFALLVDPNFTP---NDFDDI 145

Query: 174  VKIP--IYHLKVTVKIRQELERLKKHVGVTQFHSID--FLHEYDRVDFSTFDSSDPNLMD 229
             K P   +HLK+TVK R  LE   +HVG+T +H ++   LH +D+ D    +  D  L+D
Sbjct: 146  DKFPEYFFHLKITVKRRSYLENFNRHVGITHYHVLEPESLHPFDKRDIFIMEEKDCRLVD 205

Query: 230  YGIYVSDDTNKLILIEIFKPEFDSPEEHESFTINAIKRRYSDMCLNNESLDKNNTPSQAD 289
              I+VS DTNKLIL+EI KPEF+S E    +    I+ RY + C   + L+ ++ PSQA+
Sbjct: 206  QSIFVSADTNKLILVEIIKPEFNS-ENLAEYRTAKIEERYKNACQEFDLLNPDDIPSQAE 264

Query: 290  CFYTLFKIFKGPLTRKSKTEPVKTIDSGNLALNTHLNPEWLTSKYGFQVSSEIDEETNER 349
            C  TLF IFK PL RKS     K I   ++ALN+ +N +WLT+ + F +     E+  + 
Sbjct: 265  CLKTLFMIFKNPLQRKSANSEFKIISRDSVALNSQINTDWLTTMFDFSLQKTAVEDNVQS 324

Query: 350  FTEYLPPDMVDYVDDLKVRKIRESFVRKCLQLLFWGQLSTSLLAPNSPLKNTKSV-KGLS 408
              EY PPD+VDY+ D KVR IRE++ RK ++++  G+   S+L  N      K+V K  S
Sbjct: 325  GEEYKPPDLVDYITDFKVRGIREAYTRKSMEVVLIGK--QSMLLENELGTEKKTVAKCFS 382

Query: 409  CLQTSFSSLPWFHLLGESRSRILLNSNESHSPLDAEPHFVNLSVSHYYTDRDIIRNYESL 468
                S S   WF++L                P D   HF+NLSV+  Y D+DII+NYE+ 
Sbjct: 383  NQHFSASHTWWFNILNHQHIEPF--------PYDINYHFINLSVAFKYIDKDIIKNYETQ 434

Query: 469  SSLDPKNIGLYFDALTYIANRKGAYQLIAYCGKQDIIGQEALENALLVFKIEPKECNIAE 528
             +LD +NI  YFDAL Y+ N KG+YQLIAYCGKQD++G E L NAL VF ++P + + + 
Sbjct: 435  IALDQENISHYFDALQYVTNAKGSYQLIAYCGKQDVVGYEDLNNALQVFGLDPTDIDASL 494

Query: 529  LNEATLLSIYKFETSNKSQVTSGHLTNLKNALRLLAKYTKSDKLKFYVDHEPYRALSQAY 588
            L+  T++  Y    S+  + +     +L+NALR+L KY  S K+ F V++EPY  + QAY
Sbjct: 495  LDANTMIEYY---NSHLLRSSDNQRKDLRNALRVLGKYLGSQKMLFLVEYEPYYNVQQAY 551

Query: 589  DTLSIDESVDEDIIKTAYSVKINDSPGLKLDCDRALYTIAISKKSLDLFNFLTDECPQFL 648
              L +DE+VD+DII+TAY++ I D+PGLK D DRA++TIA+ ++S+ L N LTDECP+F 
Sbjct: 552  TLLKVDETVDDDIIQTAYTINIADAPGLKKDYDRAIFTIALDRRSIFLLNVLTDECPEFA 611

Query: 649  TYYGAEQLDYQEALKLLQVNENASDETILKIFKQKWFDESVYEPDQFLTLKAALTKISIE 708
             YY    + Y EAL +++++ NASD+ IL++F++KW    +  PD  L LK AL  I   
Sbjct: 612  QYYNCTDISYDEALNIIEIDMNASDDVILEVFQKKWSHGIMTGPDYLLKLKMALQNIGFT 671

Query: 709  RNSNLISNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYILDYQK 768
            RNS LI++FL TG +D + LP   WP GINN+GNTCYLNSLLQ++F+I PLR +IL+Y  
Sbjct: 672  RNSKLINHFLDTGIVDVSCLPVATWPAGINNVGNTCYLNSLLQFFFTIKPLRDFILNYDD 731

Query: 769  TVENFNDHLSNSGHVRRIGGRKISKGEVERSVQFIYQLRNLFYAMVHSRERCVTPSKELA 828
                  D  S     RRIGGR++SK E  RSVQF+Y LR+LF  M+H+  RCVTP+KEL 
Sbjct: 732  DSAKLLDA-SEYHSRRRIGGREVSKQEELRSVQFVYHLRDLFNDMIHTNSRCVTPTKELV 790

Query: 829  YLAFAPSNIEVEFEVEGNKPADGAAIPIGLKEEATQESCTTKENDPKSIGSKMEDNTNRD 888
            YLAFAPSN+EVEF  +     +   +   + E+ T  +      D   I  +        
Sbjct: 791  YLAFAPSNVEVEFGDDTVAQKELIDLTTDVVEDPTDTTRHLASCDDDIIMCQSPVAL--- 847

Query: 889  THRNPSNTEKNEPNNVQIVGGDDTTDLNSLTRVAKISSDQLENALEMGRQQDVTECIGNV 948
                P +   +E    Q              +VAKIS+DQLEN LE+GRQQDVTECIGNV
Sbjct: 848  ----PEHKTSSEAGTQQYS-----------VQVAKISADQLENTLEIGRQQDVTECIGNV 892

Query: 949  LFQIESGSEPIKYDEDNEQYDLVKQLFYGTTKQSIVPLSATNKVRTKVERFLSLLINIGD 1008
            L Q+E  SEP+  ++D EQ DLVKQLFYG  KQ ++P++    VRTK ERFLSLL+N GD
Sbjct: 893  LAQLEIASEPLSLEDDLEQNDLVKQLFYGRIKQDLIPVNDEASVRTKYERFLSLLVNTGD 952

Query: 1009 HPKDIYDAFDSYFKDEYLTMEEYGDVTRTVAVTTFPTILQVQIQRVYYDRERFMPFKSIE 1068
            HPKDIYDA D YF+++YL +EEYGDV RTV+++  P +LQ+QIQRVYYDRE+FMPFKSIE
Sbjct: 953  HPKDIYDALDFYFQNDYLNLEEYGDVKRTVSISELPAVLQIQIQRVYYDREKFMPFKSIE 1012

Query: 1069 PLPFKEVIYMDRYADTENPLLLAKKNETEEMKQKLRVMKNRQRELLSRDNSGLTRKDAFL 1128
            PLPF E +YMDRY  TE+P LLA+  +  E+KQKL+ +K RQR+LLS++  GLT K + +
Sbjct: 1013 PLPFGETLYMDRYMATEDPKLLAEIQQNAELKQKLQDLKQRQRKLLSQNEIGLTLKSSLI 1072

Query: 1129 ESIKLLESSVVEKTTLKTEVKIDVINTLRTNVNNIDNELMSLYNNINNLEEKISHQFDDF 1188
            E+ K L+S  ++   +  +     I  +   +NNID EL SL+N I +LE  IS QF +F
Sbjct: 1073 ETKKFLQSGTLKAHDIDADNIPSSIAYIDILINNIDEELKSLFNKITDLETTISQQFSEF 1132

Query: 1189 KEYGYSLFSVFIHRGEASYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNFNEGNTA 1248
            K  GYSLF+VFIHRGEASYGHYW+YIKD   NG+WRKYND++V+EV + EVFNF EGNTA
Sbjct: 1133 KHIGYSLFAVFIHRGEASYGHYWVYIKDHTKNGIWRKYNDDSVTEVPQSEVFNFTEGNTA 1192

Query: 1249 TPYFLVYVKQGQEAD-IEPLKRILQ 1272
            TPYFLVYV++GQE + IEPLKRILQ
Sbjct: 1193 TPYFLVYVREGQEQETIEPLKRILQ 1217

>ACL164C Chr3 complement(67792..71961) [4170 bp, 1389 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR124C
           (UBP2)
          Length = 1389

 Score =  749 bits (1935), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/802 (48%), Positives = 544/802 (67%), Gaps = 29/802 (3%)

Query: 54  DDGKHLLYPDIATSLPLKTSDRLLDDILCDTIFLNSTDPSVIEKGLQTTGILRESMLSYS 113
           DDG+ +LY ++A   P+KTSDRLLDD+            S+ E+G +   +LR  ML Y+
Sbjct: 21  DDGRTVLYGNLARQGPVKTSDRLLDDVRVTV--------SLSEEGRE---VLRAPMLEYA 69

Query: 114 SFRSSIRPNALGSVTDQVVIQTKIEYDSYSCPKYNKIHVFQAVILNPSLTEQHVSSFDDI 173
             R++ R  ++G + DQVV+QT  EY S +C + N++HVF  V+ +P    Q  +S D++
Sbjct: 70  RQRANARTWSVGYLLDQVVLQTSFEYTSRTCAQ-NRVHVFMGVLCDPG---QRFASQDEL 125

Query: 174 VKIPIYHLKVTVKIRQELERLKKHVGVTQFHSIDFLHEYDRVDFSTFDSSDPNLMDYGIY 233
           V   IYHL+VTVKIR +LER ++H GV Q+H +D LH +D+ DF  F+  DP ++D   Y
Sbjct: 126 VNYRIYHLRVTVKIRPQLERARQHYGVAQYHLVDELHPWDKPDFCLFEDGDPAVVDSATY 185

Query: 234 VSDDTNKLILIEIFKPEFDSPEEHESFTINAIKRRYSDMCLNNESLDKNNTPSQADCFYT 293
           V+  TN+L+ IE+ +PEF  P+E + FT   I+ RY ++C  +  LD ++ PSQA+C  T
Sbjct: 186 VASGTNRLVRIEVLRPEF-GPDELQEFTGERIRARYLEVCKRHPDLDPSDIPSQAECLNT 244

Query: 294 LFKIFKGPLTRKSKTEPVKTIDSGNLALNTHLNPEWLTSKYGFQVSSEIDEETNERFTEY 353
           LFK+FK PL+R+   + +KTI + N  LN+ L   WL +K+GF++  EI EE  ++  EY
Sbjct: 245 LFKVFKNPLSRQKAQDELKTISADNKVLNSQLEANWLVTKFGFELC-EI-EEDGQKIYEY 302

Query: 354 LPPDMVDYVDDLKVRKIRESFVRKCLQLLFWGQLSTSLLAPNSPLKNTKSVKGLSCLQTS 413
            PPD  ++V++ +VR+ RES++RK L+L+F G+ S  L+  +  + N+K ++     QT 
Sbjct: 303 KPPDFTEHVENWEVRRFRESYIRKSLELIFLGKQSLRLVPKDVVVSNSK-LRSFQLYQTH 361

Query: 414 FSSLPWFHLLGESRSRILLNSNESHSPLDAEPHFVNLSVSHYYTDRDIIRNYESLSSLDP 473
           FS   W+HL+GE       + N+   P D   HFV+LS ++YY+DRDII+NYE+  +LDP
Sbjct: 362 FSHSFWYHLMGEYDHN---DFNQQMHPYDTNYHFVHLSSNYYYSDRDIIKNYEAQIALDP 418

Query: 474 KNIGLYFDALTYIANRKGAYQLIAYCGKQDIIGQEALENALLVFKIEPKECNIAELNEAT 533
            N  +Y+D L+++AN KG+ QL+ Y  KQ+++G EAL +AL +F ++P   +  +L++  
Sbjct: 419 ANASIYYDDLSFVANSKGSKQLLTYTYKQNVVGHEALMSALRLFHLDPSSTDPRQLSDEF 478

Query: 534 LLSIYKFETSNKSQVTSGHLTNLKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDTLSI 593
           LL  YK     K      H  +L+NALRLLA+Y +SDKLKFYV+ EP+    QAY  L I
Sbjct: 479 LLESYK--EVCKDSGPQKH-ADLRNALRLLARYKESDKLKFYVEVEPFPNELQAYKLLEI 535

Query: 594 DESVDEDIIKTAYSVKINDSPGLKLDCDRALYTIAISKKSLDLFNFLTDECPQFLTYYGA 653
           DESVD DII+TAYS+K++D+PGLK+DC RALYT+A++K+S+ LFN L  +CP+F  +Y  
Sbjct: 536 DESVDIDIIETAYSIKVSDAPGLKMDCIRALYTLAVAKRSIILFNILFQQCPKFHQFYHM 595

Query: 654 EQLDYQEALKLLQVNENASDETILKIFKQKWFDESVYEPDQFLTLKAALTKISIERNSNL 713
             L YQ AL+ L VN NA+D+ IL+IF++KW  + +  P+Q L LK ALTKI  ERNS L
Sbjct: 596 SYLSYQSALQYLHVNVNATDDLILEIFQRKWSYDPLVSPEQLLNLKIALTKIGFERNSKL 655

Query: 714 ISNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYILDYQKTVENF 773
           I++FL TG +D N LP  NWPTGINNIGNTCYLNSLLQYYF+I+PLR YIL Y  T  N 
Sbjct: 656 INHFLETGLVDINYLPAGNWPTGINNIGNTCYLNSLLQYYFTISPLREYILAYDHTASNL 715

Query: 774 NDHLSNSGHV--RRIGGRKISKGEVERSVQFIYQLRNLFYAMVHSRERCVTPSKELAYLA 831
            ++  +S  +  RRIGGR IS+ EVERSVQF+YQLR+LF+ MVHSRER VTP++EL YL+
Sbjct: 716 LNNAVSSSDMGRRRIGGRAISQAEVERSVQFVYQLRSLFHEMVHSRERYVTPTRELVYLS 775

Query: 832 FAPSNIEVEFEVEGNKPADGAA 853
           F+PS+ EVEF  E   PA G A
Sbjct: 776 FSPSSTEVEF--EPVPPAVGTA 795

 Score =  402 bits (1032), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 205/374 (54%), Positives = 274/374 (73%), Gaps = 8/374 (2%)

Query: 903  NVQIVGGDDTTDLNSLTRVAKISSDQLENALEMGRQQDVTECIGNVLFQIESGSEPIKYD 962
            ++ +VG  +     + T VAKISSDQLEN LE+GRQQDVTECIGNVL+QIES S P+  D
Sbjct: 1018 DITMVGSPEAEGPETSTYVAKISSDQLENTLEIGRQQDVTECIGNVLYQIESASVPLSLD 1077

Query: 963  EDNEQYDLVKQLFYGTTKQSIVPLSATNKVRTKVERFLSLLINIGDHPKDIYDAFDSYFK 1022
            E+ EQ+DLVKQLFYG  KQ ++PL   ++ RTK+ERF+SLL+NIGDHPKDIYDA DSYFK
Sbjct: 1078 EEGEQFDLVKQLFYGKLKQELIPLEFPDRKRTKIERFMSLLVNIGDHPKDIYDALDSYFK 1137

Query: 1023 -DEYLTMEEYGDVTRTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKEVIYMDRY 1081
             D     E+ G V R+VAV   P +LQ+QIQRVYYDRE+FMPFKS EPLPF E +YMDRY
Sbjct: 1138 DDLLTLDEDDGKVRRSVAVAELPIMLQIQIQRVYYDREKFMPFKSTEPLPFGEKLYMDRY 1197

Query: 1082 ADTENPLLLAKKNETEEMKQKLRVMKNRQRELLSRDNSGLTRKDAFLESIKLLESSVVEK 1141
              T+N  L AKK +   ++++L  ++ R+R LL++++ G+T   A  ++ + L+++ +  
Sbjct: 1198 LATDNAELNAKKQQAIGLREELERLRERRRRLLAKNDHGVTLSAALADTRRFLDAAELTS 1257

Query: 1142 TTLKTEVKIDV----INTLRTNVNNIDNELMSLYNNINNLEEKISHQFDDFKEYGYSLFS 1197
             + + + +       ++ LR     +D EL +L  +I ++++ I+H+FD F  YGYSL +
Sbjct: 1258 GSRQLQEQYHATTSHLDALRV---ALDEELAALDAHIASVQDAIAHRFDAFSSYGYSLGA 1314

Query: 1198 VFIHRGEASYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNFNEGNTATPYFLVYVK 1257
            VFIHRGEASYGHYW+YIKD  + G+WRKYNDE+V+EV E EVF+F+E NTATPYFLVYVK
Sbjct: 1315 VFIHRGEASYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVFDFSEENTATPYFLVYVK 1374

Query: 1258 QGQEADIEPLKRIL 1271
            +  E DIEPLKR+L
Sbjct: 1375 EAHELDIEPLKRLL 1388

>Kpol_1016.1 s1016 (585..4340) [3756 bp, 1251 aa] {ON} (585..4340)
            [3756 nt, 1252 aa]
          Length = 1251

 Score =  734 bits (1896), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 469/1210 (38%), Positives = 681/1210 (56%), Gaps = 116/1210 (9%)

Query: 86   FLNSTDPSVIEKGLQTTGILRESMLSYSSFRSSIRPNALGSVTDQV-VIQTKIEYDSYSC 144
            F+NS+   + E GL   GILR     YS FRSS     + +++++  +I  + EY+S + 
Sbjct: 122  FINSSADEIKELGL-NKGILRLPTTDYSKFRSSFSEYKIINLSNKNNLINYRFEYESKTN 180

Query: 145  PKYNKIHVFQAVILNP----SLTEQHVSSFDDIVKIPIYHLKVTVKIRQELERLKKHVGV 200
             + NKI  F +++  P    +L  + ++ F    +   YHLKV++K R +LE  KKH  +
Sbjct: 181  HQDNKILEFFSILHKPKDASNLDYESMAKF--WSQNEFYHLKVSIKTRNQLELSKKHTPI 238

Query: 201  TQFHSIDFLHEYDRVDFSTFDSSDPNLMDYGIYVSDDTNKLILIEIFKPEFDSPEEHESF 260
              F+ ID  +E D++DF  F+  +PNL+DY I++S +TNK++L+EIFK EF+  ++    
Sbjct: 239  QHFYVIDEFNEEDKLDFINFNPDNPNLLDYAIFISSNTNKVVLVEIFKSEFNLNDKLIIL 298

Query: 261  TINAIKRRYSDMCLNNESLDKNNTPSQADCFYTLFKIFKGPLTR---KSKTEPVKTIDSG 317
                +   Y     +N  L     P+Q D    L   F          S  + +K  DS 
Sbjct: 299  DDLQVLNNYEKYKNSNHKL---KLPTQTDVLLVLMYCFNKQQNFDNIHSSEDEIKLKDSK 355

Query: 318  NLALNTHLNPEWLTSKYGFQVSSEIDEETNERFTEYLPPDMVDYVDDLKVRKIRESFVRK 377
              A+   LNP WLT ++  +   +            +  ++ + ++ +K  K R     +
Sbjct: 356  --AIKISLNPSWLTERFSLKFQED---------ESLIFMNLRNNLNLIKKEKRRFDVFTR 404

Query: 378  CLQLLFWGQLST--SLLAPNSPLKNTKSVKGLSCLQTSFSSLPWFHLLGESRSRILLNSN 435
            CL  LF    S    L+  NS  K+T  +K +  +  + S   W  +LGE +S IL  +N
Sbjct: 405  CLLELFVLIKSAPQKLVKCNS--KDTNIIKVVDTISINSSLSFWSQILGEYKS-ILSQNN 461

Query: 436  ESHSPLDAEPHFVNLSVSHYYTDRDIIRNYESLSSLDPKNIGLYFDALTYIANRKGAYQL 495
             +     AE  F+NLS+   YT+ +I++NYE L+ L+P  IG+YFD+L +++     Y+ 
Sbjct: 462  FNQYSKHAE--FINLSILPTYTESEIVKNYEILTILNPDKIGVYFDSLKFVSQCLTQYEN 519

Query: 496  IA-YCGKQDIIGQEALENALLVFKIEPKE---CNIAELNEATLLSIYKFETSNKSQVTSG 551
            +A Y  K +IIG E    +L +FK++  E   C+ + L E  L     +E  N       
Sbjct: 520  LADYVNKNEIIGNEEFNQSLKIFKMDKLEFTNCSDSVLWEKYLTY---YEDKN---FDYN 573

Query: 552  HLTNLKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDTLSIDESVDEDIIKTAYSVKIN 611
            H   L+N+++ L+    S  LKF   +EPY+    A+ TL+I ESVD D I  +Y+ KIN
Sbjct: 574  HAI-LRNSIKSLSIVKNSPILKFLCKYEPYKNPDNAFVTLNIHESVDSDTIIVSYTTKIN 632

Query: 612  DSPGLKLDCDRALYTIAISKKSLDLFNFLTDECPQFLTYYGAEQLDYQEALKLLQVNENA 671
            D    K   D+AL TIAI +K L LF+ L + C  F+  Y +  ++Y+ AL+ +  +E  
Sbjct: 633  DMKDKKQHLDKALLTIAIDRKDLSLFHTLYENCKDFVNLYHSMNIEYKTALQAIDSSELN 692

Query: 672  SDETILKIFKQKWFDESVYEPDQF-------LTLKAALTKISIERNSNLISNFLLTGTID 724
            SD  ++  FK++W+   V   D F       LTL+  +  IS  RNS L++N++  G ++
Sbjct: 693  SDNELILSFKKRWYRIDV-NNDTFGDDTVNLLTLRKVMMVISSNRNSLLLNNYIEYGIVN 751

Query: 725  PNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYILDYQKTVENFNDHLSNSGHV- 783
            P  LP ++WP G+NNIGNTCYLNSLLQYYF+I+PLR Y++       NFND   +   + 
Sbjct: 752  PKFLPSKSWPVGLNNIGNTCYLNSLLQYYFAISPLREYLI-------NFNDIELDGREMK 804

Query: 784  ----RRIGGRKISKGEVERSVQFIYQLRNLFYAMVHSRERCVTPSKELAYLAFAPSNIEV 839
                RR+GGR +S  E  RS+QF+YQLR+L+  MVHS  R V+P  +LAYLAFAPS+  +
Sbjct: 805  NLEKRRVGGRNLSIAEFHRSIQFVYQLRDLYGEMVHSSSRKVSPRLQLAYLAFAPSDTPI 864

Query: 840  EFEVEGNKPADGAAIPIGLKEEATQESCTTKENDPKSIGSKMEDNTNRDTHRNPSNTEKN 899
            EF  +G + A G       K     ES + K  +         D++      +   T  N
Sbjct: 865  EFR-DGIQNAIGKNDYYSDKTNGGSESSSIKGLNSNLNSDSDADSSLDSDSESSLLTFDN 923

Query: 900  EPNNVQIVGGDDTTDLNSLTRVAKISSDQLENALEMGRQQDVTECIGNVLFQIESGSEPI 959
             P     +    TT+L +L  + KISS QLE  LEMG QQDVTECI NVLFQIE+ S PI
Sbjct: 924  LP-----IIKTSTTNLPTL--IPKISSSQLETTLEMGSQQDVTECIENVLFQIEAASNPI 976

Query: 960  KYDEDNEQYDLVKQLFYGTTKQSIVPLSATNKVRTKVERFLSLLINIGDHPKDIYDAFDS 1019
              DEDNEQ DLVKQLF+G T+Q I P +  +KV  K ERFLSLL+++ D P+DIYDA D+
Sbjct: 977  SIDEDNEQVDLVKQLFFGKTEQKIKPFNEVSKVHPKRERFLSLLVSVSDKPRDIYDALDT 1036

Query: 1020 YFKDEYLTMEEYGDVTRTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKEVIYMD 1079
            YFKDE   MEEYG V +++ +++FPTILQVQIQRVYYD E+ +PFK +EPL F E +Y+D
Sbjct: 1037 YFKDEVFDMEEYGKVKKSLTISSFPTILQVQIQRVYYDIEKGVPFKDLEPLRFSESLYLD 1096

Query: 1080 RYADTENPLLLAKKNETEEMKQKLRVMKNRQRELLSRDNSGLTRKDAFLESIKLLESSVV 1139
            RYA+  +  L  KK E   +K++L+ +   ++EL  ++++                   V
Sbjct: 1097 RYANDIDEKLAEKKIEVASLKKRLKGLITIKKELEKKNDN-------------------V 1137

Query: 1140 EKTTLKTEVKIDVINTLRTNVNNIDNELMSLYNNINNLEEKISHQFDDFKEYGYSLFSVF 1199
            E  T+  E                          IN++E KI   F +F ++GYSLF+VF
Sbjct: 1138 EIRTISKE--------------------------INDVETKIDTAFSEFHKHGYSLFAVF 1171

Query: 1200 IHRGEASYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNFNEGNTATPYFLVYVKQG 1259
            IHRG+A++GHYWIYIKD  ++G WRKYND  V+E+   EVFNF+EGN++TPYFLVY+K G
Sbjct: 1172 IHRGQATFGHYWIYIKDFKNHGTWRKYNDHEVTEILPIEVFNFSEGNSSTPYFLVYIKNG 1231

Query: 1260 QEADIEPLKR 1269
             E D+EPLKR
Sbjct: 1232 SEFDVEPLKR 1241

>TPHA0J02620 Chr10 complement(580898..584575) [3678 bp, 1225 aa] {ON}
            Anc_5.443 YOR124C
          Length = 1225

 Score =  633 bits (1633), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/1244 (33%), Positives = 655/1244 (52%), Gaps = 121/1244 (9%)

Query: 54   DDGKHLLYPDIATSLPLKTSDRLLDDILCDTIFLNSTDPSVIEKGLQTTGILRESMLSYS 113
            DDG HLLY +I      KTS R+LDDIL D  F+ S D    +      G+L    + YS
Sbjct: 69   DDGMHLLYQNIEKEGVFKTSQRILDDILTDIAFM-SLDSEKSDDIDFKDGVLNLPTIKYS 127

Query: 114  SFRSSIRPNALGSV-TDQVVIQTKIEYDSYSCPKYNKIHVFQAVILNPSLTEQHVSSFDD 172
             +R  I+P  +    T+  V+  K+++ S + PK N I     +++        +++FD+
Sbjct: 128  LWRKYIKPFKIILFNTNNPVVDVKLQHKSVTSPKNNTITELYGLLVPKIPRRSELNTFDE 187

Query: 173  IVKI-PIYHLKVTVKIRQELERLKKHVGVTQFH---SIDFLHEYDRVDFSTFDSSDPNLM 228
             ++  P+Y +++TVK R  LE  KKH+ +T +      D LHE D+ DF  F+    +L+
Sbjct: 188  YIRSKPLYSIRITVKTRHRLEHKKKHIALTPYFLLDDFDKLHEVDKSDFPKFNKDSKDLL 247

Query: 229  DYGIYVSDDTNKLILIEIFKPEFDSPEEHESFTINAIKRRYSDMCLNNESL--DKNNT-- 284
            D+ IY+S DTNK+ILIEIFKP F+  E     +  ++  R +++   +E L  D N+   
Sbjct: 248  DFSIYISSDTNKIILIEIFKPAFNQTELDYLLSSASVLNRSNELDNLHEELQPDYNDAIV 307

Query: 285  PSQADC----FYTLFKIFKGPLTRKSKTEPVKTIDSGNLALNTHLNPEWLTSKYGFQVSS 340
              Q D      + + +  KG   R+ + +    + S ++ L T+++ +WL   +  +V  
Sbjct: 308  EEQIDTIEILLHCIMQNLKGSPERELEKQKTSFLLSDDVKLGTYVDIKWLEENFDIKVKE 367

Query: 341  E---------IDEETNERFTEYLPPDMVDYVDDLKVRKIRESFVRKCLQLLFWGQLSTSL 391
            +         +DE     F +  P +   +          +   R  ++L++ G++  S 
Sbjct: 368  QKRKDHVSITLDEALKLSFDDPNPKNQAKF----------DKITRYAMELMYLGKVLQSF 417

Query: 392  LAPNSPLKNTKSVKGLSCLQTSFSSLPWFHLLGESRSRILLNSNESHSPLDAEPHFVNLS 451
             +    ++          ++   ++  W  +L E +S   + S++  S    + HF+NL 
Sbjct: 418  YSNEEEIEEYMEDTIFKQVKVHHTTSFWTQILNEYQS---IFSSQKTSTRCVDEHFINLC 474

Query: 452  VSHYYTDRDIIRNYESLSSLDPKNIGLYFDALTYIANRKGAYQLI-AYCGKQDIIGQEAL 510
            +    +++DII NYE     DP N   YF++L Y++ +   Y ++  YC +  II + A 
Sbjct: 475  IDSNVSEKDIITNYEIQLRTDPDNDSKYFESLKYVSRKFPDYIVLEKYCKENVIISKAAY 534

Query: 511  ENALLVFKIEPKECNIAELNEATLLSIYKFETSNKSQVTSGHLTNLKNALRLLAKYTKSD 570
             +AL +FK   +  N  E + + +   Y     + +     +  +L ++   LA   KS 
Sbjct: 535  LHALEIFKYSEEYFNAIE-HVSEIWDKYTELVQSNNNNDDQYRVDLVDSFYSLATVKKSS 593

Query: 571  KLKFYVDHEPYRALSQAYDTLSIDESVDEDIIKTAYSVKINDSPGLKLDCDRALYTIAIS 630
             L +   +EP+     AY  L++D  +D + I  AY+++I + P  K+  DRAL+ IAI 
Sbjct: 594  PLIYITKYEPFFHPVTAYLKLNVDAKLDSENIVLAYTMQIREVPEHKIQFDRALFAIAIQ 653

Query: 631  KKSLDLFNFLTDECPQFLTYYGAEQLDYQEALKLLQVNENASDETILKIFKQKWFDESVY 690
            +  L L   L   C  F        L   +A +++ + + +S+ +I+  F + W +    
Sbjct: 654  RHDLSLLYVLKQNCSAFNECISNIILTSDDAFEIIGMPKTSSELSIINTFTKYWKETDDS 713

Query: 691  EPDQFLTLKAALTKISIERNSNLISNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLL 750
             P  F+   AAL ++S  R S L+ +F   G ++P  +  E WPTGINNIGNTCYLNSLL
Sbjct: 714  NPVNFILASAALREVSKHRASALLRHFYEFGKVNPKMIDSELWPTGINNIGNTCYLNSLL 773

Query: 751  QYYFSIAPLRRYILDYQKTVENFNDHLSNSGHV--RRIGGRKISKGEVERSVQFIYQLRN 808
            QYYFSI   R +I +YQ ++E  +D L+++  +  RR+GGR+I   E+ RSVQFIYQ+++
Sbjct: 774  QYYFSITLFREFIENYQ-SIE--SDLLNSNAEMSKRRVGGREIQNNEINRSVQFIYQVQD 830

Query: 809  LFYAMVHSRERCVTPSKELAYLAFAPSNIEVEFEVEGNKPADGAAIPIGLKEEATQESCT 868
            LF  MVH++ R VTPS +LAYLAFAP+N E++F+ +               E + +   T
Sbjct: 831  LFKLMVHTKSRKVTPSNQLAYLAFAPNNAEIKFKHKSE------------LESSEEHQLT 878

Query: 869  TKENDPKSIGSKMEDNTNRDTHRNPSNTEKNEPNNVQIVGGDDTTDLNSLTRVAKISSDQ 928
            T  +   S  + +  +++ DT  +              +  + T+  N L  VA ++ D 
Sbjct: 879  TSHSIALSSATSIS-HSDIDTQDHD-------------ISLNSTSYSNRL--VAMVTRDD 922

Query: 929  LENALEMGRQQDVTECIGNVLFQIESGSEPIKYDEDNEQYDLVKQLFYGTTKQSIVPLSA 988
            LE  LE+G QQDVTECI  VL+Q+E+GS P+  D DNEQ DLVK+LFYG T Q I P+  
Sbjct: 923  LETTLEIGNQQDVTECINTVLYQVETGSMPLYLDADNEQMDLVKELFYGETIQEICPIKK 982

Query: 989  TNKVRTKVERFLSLLINIGDHPKDIYDAFDSYFKDEYLTMEEYGDVTRTVAVTTFPTILQ 1048
              K   K E + SLL+NI D P D+Y+  D YF DEY++MEEYG+V +T+++T  PTIL 
Sbjct: 983  FIKGHEKRELYSSLLVNILDSPTDLYEVLDEYFADEYMSMEEYGEVKKTLSITKLPTILN 1042

Query: 1049 VQIQRVYYDRERFMPFKSIEPLPFKEVIYMDRYA---DTENPLLLAKKNETEEMKQKLRV 1105
            +QIQRVYYD+E+ +P+K    LPFK  I++DRY      EN +L       E+ + +L++
Sbjct: 1043 IQIQRVYYDKEKLVPYKCGTALPFKNEIFLDRYIKGNKKENDVL-------EKARLELKL 1095

Query: 1106 MKNRQRELLSRDNSGLTRKDAFLESIKLLESSVVEKTTLKTEVKIDVINTLRTNVNNIDN 1165
             K + REL+S  NS                   V K+                    I +
Sbjct: 1096 AKVKYRELVSEYNS-------------------VNKS--------------------ISD 1116

Query: 1166 ELMSLYNNINNLEEKISHQFDDFKEYGYSLFSVFIHRGEASYGHYWIYIKDRNHNGVWRK 1225
             +++ Y+ I  L   I  +     +  YSLF+VFIHRG+AS+GHYW+YI+D   NG+WRK
Sbjct: 1117 RIITTYDRIEELNAVIEEEVTKDAKIRYSLFAVFIHRGQASFGHYWVYIRDF-ENGIWRK 1175

Query: 1226 YNDETVSEVQEDEVFNFNEGNTATPYFLVYVKQGQEADIEPLKR 1269
            YND  V+   EDE+F   +G+ +TPYFL YV   +++ ++PL R
Sbjct: 1176 YNDHQVTGAHEDEIFKCVDGDISTPYFLAYVDSSKKSIVKPLVR 1219

>KLTH0H13354g Chr8 complement(1165485..1166953,1167017..1167035)
           [1488 bp, 495 aa] {ON} similar to uniprot|P43593
           Saccharomyces cerevisiae YFR010W UBP6 Ubiquitin-specific
           protease situated in the base subcomplex of the 26S
           proteasome releases free ubiquitin from branched
           polyubiquitin chains deletion causes hypersensitivity to
           cycloheximide and other toxic compounds
          Length = 495

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 45/97 (46%), Gaps = 21/97 (21%)

Query: 734 PTGINNIGNTCYLNSLLQYYFSIAPLRRYILDYQKTVENFNDHLSNSGHVRRIGGRKISK 793
           P G+ N+GNTCY+NS LQ  + I PLR  IL++Q   EN       SG            
Sbjct: 105 PVGLKNLGNTCYMNSTLQALYQIRPLREEILNFQPPKEN------RSG------------ 146

Query: 794 GEVERSVQFIYQLRNLFYAMVHSRERCVTPSKELAYL 830
              E+ +Q + +L+  F  +    +   TP   LA L
Sbjct: 147 ---EQHIQLVAELKRCFQQLRDRPQESTTPILLLATL 180

 Score = 40.4 bits (93), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 37/69 (53%), Gaps = 2/69 (2%)

Query: 1193 YSLFSVFIHRGEAS-YGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNFNEGNTA-TP 1250
            Y+L  V  H+G  S  GHY  +I+D      W ++ND+ VS ++++++ +   G  + + 
Sbjct: 426  YNLIGVITHQGANSESGHYQSFIRDEADENKWYRFNDDKVSVIEKEKIESLAGGGESDSA 485

Query: 1251 YFLVYVKQG 1259
              L+Y   G
Sbjct: 486  LILIYKGLG 494

>KAFR0C04520 Chr3 complement(901847..903330,903422..903437) [1500
           bp, 499 aa] {ON} Anc_1.369 YFR010W
          Length = 499

 Score = 52.0 bits (123), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 41/149 (27%), Positives = 63/149 (42%), Gaps = 41/149 (27%)

Query: 698 LKAALTKISIERNSNLI---SNFLLTGTIDPN-------------SLPPE-------NWP 734
           +K  LT  SI+  S +I   SN +L GT D N              L PE       + P
Sbjct: 47  VKGGLTDDSIKNLSEIIKPGSNIMLLGTPDANLVSKPKSQNHFIEDLTPEQQVQQFNDIP 106

Query: 735 TGINNIGNTCYLNSLLQYYFSIAPLRRYILDYQKTVENFNDHLSNSGHVRRIGGRKISKG 794
            G  N+GNTCYLN+ LQ  + I  LR  +L++  ++ N  +                  G
Sbjct: 107 IGFKNMGNTCYLNATLQALYRIDDLRDAVLNFDVSINNDKN------------------G 148

Query: 795 EVERSVQFIYQLRNLFYAMVHSRERCVTP 823
           E E  ++ + +L+  F  + +   + V P
Sbjct: 149 ENETHIKLVTELKRCFEGLKNKSFKSVMP 177

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 32/55 (58%), Gaps = 1/55 (1%)

Query: 1193 YSLFSVFIHRGEAS-YGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNFNEGN 1246
            Y L  +  H+G  S  GHY  +I+D N   +W K+ND+ VS ++++++ +   G 
Sbjct: 430  YDLVGIITHQGANSESGHYQAFIRDENDENIWYKFNDDKVSIIEKEKIESLAGGG 484

>TBLA0C01200 Chr3 complement(258492..259981,260188..260209) [1512
           bp, 503 aa] {ON} Anc_1.369 YFR010W
          Length = 503

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 20/36 (55%), Positives = 27/36 (75%)

Query: 734 PTGINNIGNTCYLNSLLQYYFSIAPLRRYILDYQKT 769
           P G+ N+GNTCYLN+ LQ  F I PLR  IL+Y+++
Sbjct: 108 PIGLKNLGNTCYLNATLQCLFRIEPLREMILNYKQS 143

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 35/66 (53%), Gaps = 1/66 (1%)

Query: 1193 YSLFSVFIHRGEAS-YGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNFNEGNTATPY 1251
            Y+L  +  H+G  S  GHY  +I+DR    +W K+ND+ V+ V ++++     G  +   
Sbjct: 434  YNLIGIITHQGANSESGHYQAFIRDREDEEIWYKFNDDKVTIVDKEKIETLAGGGESDSA 493

Query: 1252 FLVYVK 1257
             ++  K
Sbjct: 494  LILLYK 499

>SAKL0D10120g Chr4 complement(845029..846491,846566..846581) [1479
           bp, 492 aa] {ON} highly similar to uniprot|P43593
           Saccharomyces cerevisiae YFR010W UBP6 Ubiquitin-specific
           protease situated in the base subcomplex of the 26S
           proteasome releases free ubiquitin from branched
           polyubiquitin chains deletion causes hypersensitivity to
           cycloheximide and other toxic compounds
          Length = 492

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 27/40 (67%)

Query: 734 PTGINNIGNTCYLNSLLQYYFSIAPLRRYILDYQKTVENF 773
           P G+ N+GNTCY+N+ LQ  + I PLR  IL++ K   NF
Sbjct: 103 PIGLKNMGNTCYMNATLQALYQITPLREAILNFDKKSGNF 142

 Score = 41.6 bits (96), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 35/65 (53%), Gaps = 2/65 (3%)

Query: 1193 YSLFSVFIHRGEAS-YGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNF-NEGNTATP 1250
            Y L  V  H+G  S  GHY  +I+D      W K+ND+ VS ++++++ +    G + + 
Sbjct: 423  YDLIGVITHQGANSESGHYQAFIRDEMDENKWYKFNDDKVSVIEKEKIESLAGGGESDSA 482

Query: 1251 YFLVY 1255
              LVY
Sbjct: 483  LILVY 487

>Kwal_34.16268 s34 (268814..270163) [1350 bp, 449 aa] {ON} YFR010W
           (UBP6) - (putative) ubiquitin-specific protease [contig
           710] FULL
          Length = 449

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 43/97 (44%), Gaps = 21/97 (21%)

Query: 734 PTGINNIGNTCYLNSLLQYYFSIAPLRRYILDYQKTVENFNDHLSNSGHVRRIGGRKISK 793
           P G+ N+GNTCY+NS LQ  + I PLR  +L+Y+   E                     K
Sbjct: 59  PVGLKNLGNTCYMNSTLQALYQIKPLRDEVLNYKVPRE---------------------K 97

Query: 794 GEVERSVQFIYQLRNLFYAMVHSRERCVTPSKELAYL 830
              E+  Q + +LR  F  +    +  VTP   LA L
Sbjct: 98  PSEEQHHQLVSELRRCFQQLKDKPQESVTPMLLLAML 134

 Score = 38.9 bits (89), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 36/65 (55%), Gaps = 2/65 (3%)

Query: 1193 YSLFSVFIHRGEAS-YGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNF-NEGNTATP 1250
            Y+L  V  H+G  S  GHY  +I+D      W ++ND+ VS ++++++ +    G + + 
Sbjct: 380  YNLIGVITHQGANSESGHYQSFIRDEVDENKWYRFNDDKVSIIEKEKIESLAGGGESDSA 439

Query: 1251 YFLVY 1255
              L+Y
Sbjct: 440  LILIY 444

>TDEL0D02400 Chr4 (467340..467361,467436..468898) [1485 bp, 494 aa]
           {ON} Anc_1.369 YFR010W
          Length = 494

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 44/96 (45%), Gaps = 23/96 (23%)

Query: 694 QFLTLKAALTKISIERNSNLI---SNFLLTGTIDPN-------------SLPPE------ 731
           Q   +K  L+  S    ++LI   SN ++ GT D                L PE      
Sbjct: 45  QKYMVKGGLSDDSATDLASLIKPGSNVMVLGTPDAGLISKPKEKSQFIEDLAPEQQFQHA 104

Query: 732 -NWPTGINNIGNTCYLNSLLQYYFSIAPLRRYILDY 766
            + P G  N+GNTCYLN+ LQ  + I PLR  ILDY
Sbjct: 105 NDLPIGFQNMGNTCYLNATLQALYRIEPLRDMILDY 140

 Score = 36.6 bits (83), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 32/65 (49%), Gaps = 2/65 (3%)

Query: 1193 YSLFSVFIHRGEAS-YGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNF-NEGNTATP 1250
            Y L  V  H+G  S  GHY  +I+D      W  +ND+ VS V ++++      G + + 
Sbjct: 425  YELIGVITHQGANSESGHYQSFIRDDMDEDKWYNFNDDKVSVVPKEKIEGLAGGGESDSA 484

Query: 1251 YFLVY 1255
              L+Y
Sbjct: 485  LILIY 489

>KLLA0A10791g Chr1 complement(934135..935573,935718..935733) [1455
           bp, 484 aa] {ON} similar to uniprot|P43593 Saccharomyces
           cerevisiae YFR010W UBP6 Ubiquitin-specific protease
           situated in the base subcomplex of the 26S proteasome
           releases free ubiquitin from branched polyubiquitin
           chains deletion causes hypersensitivity to cycloheximide
           and other toxic compounds
          Length = 484

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 38/90 (42%), Gaps = 25/90 (27%)

Query: 734 PTGINNIGNTCYLNSLLQYYFSIAPLRRYILDYQKTVENFNDHLSNSGHVRRIGGRKISK 793
           P G+ N+GNTCY N+ LQ  + I PLR  +L Y +   + +                   
Sbjct: 105 PMGLRNMGNTCYFNASLQALYRIKPLREKVLAYNEPNPDLHG------------------ 146

Query: 794 GEVERSVQFIYQLRNLFYAMVHSRERCVTP 823
                  Q + QLRN F A    +E+  TP
Sbjct: 147 -------QLVIQLRNCFNAFAQRKEKEFTP 169

 Score = 38.1 bits (87), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 32/65 (49%), Gaps = 2/65 (3%)

Query: 1193 YSLFSVFIHRGEAS-YGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNF-NEGNTATP 1250
            Y+L  V  H+G  S  GHY  +++D      W KYND+ V  V  ++V      G + + 
Sbjct: 415  YNLIGVVTHQGANSDSGHYQAFVRDDADENKWYKYNDDKVYVVTREKVEQLAGGGESDSA 474

Query: 1251 YFLVY 1255
              L+Y
Sbjct: 475  LILIY 479

>ZYRO0G01188g Chr7 (95655..95676,95759..97239) [1503 bp, 500 aa]
           {ON} highly similar to uniprot|P43593 Saccharomyces
           cerevisiae YFR010W UBP6 Ubiquitin-specific protease
           situated in the base subcomplex of the 26S proteasome
           releases free ubiquitin from branched polyubiquitin
           chains deletion causes hypersensitivity to cycloheximide
           and other toxic compounds
          Length = 500

 Score = 49.3 bits (116), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 32/72 (44%), Gaps = 20/72 (27%)

Query: 715 SNFLLTGTIDPN-------------SLPPE-------NWPTGINNIGNTCYLNSLLQYYF 754
           S  +L GT D                L PE       + P G  N+GNTCYLNS LQ  +
Sbjct: 68  STLMLLGTADAGLVSKPAEKNQFIEDLAPEEQLQRSSDLPIGFQNMGNTCYLNSTLQALY 127

Query: 755 SIAPLRRYILDY 766
            I PLR  IL Y
Sbjct: 128 RIKPLRELILSY 139

 Score = 38.9 bits (89), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 35/65 (53%), Gaps = 2/65 (3%)

Query: 1193 YSLFSVFIHRGEAS-YGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNFNEGNTA-TP 1250
            Y L  V  H+G  S  GHY  +I+D      W K+ND+ VS V ++++ + + G  + + 
Sbjct: 431  YELVGVITHQGANSESGHYQSFIRDDYDEDKWYKFNDDKVSVVDKEKIESLSGGGESDSA 490

Query: 1251 YFLVY 1255
              L+Y
Sbjct: 491  LILIY 495

>Kpol_2001.54 s2001 complement(144924..148595) [3672 bp, 1223 aa]
           {ON} complement(144924..148595) [3672 nt, 1224 aa]
          Length = 1223

 Score = 49.7 bits (117), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 27/62 (43%), Positives = 36/62 (58%), Gaps = 3/62 (4%)

Query: 726 NSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYIL--DYQKTVENFNDHLSNSGHV 783
           N+L P     G+NN+GNTCY+NS LQ    I  LR Y L   ++K + N ++ L   GHV
Sbjct: 333 NALTPSRGNIGLNNLGNTCYMNSALQCLVHIPQLRDYFLYKVFEKEI-NLDNPLGYQGHV 391

Query: 784 RR 785
            R
Sbjct: 392 AR 393

>Ecym_2717 Chr2 (1388844..1390295) [1452 bp, 483 aa] {ON} similar to
           Ashbya gossypii AEL029W
          Length = 483

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 18/33 (54%), Positives = 24/33 (72%)

Query: 734 PTGINNIGNTCYLNSLLQYYFSIAPLRRYILDY 766
           P GI N+GNTCY+N+ LQ  F I PLR  +L++
Sbjct: 101 PMGIANLGNTCYMNATLQGLFRIDPLREQVLEF 133

>AEL029W Chr5 (580062..581402) [1341 bp, 446 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFR010W (UBP6)
          Length = 446

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 44/84 (52%), Gaps = 9/84 (10%)

Query: 734 PTGINNIGNTCYLNSLLQYYFSIAPLRRYIL---DYQKTVENFNDHLSNSGHVRRIGG-- 788
           P GI N+GNTCY+N+ LQ  + I PLR  IL   D + T E  +  L +   +R I    
Sbjct: 59  PMGIVNMGNTCYMNATLQGLYGIVPLREQILAFDDKKATAEGMD--LYHVQLIREIQATF 116

Query: 789 RKI--SKGEVERSVQFIYQLRNLF 810
           RK+   KGE    +  +  LR +F
Sbjct: 117 RKLRDKKGEAITPMLLLEILRRVF 140

 Score = 39.3 bits (90), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 36/65 (55%), Gaps = 2/65 (3%)

Query: 1193 YSLFSVFIHRGEAS-YGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNFNEGNTA-TP 1250
            Y L  V  H+G  S  GHY  +++D   +  W K+ND+ V+ ++++++ +   G  + + 
Sbjct: 377  YDLIGVITHQGANSESGHYQAFMRDEFDDDKWYKFNDDKVTAIEKEKIESLAGGGESDSA 436

Query: 1251 YFLVY 1255
              L+Y
Sbjct: 437  LILIY 441

>Ecym_8140 Chr8 complement(295730..299524) [3795 bp, 1264 aa] {ON}
           similar to Ashbya gossypii AFR627C
          Length = 1264

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 43/85 (50%), Gaps = 8/85 (9%)

Query: 709 RNSNLISNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYIL--DY 766
           +N +  SN+ +      N + P N   G+ N+GNTCY+NS LQ    I   + Y L   Y
Sbjct: 328 KNQHWASNYYIY-----NQMTPSNGTVGLGNLGNTCYMNSALQCLVHIPEFKDYFLYNAY 382

Query: 767 QKTVENFNDHLSNSGHVRRIGGRKI 791
           +K + N ++ L + GH+    G  I
Sbjct: 383 EKEI-NVDNPLGHKGHIAWAFGTLI 406

>NDAI0G00780 Chr7 (164452..165912) [1461 bp, 486 aa] {ON} 
          Length = 486

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 37/66 (56%), Gaps = 9/66 (13%)

Query: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNFNEGNTATPYF 1252
            YSL S+ +H G   YGHY  Y   R     W + +DE+V +V EDEVF      +A+  F
Sbjct: 428  YSLKSIVVHYGSHDYGHYISY---RRFEDQWWRISDESVLKVDEDEVF------SASGIF 478

Query: 1253 LVYVKQ 1258
            +V+ +Q
Sbjct: 479  IVFYEQ 484

>KAFR0I02600 Chr9 (525365..529006) [3642 bp, 1213 aa] {ON} Anc_5.18
            YMR304W
          Length = 1213

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 44/95 (46%), Gaps = 24/95 (25%)

Query: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNFNEGNTATP-- 1250
            Y L  V +H G+ S GHY+  IK    +  W +++DE V +V + +VF+ N G    P  
Sbjct: 431  YKLHGVLVHAGDISTGHYYAMIKPSTEDQ-WYRFDDEKVWKVTKTQVFDENFGLDRIPDD 489

Query: 1251 ---------------------YFLVYVKQGQEADI 1264
                                 Y LVY+++ QEAD+
Sbjct: 490  EVRLMSREQYQNYLLARHTSAYMLVYIREDQEADL 524

 Score = 38.5 bits (88), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 20/38 (52%), Positives = 21/38 (55%), Gaps = 2/38 (5%)

Query: 735 TGINNIGNTCYLNSLLQYYFSIAPLRRYILDYQKTVEN 772
            G  N G TCYLNSLLQ YF     RR +  YQ   EN
Sbjct: 193 VGFKNQGATCYLNSLLQSYFFTKYFRRLV--YQIPTEN 228

 Score = 37.7 bits (86), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 51/97 (52%), Gaps = 10/97 (10%)

Query: 969  DLVKQLFYGTTKQSIVPLSATNKVRTKVERFLSLLINIGDHPKDIYDAFDSYFKDEYLTM 1028
            D + ++F G  K  I  ++   +  ++VE F  L +N+ +  KD+  +F++Y + E +  
Sbjct: 297  DKLNEIFVGRMKSYIKCINVDYE-SSRVEEFWDLQMNVKN-LKDLKSSFENYIEIELMNG 354

Query: 1029 E------EYG--DVTRTVAVTTFPTILQVQIQRVYYD 1057
            E      +YG  D  + V   +FP +L +Q++R  YD
Sbjct: 355  ENQYAAQDYGLQDAEKGVIFESFPPVLHLQLKRFEYD 391

>Suva_13.495 Chr13 (857778..861470) [3693 bp, 1230 aa] {ON} YMR304W
            (REAL)
          Length = 1230

 Score = 47.4 bits (111), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 46/105 (43%), Gaps = 30/105 (28%)

Query: 1186 DDFKEYGYSLFSVFIHRGEASYGHYWIYIKDRNHNGV---WRKYNDETVSEVQEDEVFNF 1242
            D+   Y Y+L  V +H G+ S GHY+  IK     GV   W +++DE V  V + +VF  
Sbjct: 441  DNGNPYIYNLHGVLVHSGDISTGHYYTLIKP----GVEDQWYRFDDERVWRVTKKQVFQE 496

Query: 1243 NEGNTATP-----------------------YFLVYVKQGQEADI 1264
            N G    P                       Y LVY++Q QE D+
Sbjct: 497  NFGCDRLPDEKVRTMTRDDYQNYIIQRHTSAYMLVYIRQDQEQDL 541

 Score = 38.1 bits (87), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 60/123 (48%), Gaps = 10/123 (8%)

Query: 971  VKQLFYGTTKQSIVPLSATNKVRTKVERFLSLLINIGDHPKDIYDAFDSYFKDEYLTME- 1029
            + ++F G  K  I  ++   +  ++VE F  L +N+ +  K++ ++FD+Y + E +  E 
Sbjct: 311  LNEIFVGRMKSYIKCINVDYE-SSRVEDFWDLQMNVKNF-KNLQESFDNYIEMELMNGEN 368

Query: 1030 -----EYG--DVTRTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKEVIYMDRYA 1082
                 +YG  D  + V   +FP +L +Q++R  YD       K  +   F E I +  + 
Sbjct: 369  QYAAQDYGLQDAQKGVIFESFPPVLHLQLKRFEYDFNYDQMIKVNDKYEFPETIDLSPFV 428

Query: 1083 DTE 1085
            D +
Sbjct: 429  DKD 431

 Score = 35.0 bits (79), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 17/29 (58%)

Query: 735 TGINNIGNTCYLNSLLQYYFSIAPLRRYI 763
            G  N G TCYLNSLLQ YF     R+ +
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFRKLV 233

>SAKL0E07106g Chr5 complement(584164..586539) [2376 bp, 791 aa] {ON}
            similar to uniprot|P25037 Saccharomyces cerevisiae
            YDL122W UBP1 Ubiquitin-specific protease that removes
            ubiquitin from ubiquitinated proteins cleaves at the C
            terminus of ubiquitin fusions irrespective of their size
            capable of cleaving polyubiquitin chains
          Length = 791

 Score = 47.0 bits (110), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/49 (46%), Positives = 29/49 (59%), Gaps = 3/49 (6%)

Query: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFN 1241
            YSL SV +H G  +YGHY  +   R H G W + +DETV  V E EV +
Sbjct: 708  YSLRSVIVHYGTHNYGHYIAF---RKHRGFWWRISDETVYIVDEAEVLS 753

>TPHA0P00680 Chr16 (139640..141823) [2184 bp, 727 aa] {ON} Anc_7.390
            YBL067C
          Length = 727

 Score = 47.0 bits (110), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 33/92 (35%), Positives = 46/92 (50%), Gaps = 6/92 (6%)

Query: 1168 MSLYNNIN-NLEEKISHQFDDFKEYGYSLFSVFIHRGEA-SYGHYWIYIKDRNHNGVWRK 1225
            + L+N +N      IS  FDD     Y L S+ +H GE+   GHY    K +++   W  
Sbjct: 561  IKLFNKVNYPFTLNISSVFDDSISKKYELNSIVVHIGESPQLGHYVTLCKHKSYG--WLI 618

Query: 1226 YNDETVSEVQEDEVFNF--NEGNTATPYFLVY 1255
            Y+DETV  V ++ V     NE  +AT Y L Y
Sbjct: 619  YDDETVQAVSDELVSRILNNEQRSATAYLLFY 650

>Suva_6.276 Chr6 complement(481843..485613) [3771 bp, 1256 aa] {ON}
           YJL197W (REAL)
          Length = 1256

 Score = 47.0 bits (110), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 32/89 (35%), Positives = 45/89 (50%), Gaps = 8/89 (8%)

Query: 707 IERNSNLISNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYIL-- 764
           +E N + +SN  +      N L P +  TG+ N+GNTCY+NS LQ    +  LR Y L  
Sbjct: 338 VEGNHHWVSNHFVY-----NKLEPASGTTGLVNLGNTCYMNSALQCLVHLPQLRDYFLYN 392

Query: 765 DYQKTVENFNDHLSNSGHVRRIGGRKISK 793
            Y+K + N  + L   G+V R     I K
Sbjct: 393 GYEKEI-NEENPLGYHGYVARAFSDLIQK 420

>Smik_13.521 Chr13 (857682..861377) [3696 bp, 1231 aa] {ON} YMR304W
            (REAL)
          Length = 1231

 Score = 47.0 bits (110), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 49/108 (45%), Gaps = 32/108 (29%)

Query: 1191 YGYSLFSVFIHRGEASYGHYWIYIKDRNHNGV---WRKYNDETVSEVQEDEVFNFNEGNT 1247
            Y Y+L  V +H G+ S GHY+  IK     GV   W +++DE V  V + +VF  N G  
Sbjct: 447  YVYNLHGVLVHSGDISTGHYYTLIKP----GVEDQWYRFDDERVWRVTKKQVFQENFGCD 502

Query: 1248 ATP-----------------------YFLVYVKQGQEADIEPLKRILQ 1272
              P                       Y LVY++Q QE D+  L+ +L+
Sbjct: 503  RLPDEKVRTMTREDYQNYIIQRHTSAYMLVYIRQEQEEDL--LRPVLE 548

 Score = 39.3 bits (90), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 58/123 (47%), Gaps = 10/123 (8%)

Query: 971  VKQLFYGTTKQSIVPLSATNKVRTKVERFLSLLINIGDHPKDIYDAFDSYFKDEYLTME- 1029
            + ++F G  K S +     +    +VE F  L +N+ +  K++ ++FD+Y + E +  E 
Sbjct: 311  LSEIFVGKMK-SYIKCVNVDYESARVEDFWDLQLNVKNF-KNLQESFDNYIEMELMNGEN 368

Query: 1030 -----EYG--DVTRTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKEVIYMDRYA 1082
                 +YG  D  + V   +FP +L +Q++R  YD       K  +   F E I +  + 
Sbjct: 369  QYAAQDYGLQDAQKGVIFESFPPVLHLQLKRFEYDFNYDQMVKVNDKYEFPETIDLSPFV 428

Query: 1083 DTE 1085
            D E
Sbjct: 429  DKE 431

 Score = 35.0 bits (79), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 17/29 (58%)

Query: 735 TGINNIGNTCYLNSLLQYYFSIAPLRRYI 763
            G  N G TCYLNSLLQ YF     R+ +
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFRKLV 233

>YMR304W Chr13 (874987..878679) [3693 bp, 1230 aa] {ON}
            UBP15Ubiquitin-specific protease involved in protein
            deubiquitination; catalytic activity regulated by an
            N-terminal TRAF-like domain and and C-terminal sequences;
            physically interacts with anaphase-promoting
            complex/cyclosome (APC/C) activator, Cdh1p
          Length = 1230

 Score = 46.6 bits (109), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 49/108 (45%), Gaps = 32/108 (29%)

Query: 1191 YGYSLFSVFIHRGEASYGHYWIYIKDRNHNGV---WRKYNDETVSEVQEDEVFNFNEGNT 1247
            Y Y+L  V +H G+ S GHY+  IK     GV   W +++DE V  V + +VF  N G  
Sbjct: 447  YVYNLHGVLVHSGDISTGHYYTLIKP----GVEDQWYRFDDERVWRVTKKQVFQENFGCD 502

Query: 1248 ATP-----------------------YFLVYVKQGQEADIEPLKRILQ 1272
              P                       Y LVY++Q QE D+  L+ +L+
Sbjct: 503  RLPDEKVRTMTRGEYQNYIIQRHTSAYMLVYIRQEQEEDL--LRPVLE 548

 Score = 37.4 bits (85), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 59/123 (47%), Gaps = 10/123 (8%)

Query: 971  VKQLFYGTTKQSIVPLSATNKVRTKVERFLSLLINIGDHPKDIYDAFDSYFKDEYLTME- 1029
            + ++F G  K  I  ++   +   +VE F  L +N+ +  K++ ++FD+Y + E +  E 
Sbjct: 311  LNEIFVGKMKSYIKCINVDYE-SARVEDFWDLQLNVKNF-KNLQESFDNYIEMELMNGEN 368

Query: 1030 -----EYG--DVTRTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKEVIYMDRYA 1082
                 +YG  D  + V   +FP +L +Q++R  YD       K  +   F E I +  + 
Sbjct: 369  QYAAQDYGLQDAQKGVIFESFPPVLHLQLKRFEYDFNYDQMVKVNDKYEFPETIDLSPFV 428

Query: 1083 DTE 1085
            D +
Sbjct: 429  DKD 431

 Score = 35.0 bits (79), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 17/29 (58%)

Query: 735 TGINNIGNTCYLNSLLQYYFSIAPLRRYI 763
            G  N G TCYLNSLLQ YF     R+ +
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFRKLV 233

>Skud_13.478 Chr13 (848446..852141) [3696 bp, 1231 aa] {ON} YMR304W
            (REAL)
          Length = 1231

 Score = 46.6 bits (109), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 44/100 (44%), Gaps = 30/100 (30%)

Query: 1191 YGYSLFSVFIHRGEASYGHYWIYIKDRNHNGV---WRKYNDETVSEVQEDEVFNFNEGNT 1247
            Y Y+L  V +H G+ S GHY+  IK     GV   W +++DE V  V + +VF  N G  
Sbjct: 447  YIYNLHGVLVHSGDISTGHYYTLIKP----GVEDQWYRFDDERVWRVTKKQVFQENFGCD 502

Query: 1248 ATP-----------------------YFLVYVKQGQEADI 1264
              P                       Y LVY++Q QE D+
Sbjct: 503  RLPDEKVRTMTRDDYQNYIIQRHTSAYMLVYIRQEQEQDL 542

 Score = 35.0 bits (79), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 30/123 (24%), Positives = 58/123 (47%), Gaps = 10/123 (8%)

Query: 971  VKQLFYGTTKQSIVPLSATNKVRTKVERFLSLLINIGDHPKDIYDAFDSYFKDEYLTME- 1029
            + ++F G  K  I  ++   +   +VE F  L +N+ +  +++  +FD+Y + E +  E 
Sbjct: 311  LNEIFVGKMKSYIKCINVDYE-SARVEDFWDLQLNVKNF-ENLQGSFDNYIEMELMNGEN 368

Query: 1030 -----EYG--DVTRTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKEVIYMDRYA 1082
                 +YG  D  + V   +FP +L +Q++R  YD       K  +   F E I +  + 
Sbjct: 369  QYAAQDYGLQDAQKGVIFESFPPVLHLQLKRFEYDFNYDQMVKVNDKYEFPETIDLSPFV 428

Query: 1083 DTE 1085
            D +
Sbjct: 429  DKD 431

 Score = 35.0 bits (79), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 17/29 (58%)

Query: 735 TGINNIGNTCYLNSLLQYYFSIAPLRRYI 763
            G  N G TCYLNSLLQ YF     R+ +
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFRKLV 233

>TPHA0A02510 Chr1 (536076..536097,536233..537728) [1518 bp, 505 aa]
            {ON} Anc_1.369 YFR010W
          Length = 505

 Score = 46.2 bits (108), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 36/69 (52%), Gaps = 2/69 (2%)

Query: 1193 YSLFSVFIHRGEAS-YGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNF-NEGNTATP 1250
            Y L  +  H+G  S  GHY  +I+D N    W K+ND+ VSE ++D++      G + + 
Sbjct: 436  YDLIGIITHQGANSESGHYQSFIRDENDEDKWYKFNDDKVSEYEKDKIEQLAGGGESDSA 495

Query: 1251 YFLVYVKQG 1259
              L+Y   G
Sbjct: 496  LILIYKGMG 504

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 23/34 (67%)

Query: 734 PTGINNIGNTCYLNSLLQYYFSIAPLRRYILDYQ 767
           P G  N+GNTCY+NS LQ  F +  L+  IL+Y+
Sbjct: 108 PIGFQNMGNTCYMNSTLQALFRVDVLKDMILNYK 141

>NDAI0B03430 Chr2 complement(868578..871148) [2571 bp, 856 aa] {ON}
          Length = 856

 Score = 46.2 bits (108), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/48 (47%), Positives = 29/48 (60%), Gaps = 3/48 (6%)

Query: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVF 1240
            YSL SV +H G  +YGHY  +   R + GVW + +DETV  V E EV 
Sbjct: 722  YSLRSVIVHYGTHNYGHYIAF---RKYRGVWWRISDETVYIVDEAEVL 766

>NCAS0I03140 Chr9 complement(576993..580598) [3606 bp, 1201 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1201

 Score = 45.8 bits (107), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 51/108 (47%), Gaps = 8/108 (7%)

Query: 709 RNSNLISNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYIL--DY 766
           +N + +SN+ +      N L P    TG+ N+GNTCY+NS LQ    I   R Y L   Y
Sbjct: 300 KNYHWLSNYFIY-----NDLVPSLEITGLVNLGNTCYMNSALQCITHIPVFREYFLYSGY 354

Query: 767 QKTVENFNDHLSNSGHVRRIGGRKISKGEVERSVQFIYQLRNLFYAMV 814
           +K + N ++ L   GHV       I     ++ VQF     N F A +
Sbjct: 355 EKEL-NTDNPLGYQGHVAEAFSELIRCLFGDKLVQFSAYAPNHFKATI 401

>KNAG0A05450 Chr1 (806796..809090) [2295 bp, 764 aa] {ON} Anc_2.307
            YDL122W
          Length = 764

 Score = 45.8 bits (107), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 22/49 (44%), Positives = 29/49 (59%), Gaps = 3/49 (6%)

Query: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFN 1241
            YSL SV +H G  +YGHY  +   R + G W + +DETV  V E EV +
Sbjct: 624  YSLRSVIVHYGTHNYGHYIAF---RKYRGCWWRISDETVGIVTEAEVLS 669

>ZYRO0C17908g Chr3 complement(1393864..1397478) [3615 bp, 1204 aa]
           {ON} similar to uniprot|P39538 Saccharomyces cerevisiae
           YJL197W UBP12 Ubiquitin-specific protease present in the
           nucleus and cytoplasm that cleaves ubiquitin from
           ubiquitinated proteins
          Length = 1204

 Score = 45.8 bits (107), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 43/79 (54%), Gaps = 8/79 (10%)

Query: 709 RNSNLISNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYIL--DY 766
           +N + +SN+ +      N L P +  TG+ N+GNTCY+NS LQ    I  LR Y L   +
Sbjct: 272 KNYHWLSNYFMY-----NQLTPSSGITGLYNLGNTCYMNSALQCLVHIPELRDYFLYNCF 326

Query: 767 QKTVENFNDHLSNSGHVRR 785
           +  + N N+ L   G+V R
Sbjct: 327 EDEI-NCNNPLGYQGYVAR 344

>KNAG0C01940 Chr3 complement(375973..377472) [1500 bp, 499 aa] {ON}
            Anc_1.369 YFR010W
          Length = 499

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 30/48 (62%), Gaps = 1/48 (2%)

Query: 1193 YSLFSVFIHRGEAS-YGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEV 1239
            Y+L  V  H+G  S  GHY  +I+D N   VW K+ND+ VS V+++ V
Sbjct: 430  YNLVGVITHQGANSDSGHYQAFIRDENDENVWYKFNDDKVSIVEKERV 477

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/101 (34%), Positives = 44/101 (43%), Gaps = 24/101 (23%)

Query: 698 LKAALTKISIERNSNLI---SNFLLTGTIDPN-------------SLPPEN-------WP 734
           +K  LT  S    S++I   S  +L GT D N              L P+         P
Sbjct: 48  VKGGLTDKSASDLSSVIKAGSTVMLLGTPDANLITKPKTASHFIEDLSPDQQVSRFNELP 107

Query: 735 TGINNIGNTCYLNSLLQYYFSIAPLRRYILDYQ-KTVENFN 774
            G  N+GNTCYLN+ LQ  F +  LR  IL+Y  K   N N
Sbjct: 108 IGFKNMGNTCYLNATLQSLFRMDQLRELILNYDPKAFTNLN 148

>NCAS0D00600 Chr4 (102081..103562) [1482 bp, 493 aa] {ON} Anc_1.369
           YFR010W
          Length = 493

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 45/96 (46%), Gaps = 23/96 (23%)

Query: 694 QFLTLKAALTKISIERNSNLI---SNFLLTGTIDPN-------------SLPPENW---- 733
           Q   +K  L+  S+   S++I   SN +L GT D +              L P+      
Sbjct: 43  QKYMVKGGLSDDSVSNLSSVIKAGSNVMLLGTPDADLISKPKGTNHFIEDLTPDQQMQKF 102

Query: 734 ---PTGINNIGNTCYLNSLLQYYFSIAPLRRYILDY 766
              P G+ N+GNTCY+N+ LQ  F +  +R  IL+Y
Sbjct: 103 DSNPIGLQNMGNTCYMNATLQALFRVDSIRDLILNY 138

 Score = 40.4 bits (93), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 34/66 (51%), Gaps = 1/66 (1%)

Query: 1193 YSLFSVFIHRGEAS-YGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNFNEGNTATPY 1251
            Y+L  +  H+G  S  GHY  +I+D      W K+ND+ VS V+++++     G  +   
Sbjct: 424  YNLVGIITHQGANSESGHYQAFIRDETDENKWYKFNDDKVSVVEKEKIEALAGGGESDSA 483

Query: 1252 FLVYVK 1257
             ++  K
Sbjct: 484  LILMYK 489

>Skud_6.94 Chr6 complement(173619..175118) [1500 bp, 499 aa] {ON}
           YFR010W (REAL)
          Length = 499

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/87 (35%), Positives = 38/87 (43%), Gaps = 25/87 (28%)

Query: 715 SNFLLTGTIDPN-------------SLPPENW-------PTGINNIGNTCYLNSLLQYYF 754
           S  +L GT D N              L PE         P G  N+GNTCYLN+ LQ  +
Sbjct: 69  STVMLLGTPDANLISKPAKRNNFIEDLAPEQQVQQFAETPVGFKNMGNTCYLNATLQALY 128

Query: 755 SIAPLRRYILDYQKTVENFNDHLSNSG 781
            +  LR  IL+Y     N +   SNSG
Sbjct: 129 RVDDLRDMILNY-----NPSQEASNSG 150

 Score = 40.4 bits (93), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 35/66 (53%), Gaps = 1/66 (1%)

Query: 1193 YSLFSVFIHRGEAS-YGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNFNEGNTATPY 1251
            Y+L  V  H+G  S  GHY  +I+D      W K+ND+ VS V+++++ +   G  +   
Sbjct: 430  YNLIGVITHQGANSESGHYQAFIRDELDENKWYKFNDDKVSVVEKEKIESLAGGGESDSA 489

Query: 1252 FLVYVK 1257
             ++  K
Sbjct: 490  LILMYK 495

>YFR010W Chr6 (165067..166566) [1500 bp, 499 aa] {ON}
           UBP6Ubiquitin-specific protease situated in the base
           subcomplex of the 26S proteasome, releases free
           ubiquitin from branched polyubiquitin chains; works in
           opposition to Hul5p polyubiquitin elongation activity;
           mutant has aneuploidy tolerance
          Length = 499

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 29/48 (60%), Gaps = 5/48 (10%)

Query: 734 PTGINNIGNTCYLNSLLQYYFSIAPLRRYILDYQKTVENFNDHLSNSG 781
           P G  N+GNTCYLN+ LQ  + +  LR  IL+Y     N +  +SNSG
Sbjct: 108 PVGFKNMGNTCYLNATLQALYRVNDLRDMILNY-----NPSQGVSNSG 150

 Score = 40.4 bits (93), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 35/66 (53%), Gaps = 1/66 (1%)

Query: 1193 YSLFSVFIHRGEAS-YGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNFNEGNTATPY 1251
            Y+L  V  H+G  S  GHY  +I+D      W K+ND+ VS V+++++ +   G  +   
Sbjct: 430  YNLIGVITHQGANSESGHYQAFIRDELDENKWYKFNDDKVSVVEKEKIESLAGGGESDSA 489

Query: 1252 FLVYVK 1257
             ++  K
Sbjct: 490  LILMYK 495

>Kpol_1003.53 s1003 (121699..124065) [2367 bp, 788 aa] {ON}
            (121699..124065) [2367 nt, 789 aa]
          Length = 788

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 30/49 (61%), Gaps = 3/49 (6%)

Query: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFN 1241
            YSL SV +H G  +YGHY  +   R + G W + +DE+V+ V E EV +
Sbjct: 687  YSLRSVIVHYGTHNYGHYIAF---RKYRGCWWRISDESVTIVDEAEVLS 732

>YJL197W Chr10 (63805..67569) [3765 bp, 1254 aa] {ON}
           UBP12Ubiquitin carboxyl-terminal hydrolase,
           ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1254

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 41/81 (50%), Gaps = 8/81 (9%)

Query: 707 IERNSNLISNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYIL-- 764
           IE N +  SN+        N L P +  TG+ N+GNTCY+NS LQ    I  LR Y L  
Sbjct: 341 IEGNHHWPSNYFAY-----NKLEPASGTTGLVNLGNTCYMNSALQCLVHIPQLRDYFLYD 395

Query: 765 DYQKTVENFNDHLSNSGHVRR 785
            Y+  + N  + L   G+V R
Sbjct: 396 GYEDEI-NEENPLGYHGYVAR 415

>KAFR0L01730 Chr12 (316860..318965) [2106 bp, 701 aa] {ON} Anc_7.390
            YBL067C
          Length = 701

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/76 (36%), Positives = 34/76 (44%), Gaps = 3/76 (3%)

Query: 1181 ISHQFDDFKEYGYSLFSVFIHRGEA-SYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEV 1239
            +S  FD      Y L S  IH G+   YGHY    K       W  ++DETV  V E  V
Sbjct: 547  VSSTFDSKLSKRYELASAVIHLGDGPQYGHYISLCKTETFG--WLLFDDETVEAVDEQTV 604

Query: 1240 FNFNEGNTATPYFLVY 1255
             +F   N+ T Y L Y
Sbjct: 605  LSFTGENSDTAYVLFY 620

 Score = 35.8 bits (81), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 20/31 (64%)

Query: 736 GINNIGNTCYLNSLLQYYFSIAPLRRYILDY 766
           G  N GNTCY NS+LQ +F+ +  R  +L +
Sbjct: 128 GYENFGNTCYCNSILQCFFNHSVFRTSMLSF 158

>Smik_7.314 Chr7 (526664..528163) [1500 bp, 499 aa] {ON} YFR010W
           (REAL)
          Length = 499

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 29/48 (60%), Gaps = 5/48 (10%)

Query: 734 PTGINNIGNTCYLNSLLQYYFSIAPLRRYILDYQKTVENFNDHLSNSG 781
           P G  N+GNTCYLN+ LQ  + +  LR  IL+Y     N +  +SN+G
Sbjct: 108 PVGFKNMGNTCYLNATLQALYRVNDLREMILNY-----NPSQGVSNNG 150

 Score = 40.0 bits (92), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 35/66 (53%), Gaps = 1/66 (1%)

Query: 1193 YSLFSVFIHRGEAS-YGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNFNEGNTATPY 1251
            Y+L  V  H+G  S  GHY  +I+D      W K+ND+ VS V+++++ +   G  +   
Sbjct: 430  YNLIGVITHQGANSESGHYQAFIRDELDENKWYKFNDDKVSVVEKEKIESLAGGGESDSA 489

Query: 1252 FLVYVK 1257
             ++  K
Sbjct: 490  LILMYK 495

>CAGL0H10582g Chr8 complement(1029876..1032248) [2373 bp, 790 aa] {ON}
            similar to uniprot|P25037 Saccharomyces cerevisiae
            YDL122w UBP1 ubiquitin-specific protease
          Length = 790

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/48 (47%), Positives = 29/48 (60%), Gaps = 3/48 (6%)

Query: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVF 1240
            Y+L SV +H G  +YGHY  Y K R   GVW + +DE+V  V E EV 
Sbjct: 689  YALRSVIVHYGTHNYGHYIAYRKFR---GVWWRISDESVYVVDEAEVL 733

>Skud_4.133 Chr4 (238225..240588) [2364 bp, 787 aa] {ON} YDL122W
            (REAL)
          Length = 787

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 28/48 (58%), Gaps = 3/48 (6%)

Query: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVF 1240
            YSL SV +H G  +YGHY  +   R + G W + +DETV  V E EV 
Sbjct: 683  YSLRSVIVHYGTHNYGHYIAF---RKYRGCWWRISDETVYVVDEAEVL 727

>Kpol_534.23 s534 (53632..53653,53786..55254) [1491 bp, 496 aa] {ON}
           (53632..53653,53786..55254) [1491 nt, 497 aa]
          Length = 496

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 46/98 (46%), Gaps = 23/98 (23%)

Query: 694 QFLTLKAALTKISIERNSNLI---SNFLLTGTIDPN-------------SLPPEN----- 732
           Q   +K  LT  +I   S++I   S  +L GT D +              L PE+     
Sbjct: 45  QKYMVKGGLTDNTISNLSSVIKPGSTVMLLGTPDADMISKPKESNKFIEDLAPEHQRQKF 104

Query: 733 --WPTGINNIGNTCYLNSLLQYYFSIAPLRRYILDYQK 768
              P G+ N+GNTCY+NS LQ  + +  LR  +L Y++
Sbjct: 105 NQMPIGLLNMGNTCYMNSTLQALYRVDGLRDMVLKYKE 142

 Score = 40.4 bits (93), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 34/69 (49%), Gaps = 2/69 (2%)

Query: 1193 YSLFSVFIHRGEAS-YGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNF-NEGNTATP 1250
            Y L  V  H+G  S  GHY  +I+D      W K+ND+ VS V+ +++      G + + 
Sbjct: 427  YDLIGVITHQGANSESGHYQSFIRDEKDENKWYKFNDDKVSVVEREKIEALAGGGESDSA 486

Query: 1251 YFLVYVKQG 1259
              L+Y   G
Sbjct: 487  LILIYKGLG 495

>Suva_5.217 Chr5 (329688..331952) [2265 bp, 754 aa] {ON} YER098W
            (REAL)
          Length = 754

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/95 (35%), Positives = 42/95 (44%), Gaps = 6/95 (6%)

Query: 1165 NELMSLYNNIN-NLEEKISHQFDDFKEYGYSLFSVFIHRGEA-SYGHYWIYIKDRNHNGV 1222
            N  + L+N I   L   +S  FD      Y L  V IH G    +GHY    K  N    
Sbjct: 575  NSNIKLFNKIRYPLRLDVSSTFDTSVSKRYELSGVVIHMGSGPQHGHYVCICK--NEKFG 632

Query: 1223 WRKYNDETVSEVQEDEVFNF--NEGNTATPYFLVY 1255
            W  Y+DETV  V E+ V  F  + G+  T Y L Y
Sbjct: 633  WLLYDDETVESVSEETVLKFTGHSGDQTTAYVLFY 667

 Score = 36.2 bits (82), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 19/31 (61%)

Query: 736 GINNIGNTCYLNSLLQYYFSIAPLRRYILDY 766
           G  N GNTCY NS+LQ  ++I   R  +L Y
Sbjct: 137 GYENFGNTCYCNSVLQCLYNIPEFRCNVLRY 167

>YDL122W Chr4 (242552..244981) [2430 bp, 809 aa] {ON}
            UBP1Ubiquitin-specific protease that removes ubiquitin
            from ubiquitinated proteins; cleaves at the C terminus of
            ubiquitin fusions irrespective of their size; capable of
            cleaving polyubiquitin chains
          Length = 809

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 28/48 (58%), Gaps = 3/48 (6%)

Query: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVF 1240
            YSL SV +H G  +YGHY  +   R + G W + +DETV  V E EV 
Sbjct: 681  YSLRSVIVHYGTHNYGHYIAF---RKYRGCWWRISDETVYVVDEAEVL 725

>Smik_4.115 Chr4 (219167..221539) [2373 bp, 790 aa] {ON} YDL122W
            (REAL)
          Length = 790

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 28/48 (58%), Gaps = 3/48 (6%)

Query: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVF 1240
            YSL SV +H G  +YGHY  +   R + G W + +DETV  V E EV 
Sbjct: 682  YSLRSVIVHYGTHNYGHYIAF---RKYRGCWWRISDETVYVVDEAEVL 726

>Smik_2.49 Chr2 complement(87575..89812) [2238 bp, 745 aa] {ON}
           YBL067C (REAL)
          Length = 745

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 31/51 (60%), Gaps = 9/51 (17%)

Query: 736 GINNIGNTCYLNSLLQYYFSIAPLRRYILDY-QKTVENFNDHLSNSGHVRR 785
           G  N GNTCY NS+LQ  ++++PLR  IL + +K +E        SGH R+
Sbjct: 141 GYENFGNTCYCNSVLQCLYNLSPLRENILQFPEKPIE--------SGHPRK 183

>Suva_4.125 Chr4 (231011..233392) [2382 bp, 793 aa] {ON} YDL122W
            (REAL)
          Length = 793

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 28/48 (58%), Gaps = 3/48 (6%)

Query: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVF 1240
            YSL SV +H G  +YGHY  +   R + G W + +DETV  V E EV 
Sbjct: 685  YSLRSVIVHYGTHNYGHYIAF---RKYRGCWWRISDETVYVVDEAEVL 729

>TDEL0C05640 Chr3 complement(1005536..1009072) [3537 bp, 1178 aa]
           {ON} Anc_1.137 YJL197W
          Length = 1178

 Score = 44.3 bits (103), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 24/39 (61%)

Query: 726 NSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYIL 764
           N+L P    TG+ N+GNTCY+NS LQ    I  LR Y L
Sbjct: 293 NTLQPSQGITGLTNLGNTCYMNSALQCLVHIPELRDYFL 331

>TDEL0G02370 Chr7 (456393..458636) [2244 bp, 747 aa] {ON} Anc_2.307
            YDL122W
          Length = 747

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 34/63 (53%), Gaps = 8/63 (12%)

Query: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNFNEGNTATPYF 1252
            Y L SV +H G  +YGHY  +   R + G W + +DETV  V+E EV      +T+  + 
Sbjct: 658  YVLRSVIVHYGTHNYGHYIAF---RKYRGCWWRISDETVYVVEEAEVL-----STSGVFM 709

Query: 1253 LVY 1255
            L Y
Sbjct: 710  LFY 712

 Score = 37.0 bits (84), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 28/45 (62%)

Query: 721 GTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYILD 765
           G +D ++L    +  G+ N GNTC++NS++Q   S A L +++ D
Sbjct: 78  GQVDQHTLDKGGYVAGLVNDGNTCFMNSVIQSLASSAELMKFLDD 122

>KAFR0A06910 Chr1 complement(1393653..1395689) [2037 bp, 678 aa] {ON}
            Anc_2.307 YDL122W
          Length = 678

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 28/48 (58%), Gaps = 3/48 (6%)

Query: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVF 1240
            YSL SV +H G  +YGHY  +   R + G W + +DETV  V E EV 
Sbjct: 577  YSLRSVIVHYGTHNYGHYIAF---RKYRGYWWRISDETVYIVDETEVL 621

>Smik_5.244 Chr5 (364470..366719) [2250 bp, 749 aa] {ON} YER098W
            (REAL)
          Length = 749

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 36/78 (46%), Gaps = 5/78 (6%)

Query: 1181 ISHQFDDFKEYGYSLFSVFIHRGEA-SYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEV 1239
            +S  FD      Y L  V IH G    +GHY    K  N    W  Y+DETV  ++E+ V
Sbjct: 587  VSSTFDTSVSKKYELSGVVIHMGSGPQHGHYVCICK--NEKFGWLLYDDETVESIREETV 644

Query: 1240 FNF--NEGNTATPYFLVY 1255
              F  + G+  T Y L Y
Sbjct: 645  LQFTGHPGDQTTAYVLFY 662

 Score = 37.0 bits (84), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 19/31 (61%)

Query: 736 GINNIGNTCYLNSLLQYYFSIAPLRRYILDY 766
           G  N GNTCY NS+LQ  ++I   R  IL Y
Sbjct: 135 GYENFGNTCYCNSVLQCLYNIPEFRCNILQY 165

>AGR389C Chr7 complement(1444377..1446704) [2328 bp, 775 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YDL122W
            (UBP1)
          Length = 775

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/49 (44%), Positives = 28/49 (57%), Gaps = 3/49 (6%)

Query: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFN 1241
            YSL SV +H G  +YGHY  +   R   GVW + +DET   V E EV +
Sbjct: 674  YSLRSVIVHYGTHNYGHYIAF---RKFRGVWWRISDETAYIVDEAEVLS 719

>TPHA0G00850 Chr7 (158945..161293) [2349 bp, 782 aa] {ON} Anc_2.307
            YDL122W
          Length = 782

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 30/49 (61%), Gaps = 3/49 (6%)

Query: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFN 1241
            YSL SV +H G  +YGHY  +   R + G W + +DE+V  V+E EV +
Sbjct: 674  YSLRSVIVHYGTHNYGHYIAF---RRYRGCWWRISDESVYIVEEAEVLS 719

>TBLA0B06080 Chr2 (1437254..1439728) [2475 bp, 824 aa] {ON} Anc_2.307
            YDL122W
          Length = 824

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 33/63 (52%), Gaps = 8/63 (12%)

Query: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNFNEGNTATPYF 1252
            Y L SV +H G  +YGHY  +   R + G W + +DETV  V E EV      +T + + 
Sbjct: 672  YELRSVIVHYGTHNYGHYIAF---RKYRGTWWRISDETVHMVDEAEVL-----STPSVFM 723

Query: 1253 LVY 1255
            L Y
Sbjct: 724  LFY 726

>Smik_10.37 Chr10 (61787..65530) [3744 bp, 1247 aa] {ON} YJL197W
           (REAL)
          Length = 1247

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 36/70 (51%), Gaps = 3/70 (4%)

Query: 726 NSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYIL--DYQKTVENFNDHLSNSGHV 783
           N L P +  TG+ N+GNTCY+NS LQ    I  LR Y L   Y+  + N  + L   G+V
Sbjct: 355 NKLEPASGTTGLVNLGNTCYMNSALQCLVHIPQLRDYFLYDGYENEI-NEENPLGYHGYV 413

Query: 784 RRIGGRKISK 793
            R     I K
Sbjct: 414 ARAFSDLIQK 423

>NCAS0B06130 Chr2 complement(1159264..1161576) [2313 bp, 770 aa] {ON}
            Anc_2.307 YDL122W
          Length = 770

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/49 (44%), Positives = 28/49 (57%), Gaps = 3/49 (6%)

Query: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFN 1241
            YSL SV +H G  +YGHY  +   R   G W + +DETV  V E EV +
Sbjct: 644  YSLRSVIVHYGTHNYGHYIAF---RKFRGCWWRISDETVYIVDEAEVLS 689

 Score = 33.9 bits (76), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 31/58 (53%), Gaps = 1/58 (1%)

Query: 709 RNSNLISNFL-LTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYILD 765
           +N+N+   ++   G ID   L    +  G+ N GNTC++NS+LQ   S   L  ++ D
Sbjct: 64  KNNNMFRRWIPRAGNIDDKILKKGGFVGGLVNDGNTCFMNSVLQSLASSKELNAFLDD 121

>ZYRO0A02420g Chr1 (190417..192654) [2238 bp, 745 aa] {ON} similar to
            uniprot|P25037 Saccharomyces cerevisiae YDL122W UBP1
            Ubiquitin-specific protease that removes ubiquitin from
            ubiquitinated proteins cleaves at the C terminus of
            ubiquitin fusions irrespective of their size capable of
            cleaving polyubiquitin chains
          Length = 745

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/49 (44%), Positives = 29/49 (59%), Gaps = 3/49 (6%)

Query: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFN 1241
            YSL SV +H G  +YGHY  +   R + G W + +DETV  V E EV +
Sbjct: 654  YSLRSVVVHYGTHNYGHYIAF---RRYRGYWWRISDETVYIVDETEVLS 699

>NDAI0A01670 Chr1 complement(368070..370610) [2541 bp, 846 aa] {ON}
            Anc_7.390 YBL067C
          Length = 846

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 36/78 (46%), Gaps = 5/78 (6%)

Query: 1181 ISHQFDDFKEYGYSLFSVFIHRGEA-SYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEV 1239
            ++  FD   E  Y L  V IH G +  +GHY    K  N    W  ++DETV  V E  V
Sbjct: 680  VASTFDSSIEKAYELTGVVIHMGSSPQHGHYVSLCK--NDKFGWLLFDDETVESVSESTV 737

Query: 1240 FNF--NEGNTATPYFLVY 1255
              F  +  N AT Y L Y
Sbjct: 738  LEFTGDPNNQATAYVLFY 755

 Score = 35.0 bits (79), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 31/58 (53%), Gaps = 9/58 (15%)

Query: 736 GINNIGNTCYLNSLLQYYFSIAPLRRYILDYQKTVENFNDHLSNSGHVRRIGGRKISK 793
           G  N GNTCY NS+LQ  +++   R  +L+Y       +DHL ++     I  R+I K
Sbjct: 173 GYENFGNTCYCNSVLQCLYNLYEFRLNMLEY-------SDHLPHN--YANIENRRIRK 221

>Kwal_27.11444 s27 complement(802766..805039) [2274 bp, 757 aa] {ON}
            YDL122W (UBP1) - Ubiquitin-specific protease [contig 27]
            FULL
          Length = 757

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/49 (44%), Positives = 30/49 (61%), Gaps = 3/49 (6%)

Query: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFN 1241
            Y+L SV +H G  +YGHY  + K R   G+W + +DETV  V E EV +
Sbjct: 678  YALRSVIVHYGSHNYGHYIAFRKFR---GLWWRISDETVYVVDEAEVLS 723

>Skud_5.223 Chr5 (351514..353760) [2247 bp, 748 aa] {ON} YER098W
            (REAL)
          Length = 748

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 36/78 (46%), Gaps = 5/78 (6%)

Query: 1181 ISHQFDDFKEYGYSLFSVFIHRGEA-SYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEV 1239
            +S  FD      Y L  V IH G    +GHY    K  N    W  Y+DETV  ++E+ V
Sbjct: 581  VSSTFDSSISKKYELSGVVIHMGSGPQHGHYVCICK--NEKFGWLLYDDETVESIREETV 638

Query: 1240 FNF--NEGNTATPYFLVY 1255
              F  + G+  T Y L Y
Sbjct: 639  LKFTGHPGDQTTAYVLFY 656

 Score = 37.4 bits (85), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 22/35 (62%)

Query: 736 GINNIGNTCYLNSLLQYYFSIAPLRRYILDYQKTV 770
           G  N GNTCY NS+LQ  ++I+  R  +L Y + V
Sbjct: 127 GYENFGNTCYCNSVLQCLYNISEFRCNVLRYPERV 161

>KLTH0G10934g Chr7 (919304..921580) [2277 bp, 758 aa] {ON} similar to
            uniprot|P25037 Saccharomyces cerevisiae YDL122W UBP1
            Ubiquitin-specific protease that removes ubiquitin from
            ubiquitinated proteins cleaves at the C terminus of
            ubiquitin fusions irrespective of their size capable of
            cleaving polyubiquitin chains
          Length = 758

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/49 (44%), Positives = 30/49 (61%), Gaps = 3/49 (6%)

Query: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFN 1241
            Y+L SV +H G  +YGHY  + K R   G+W + +DETV  V E EV +
Sbjct: 679  YALRSVIVHYGTHNYGHYIAFRKFR---GLWWRISDETVYVVDEAEVLS 724

>NDAI0H03550 Chr8 complement(865851..867359) [1509 bp, 502 aa] {ON}
           Anc_1.369 YFR010W
          Length = 502

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 23/34 (67%)

Query: 734 PTGINNIGNTCYLNSLLQYYFSIAPLRRYILDYQ 767
           P G  N+GNTCY+N+ LQ  +    +R+ ILDY+
Sbjct: 110 PIGFQNMGNTCYMNATLQALYRTDDIRQMILDYK 143

 Score = 41.2 bits (95), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 35/66 (53%), Gaps = 1/66 (1%)

Query: 1193 YSLFSVFIHRGEAS-YGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNFNEGNTATPY 1251
            Y+L  +  H+G  S  GHY  +++D N    W K+ND+ V+ V+++++     G  +   
Sbjct: 433  YNLIGIITHQGANSESGHYQAFMRDENDENKWYKFNDDKVTVVEKEKIEALAGGGESDSA 492

Query: 1252 FLVYVK 1257
             ++  K
Sbjct: 493  LILMYK 498

>Skud_10.22 Chr10 (38735..42502) [3768 bp, 1255 aa] {ON} YJL197W
           (REAL)
          Length = 1255

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 41/81 (50%), Gaps = 8/81 (9%)

Query: 707 IERNSNLISNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYIL-- 764
           I+ N +  SN+        N L P +  TG+ N+GNTCY+NS LQ    I  LR Y L  
Sbjct: 341 IKGNCHWASNYFAY-----NKLEPGSGTTGLVNLGNTCYMNSALQCLVHIPQLRDYFLYN 395

Query: 765 DYQKTVENFNDHLSNSGHVRR 785
            Y+  + N  + L   G+V R
Sbjct: 396 GYESEI-NEENPLGYHGYVAR 415

>Klac_YGOB_Anc_5.18b Chr3 (1201452..1202573,1202576..1204954) [3501
            bp, 1166 aa] {ON} ANNOTATED BY YGOB -
          Length = 1166

 Score = 43.1 bits (100), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 44/103 (42%), Gaps = 26/103 (25%)

Query: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNFNEGNTATP-- 1250
            Y L  V +H G+ S GHY+  I+   H G W +++D+ V +  + +VF  N G    P  
Sbjct: 431  YILHGVLVHSGDISTGHYYAMIQPDAH-GSWYRFDDDRVIKATDKQVFEENFGKAKLPDD 489

Query: 1251 ---------------------YFLVYVKQGQEADIEPLKRILQ 1272
                                 Y LVY+++  E  I  LK + Q
Sbjct: 490  EIQGFTKDEYQNYLLARQTSAYMLVYIRKDMEESI--LKEVEQ 530

 Score = 37.4 bits (85), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 59/124 (47%), Gaps = 9/124 (7%)

Query: 971  VKQLFYGTTKQSIVPLSATNKVRTKVERFLSLLINIGDHPKDIYDAFDSYFKDEYLTME- 1029
            + +LF G  K  I  ++   +  ++VE F  + +N+ D  K++ ++F+ Y + E +  E 
Sbjct: 303  INELFVGKMKSCIKCINVDYE-SSRVEDFWDIQLNVKDM-KNLQESFEQYIEVELMNGEN 360

Query: 1030 -----EYG-DVTRTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKEVIYMDRYAD 1083
                 ++G    + V   +FP +L +Q++R  YD       K  +   F E I +  Y D
Sbjct: 361  QYAAQDHGLQDAQKVVFESFPPVLHLQLKRFEYDFNYDQLIKINDRYEFPESIDLSHYLD 420

Query: 1084 TENP 1087
            +  P
Sbjct: 421  SAAP 424

>CAGL0M13783g Chr13 (1354198..1357788) [3591 bp, 1196 aa] {ON} similar
            to uniprot|P50101 Saccharomyces cerevisiae YMR304w UBP15
          Length = 1196

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 34/58 (58%), Gaps = 1/58 (1%)

Query: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNFNEGNTATP 1250
            Y+L  V +H G+ S GHY+  IK    +  W +++DE V +V +++VF  N G  A P
Sbjct: 439  YNLHGVLVHAGDISTGHYYTLIKPGLEDQ-WYRFDDERVWKVTKNQVFEENYGLDALP 495

 Score = 38.9 bits (89), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 50/96 (52%), Gaps = 10/96 (10%)

Query: 970  LVKQLFYGTTKQSIVPLSATNKVRTKVERFLSLLINIGDHPKDIYDAFDSYFKDEYLTME 1029
            ++ ++F G  K S +     +   ++VE F  L +N+ +  K + ++FD+Y + E L  E
Sbjct: 308  MLNEIFVGKMK-SYIKCIDVDYESSRVEDFWDLQLNVKNM-KGLKESFDNYIEIELLNGE 365

Query: 1030 ------EYG--DVTRTVAVTTFPTILQVQIQRVYYD 1057
                  +YG  D  + V   +FP +L +Q++R  YD
Sbjct: 366  NQYQAQDYGLQDAEKGVIFESFPPVLHLQLKRFEYD 401

 Score = 38.1 bits (87), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 20/38 (52%), Positives = 21/38 (55%), Gaps = 2/38 (5%)

Query: 735 TGINNIGNTCYLNSLLQYYFSIAPLRRYILDYQKTVEN 772
            G  N G TCYLNSLLQ YF     RR +  YQ   EN
Sbjct: 203 VGFRNQGATCYLNSLLQSYFFTKYFRRLV--YQIPTEN 238

>CAGL0K10494g Chr11 (1023698..1025185) [1488 bp, 495 aa] {ON} highly
           similar to uniprot|P43593 Saccharomyces cerevisiae
           YFR010w UBP6 ubiquitin-specific protease
          Length = 495

 Score = 42.4 bits (98), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 41/96 (42%), Gaps = 23/96 (23%)

Query: 694 QFLTLKAALTKISIERNSNLI---SNFLLTGTIDPNSL--PPE----------------- 731
           Q   +K  L+  SI     +I   S  +L GT D N L  P E                 
Sbjct: 45  QKFMVKGGLSDDSIANLQTIIKPGSTVMLLGTPDANLLSKPAEKHRFVEDLSPDQQVQQF 104

Query: 732 -NWPTGINNIGNTCYLNSLLQYYFSIAPLRRYILDY 766
            + P G+ N+GNTCYLN+ LQ  F    L+  IL Y
Sbjct: 105 NSTPLGLQNMGNTCYLNATLQALFRADELKDLILQY 140

 Score = 41.2 bits (95), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 34/66 (51%), Gaps = 1/66 (1%)

Query: 1193 YSLFSVFIHRGEAS-YGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNFNEGNTATPY 1251
            Y L  V  H+G  S  GHY  +I+D +    W K+ND+ VS ++++++     G  +   
Sbjct: 426  YDLIGVITHQGANSESGHYQAFIRDESDENKWYKFNDDKVSPIEKEKIEALAGGGESDSA 485

Query: 1252 FLVYVK 1257
             ++  K
Sbjct: 486  LILLYK 491

>NCAS0D02390 Chr4 complement(451930..455565) [3636 bp, 1211 aa] {ON}
            Anc_5.18
          Length = 1211

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 43/95 (45%), Gaps = 24/95 (25%)

Query: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNFNEGNTATP-- 1250
            Y+L  V +H G+ S GHY+  IK  +    W +++DE V +V + +VF  N G    P  
Sbjct: 444  YTLHGVLVHTGDISTGHYYAMIKP-DLQDQWYRFDDEKVWKVTKKQVFEENFGMNKLPEE 502

Query: 1251 ---------------------YFLVYVKQGQEADI 1264
                                 Y LVY+++ +E ++
Sbjct: 503  EIRGMTREQYQNYLITRHTSAYMLVYIREDKEPEV 537

 Score = 37.0 bits (84), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 21/38 (55%), Gaps = 2/38 (5%)

Query: 735 TGINNIGNTCYLNSLLQYYFSIAPLRRYILDYQKTVEN 772
            G  N G TCYLNSLLQ YF     R+ +  YQ   EN
Sbjct: 207 VGFRNQGATCYLNSLLQSYFFTKYFRKLV--YQIPTEN 242

 Score = 35.8 bits (81), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 61/128 (47%), Gaps = 14/128 (10%)

Query: 971  VKQLFYGTTKQSIVPLSATNKVRTKVERFLSLLINIGDHPKDIYDAFDSYFKDEYLTME- 1029
            + +LF G  K  I  ++   +  ++VE F  L +N+ +  K + ++F +Y + E +  E 
Sbjct: 313  LNELFVGKMKSYIKCINVDYE-SSRVEDFWDLQLNVKNL-KGLEESFKNYIEIELMNGEN 370

Query: 1030 -----EYG--DVTRTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKEVI----YM 1078
                 ++G  D  + V   +FP IL +Q++R  YD       K  +   F E I    YM
Sbjct: 371  QYAAQDFGLQDAEKGVIFESFPPILHLQLKRFEYDFNYDQLIKINDRYEFPESIDVSPYM 430

Query: 1079 DRYADTEN 1086
            D+ A  EN
Sbjct: 431  DKKALREN 438

>KLLA0D08459g Chr4 complement(718046..720298) [2253 bp, 750 aa] {ON}
            some similarities with uniprot|P53874 Saccharomyces
            cerevisiae YNL186W UBP10 Ubiquitin-specific protease that
            deubiquitinates ubiquitin-protein moieties may regulate
            silencing by acting on Sir4p involved in
            posttranscriptionally regulating Gap1p and possibly other
            transporters primarily located in the nucleus
          Length = 750

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 36/66 (54%), Gaps = 8/66 (12%)

Query: 1193 YSLFSVFIHRGEA-SYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNFNEGNTATPY 1251
            Y L SV +H G + S GHY  + K  +  G W  Y+DE ++++ E ++    E N    Y
Sbjct: 639  YQLISVVVHEGRSLSSGHYIAHCKQPD--GSWATYDDEYINKISEKQL--LKEPNA---Y 691

Query: 1252 FLVYVK 1257
            FLVY +
Sbjct: 692  FLVYTR 697

>KAFR0D02160 Chr4 (432966..435506) [2541 bp, 846 aa] {ON} Anc_5.712
           YIL156W
          Length = 846

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 32/52 (61%), Gaps = 3/52 (5%)

Query: 735 TGINNIGNTCYLNSLLQYYFSIAPLRRYILD--YQKTVENFND-HLSNSGHV 783
           +G+ N+GNTCY+NS+LQ  F+    R   L   Y++ +    D HLSNS H+
Sbjct: 446 SGLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGTKVDPHLSNSFHI 497

>AFR627C Chr6 complement(1572814..1576677) [3864 bp, 1287 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL197W
           (UBP12)
          Length = 1287

 Score = 42.7 bits (99), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 30/50 (60%), Gaps = 3/50 (6%)

Query: 736 GINNIGNTCYLNSLLQYYFSIAPLRRYIL--DYQKTVENFNDHLSNSGHV 783
           G++N+GNTCY+NS LQ    I   + Y L   Y+K V N  + L + GH+
Sbjct: 347 GLSNLGNTCYMNSALQCLLHIPEFKDYFLYNGYEKEV-NIENPLGHKGHI 395

>TBLA0J00600 Chr10 (129182..133570) [4389 bp, 1462 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1462

 Score = 42.7 bits (99), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 38/77 (49%), Gaps = 3/77 (3%)

Query: 726 NSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYIL--DYQKTVENFNDHLSNSGHV 783
           N L P     G+ N+GNTCY+NS LQ    +     Y L   YQK + N ++ +   G+V
Sbjct: 405 NYLVPSTGTLGLVNLGNTCYMNSALQCLIHLPKFNEYFLLNGYQKEI-NLDNPIGYQGNV 463

Query: 784 RRIGGRKISKGEVERSV 800
               G+ I K   ER +
Sbjct: 464 ANAFGKLIHKLFEERII 480

>Kwal_33.13628 s33 (324581..328063) [3483 bp, 1160 aa] {ON} YJL197W
           (UBP12) - ubiquitin carboxyl-terminal hydrolase [contig
           114] FULL
          Length = 1160

 Score = 42.4 bits (98), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 33/59 (55%), Gaps = 5/59 (8%)

Query: 706 SIERNSNLISNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYIL 764
            +E++ + +SN+        N L P +   G++N+GN+CY+NS LQ    I  LR Y L
Sbjct: 274 GVEKDQHWLSNYYYY-----NKLSPPSGIVGLSNLGNSCYMNSALQCLVHIPELRDYFL 327

>KAFR0A07580 Chr1 complement(1528362..1530770) [2409 bp, 802 aa] {ON}
            Anc_2.69 YNL186W
          Length = 802

 Score = 42.4 bits (98), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 37/66 (56%), Gaps = 8/66 (12%)

Query: 1193 YSLFSVFIHRGEA-SYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNFNEGNTATPY 1251
            Y L SV +H G + S GHY  + K    +G+W  Y+DE ++++ + EV    E N    Y
Sbjct: 673  YQLISVVVHEGRSLSSGHYVAHCK--QPDGLWATYDDEYINKISDKEV--LRETNA---Y 725

Query: 1252 FLVYVK 1257
            +LVY +
Sbjct: 726  YLVYSR 731

>Suva_6.83 Chr6 complement(143456..144958) [1503 bp, 500 aa] {ON}
           YFR010W (REAL)
          Length = 500

 Score = 42.0 bits (97), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 22/33 (66%)

Query: 734 PTGINNIGNTCYLNSLLQYYFSIAPLRRYILDY 766
           P G  N+GNTCYLN+ LQ  + +  +R  IL+Y
Sbjct: 108 PVGFKNMGNTCYLNATLQALYRVDDVRDMILNY 140

 Score = 40.0 bits (92), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 35/66 (53%), Gaps = 1/66 (1%)

Query: 1193 YSLFSVFIHRGEAS-YGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNFNEGNTATPY 1251
            Y+L  V  H+G  S  GHY  +I+D      W K+ND+ V+ V+++++ +   G  +   
Sbjct: 431  YNLIGVITHQGANSESGHYQAFIRDELDENKWYKFNDDKVTAVEKEKIESLAGGGESDSA 490

Query: 1252 FLVYVK 1257
             ++  K
Sbjct: 491  LILMYK 496

>KNAG0F01220 Chr6 (219798..222152) [2355 bp, 784 aa] {ON} Anc_2.69
            YNL186W
          Length = 784

 Score = 42.4 bits (98), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 36/66 (54%), Gaps = 8/66 (12%)

Query: 1193 YSLFSVFIHRGEA-SYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNFNEGNTATPY 1251
            Y L SV +H G + S GHY  + K    +G W  Y+DE ++++ E +V    E N    Y
Sbjct: 645  YQLISVVVHEGRSLSSGHYIAHCK--QPDGSWSTYDDEYINKITERDV--LRESNA---Y 697

Query: 1252 FLVYVK 1257
            +LVY +
Sbjct: 698  YLVYTR 703

>SAKL0H00418g Chr8 (50575..54147) [3573 bp, 1190 aa] {ON} similar to
            uniprot|P50101 Saccharomyces cerevisiae YMR304W UBP15
            Ubiquitin-specific protease that may play a role in
            ubiquitin precursor processing
          Length = 1190

 Score = 42.0 bits (97), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 42/97 (43%), Gaps = 24/97 (24%)

Query: 1191 YGYSLFSVFIHRGEASYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNFNEGNTATP 1250
            Y Y L  V +H G+ S GHY+  IK    +  W +++D+ V  V +++VF  N G+   P
Sbjct: 441  YIYDLHGVLVHTGDISTGHYYTMIKPSIEDQ-WYRFDDDKVWRVTKNQVFEENFGHVRLP 499

Query: 1251 -----------------------YFLVYVKQGQEADI 1264
                                   Y LVYV++  E  I
Sbjct: 500  DEKLRTFTREQYQNYLISRQTSAYMLVYVRKDMEDKI 536

 Score = 35.0 bits (79), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 17/29 (58%)

Query: 735 TGINNIGNTCYLNSLLQYYFSIAPLRRYI 763
            G  N G TCYLNSLLQ YF     R+ +
Sbjct: 206 VGFKNQGATCYLNSLLQSYFFTKYFRKLV 234

>YER098W Chr5 (355466..357730) [2265 bp, 754 aa] {ON}  UBP9Ubiquitin
            carboxyl-terminal hydrolase, ubiquitin-specific protease
            that cleaves ubiquitin-protein fusions
          Length = 754

 Score = 42.0 bits (97), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 32/66 (48%), Gaps = 5/66 (7%)

Query: 1193 YSLFSVFIHRGEA-SYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNF--NEGNTAT 1249
            Y L  V IH G    +GHY      RN    W  Y+DETV  ++E+ V  F  + G+  T
Sbjct: 601  YELSGVVIHMGSGPQHGHYVCIC--RNEKFGWLLYDDETVESIKEETVLQFTGHPGDQTT 658

Query: 1250 PYFLVY 1255
             Y L Y
Sbjct: 659  AYVLFY 664

 Score = 37.4 bits (85), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 22/39 (56%)

Query: 736 GINNIGNTCYLNSLLQYYFSIAPLRRYILDYQKTVENFN 774
           G  N GNTCY NS+LQ  ++I   R  +L Y + V   N
Sbjct: 135 GYENFGNTCYCNSVLQCLYNIPEFRCNVLRYPERVAAVN 173

>KLTH0B09944g Chr2 complement(826050..829619) [3570 bp, 1189 aa] {ON}
            similar to uniprot|P50101 Saccharomyces cerevisiae
            YMR304W UBP15 Ubiquitin-specific protease that may play a
            role in ubiquitin precursor processing
          Length = 1189

 Score = 42.0 bits (97), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 43/95 (45%), Gaps = 24/95 (25%)

Query: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNFNEGNTATP-- 1250
            Y+L  V +H GE S GHY+  IK  +    W +++D+ V  V +++ F+ N G+   P  
Sbjct: 439  YNLHGVLVHSGEISVGHYYAMIKP-DVGDQWFRFDDDKVWRVTKEQAFDENFGHEPLPDD 497

Query: 1251 ---------------------YFLVYVKQGQEADI 1264
                                 Y LVY+++  E ++
Sbjct: 498  KLRSLTREQYQNYLIARQTSAYMLVYIREDMEKNV 532

 Score = 38.1 bits (87), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 31/121 (25%), Positives = 59/121 (48%), Gaps = 10/121 (8%)

Query: 971  VKQLFYGTTKQSIVPLSATNKVRTKVERFLSLLINIGDHPKDIYDAFDSYFKDEYL---- 1026
            + +LF G  K  I  ++   +  ++VE F  + +N+ +  K + ++FD+Y + E +    
Sbjct: 308  LNELFVGKMKSYIRCINVDYE-SSRVEDFWDIQLNVKN-LKGVQESFDNYVEVEIMDGEN 365

Query: 1027 --TMEEYG--DVTRTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKEVIYMDRYA 1082
                ++YG  D  + V   +FP++L +Q++R  YD       K  +   F E I +  Y 
Sbjct: 366  QYAAQDYGLQDAKKGVVFESFPSVLHLQLKRFEYDFNYDQLVKINDRYEFPETIDLSPYL 425

Query: 1083 D 1083
            D
Sbjct: 426  D 426

 Score = 36.2 bits (82), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 40/91 (43%), Gaps = 16/91 (17%)

Query: 701 ALTKISIERNSNLISNFLLTGTI------DPNSLPPENWPT----------GINNIGNTC 744
           +L + +  +NS  +SN  L  ++      DP  +   N+            G+ N G TC
Sbjct: 152 SLKRRTSSKNSGFLSNGRLNVSVFVRILKDPTGVLWHNFMNYDSKKLTGFIGLKNQGATC 211

Query: 745 YLNSLLQYYFSIAPLRRYILDYQKTVENFND 775
           YLNSLLQ YF     R+ +       E+ ND
Sbjct: 212 YLNSLLQSYFFTKLFRKIVYKIPSENESPND 242

>Kpol_1045.41 s1045 complement(95233..97371) [2139 bp, 712 aa] {ON}
            complement(95235..97373) [2139 nt, 713 aa]
          Length = 712

 Score = 41.6 bits (96), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 51/103 (49%), Gaps = 13/103 (12%)

Query: 1180 KISHQFDDFKEYGYSLFSVFIHRG-EASYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDE 1238
            K+S  FD+     Y L  + +H G    +GHY    K  ++   W  ++DETV  + ED 
Sbjct: 561  KVSSTFDESVSKDYELGGLVVHIGIGPQHGHYISVCKTSDYG--WLLFDDETVECISEDT 618

Query: 1239 VFNF-NEGNTA-TPYFLVY--------VKQGQEADIEPLKRIL 1271
            V +F  + N+A T Y L Y        V++ Q   +E ++++L
Sbjct: 619  VLSFVGDSNSAGTAYVLFYKEINSSRNVERSQNEHLENVEKLL 661

 Score = 35.8 bits (81), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 22/36 (61%)

Query: 736 GINNIGNTCYLNSLLQYYFSIAPLRRYILDYQKTVE 771
           G+ N GNTCY NS+LQ  +++   R  IL    +++
Sbjct: 132 GLENFGNTCYCNSILQCLYNMNEFRENILGLTPSID 167

>KNAG0C02180 Chr3 (429789..433484) [3696 bp, 1231 aa] {ON} Anc_1.137
           YJL197W
          Length = 1231

 Score = 41.6 bits (96), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 32/52 (61%), Gaps = 3/52 (5%)

Query: 736 GINNIGNTCYLNSLLQYYFSIAPLRRYIL--DYQKTVENFNDHLSNSGHVRR 785
           G++N+GNTCY+NS LQ    I  +R Y +   ++K + N N+ L   GH+ R
Sbjct: 322 GLSNLGNTCYMNSGLQCLVHIPQIRDYFVYNGFEKEI-NVNNPLGFQGHMAR 372

>TDEL0B03670 Chr2 complement(656511..657902) [1392 bp, 463 aa] {ON}
            Anc_8.742 YMR223W
          Length = 463

 Score = 41.2 bits (95), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 51/112 (45%), Gaps = 9/112 (8%)

Query: 950  FQIESGSEPIKYDEDNEQYDLVKQLFYGTTKQSIVPLSATNKVRTKVERFLSLLINIGDH 1009
            FQ+ SG        D+    +    F G  K SIV     N  +T ++ F+ L ++I D 
Sbjct: 251  FQVCSGKGVNDAISDDLCTCIAHSTFQGLLKSSIVCPDCQNDSKTTIDPFMDLSLDIKD- 309

Query: 1010 PKDIYDAFDSYFKDEYLTMEEYG--------DVTRTVAVTTFPTILQVQIQR 1053
              ++Y+  DS+ K E L    Y         D  + +++   P++L +Q++R
Sbjct: 310  KSNLYNCLDSFHKKERLHDFNYHCPNCNTSQDAIKRLSIYKLPSVLVLQLKR 361

 Score = 35.0 bits (79), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 23/49 (46%), Gaps = 2/49 (4%)

Query: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFN 1241
            Y L  V  H+G  + GHY    K       W K+ND  VS V ++E  N
Sbjct: 403  YELIGVVAHKGTVNEGHYVATTKVAGRQ--WFKFNDSMVSSVTQEEALN 449

>Suva_14.156 Chr14 (285613..287979) [2367 bp, 788 aa] {ON} YNL186W
            (REAL)
          Length = 788

 Score = 41.6 bits (96), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 36/66 (54%), Gaps = 8/66 (12%)

Query: 1193 YSLFSVFIHRGEA-SYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNFNEGNTATPY 1251
            Y L SV +H G + S GHY  + K  +  G W  Y+DE ++++ E +V    E N    Y
Sbjct: 669  YQLLSVVVHEGRSLSSGHYIAHCKQPD--GTWATYDDEYINKISERDV--LKEPNA---Y 721

Query: 1252 FLVYVK 1257
            +L+Y +
Sbjct: 722  YLLYTR 727

>NCAS0E02610 Chr5 complement(520877..523030) [2154 bp, 717 aa] {ON}
            Anc_7.390
          Length = 717

 Score = 41.6 bits (96), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 38/77 (49%), Gaps = 6/77 (7%)

Query: 1193 YSLFSVFIHRGEA-SYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNF--NEGNTAT 1249
            Y L  + IH G+    GHY    K   +   W  Y+DETV  V E+ V  F  +E   +T
Sbjct: 565  YELSGIVIHVGDGPQMGHYVALCKTEKYG--WLFYDDETVESVSEETVLKFIGDEKTQST 622

Query: 1250 PYFLVYVKQG-QEADIE 1265
             Y L Y K G +E +I+
Sbjct: 623  AYVLFYKKLGDKETNID 639

 Score = 35.8 bits (81), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 19/31 (61%)

Query: 736 GINNIGNTCYLNSLLQYYFSIAPLRRYILDY 766
           G  N GNTCY NS+LQ  +++   R  IL Y
Sbjct: 127 GYENFGNTCYCNSVLQCLYNLPEFRLNILQY 157

>KLLA0C03476g Chr3 (314815..318573) [3759 bp, 1252 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
           Ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1252

 Score = 41.6 bits (96), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 34/63 (53%), Gaps = 6/63 (9%)

Query: 732 NWPTGI---NNIGNTCYLNSLLQYYFSIAPLRRYIL--DYQKTVENFNDHLSNSGHVRRI 786
           N P+GI   +N+GNTCY+NS LQ    I  L  Y L   Y++ + N N+ L + G V   
Sbjct: 333 NAPSGIMGLSNLGNTCYMNSALQCLLHIPELNEYFLYKGYEREI-NINNPLGHKGDVAHA 391

Query: 787 GGR 789
            G 
Sbjct: 392 FGH 394

>TBLA0C07020 Chr3 (1694706..1698449) [3744 bp, 1247 aa] {ON} Anc_5.18
            YMR304W
          Length = 1247

 Score = 41.6 bits (96), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 32/58 (55%), Gaps = 1/58 (1%)

Query: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNFNEGNTATP 1250
            Y+L  V +H G+ S GHY+  IK    +  W +++DE V  V + +VF+ N G    P
Sbjct: 496  YNLHGVLVHTGDISTGHYYAMIKPTTDDK-WYRFDDEKVWRVTKKQVFDENFGLNRLP 552

 Score = 36.6 bits (83), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 22/44 (50%)

Query: 735 TGINNIGNTCYLNSLLQYYFSIAPLRRYILDYQKTVENFNDHLS 778
            G  N G TCYLNSLLQ YF     R  +       EN ND ++
Sbjct: 259 VGFRNQGATCYLNSLLQSYFFTKYFRDLVYQIPTADENPNDSVA 302

 Score = 34.7 bits (78), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 48/100 (48%), Gaps = 9/100 (9%)

Query: 994  TKVERFLSLLINIGDHPKDIYDAFDSYFKDEYLTME------EYG--DVTRTVAVTTFPT 1045
            ++VE F  + +N+    + + +AF++Y + E +  E      +YG  D  + V   +FP 
Sbjct: 387  SRVEDFWDIQLNVKG-LEGLANAFENYIEVELMDGENQYAAQDYGLQDAKKGVVFESFPE 445

Query: 1046 ILQVQIQRVYYDRERFMPFKSIEPLPFKEVIYMDRYADTE 1085
            +L +Q++R  YD       K  +   F E I +  Y D E
Sbjct: 446  VLHLQLKRFEYDFNYDQLVKVNDRFEFPETIDLSPYMDKE 485

>NCAS0G01800 Chr7 (319652..322279) [2628 bp, 875 aa] {ON} Anc_2.69
          Length = 875

 Score = 41.2 bits (95), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 34/66 (51%), Gaps = 8/66 (12%)

Query: 1193 YSLFSVFIHRGEA-SYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNFNEGNTATPY 1251
            Y L SV +H G + S GHY  +   R  +G W  Y+DE ++++ E  V        A  Y
Sbjct: 691  YELLSVVVHEGRSLSSGHYIAHC--RQPDGSWATYDDEYINKISELNVL-----KEANAY 743

Query: 1252 FLVYVK 1257
            +L+Y +
Sbjct: 744  YLLYTR 749

>ABL145W Chr2 (124839..127088) [2250 bp, 749 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YNL186W (UBP10)
          Length = 749

 Score = 40.8 bits (94), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 33/66 (50%), Gaps = 8/66 (12%)

Query: 1193 YSLFSVFIHRGEA-SYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNFNEGNTATPY 1251
            Y L SV +H G + S GHY  + K    +G W  Y+DE ++++ E  V           Y
Sbjct: 638  YQLISVVVHEGRSLSSGHYIAHCK--QPDGTWATYDDEYINKITERNVL-----KEVNAY 690

Query: 1252 FLVYVK 1257
            +LVY +
Sbjct: 691  YLVYTR 696

>TPHA0A02540 Chr1 (543606..547466) [3861 bp, 1286 aa] {ON} Anc_1.137
           YJL197W
          Length = 1286

 Score = 40.8 bits (94), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 20/28 (71%)

Query: 735 TGINNIGNTCYLNSLLQYYFSIAPLRRY 762
            G+NN+GNTCY+NS LQ    I P+R Y
Sbjct: 398 VGLNNLGNTCYMNSALQCLAHIPPIRDY 425

>NDAI0B00480 Chr2 complement(89965..93726) [3762 bp, 1253 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1253

 Score = 40.8 bits (94), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 42/80 (52%), Gaps = 8/80 (10%)

Query: 708 ERNSNLISNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYIL--D 765
           +++S+  SNFL+      N+L       G+ N+GNTCY+NS LQ    I   R Y L   
Sbjct: 308 QKSSHWPSNFLIY-----NNLQSSPGTIGLTNLGNTCYMNSALQCITHIPIFRDYFLYGT 362

Query: 766 YQKTVENFNDHLSNSGHVRR 785
           +QK V N  + L   G++ R
Sbjct: 363 FQKEV-NEGNPLGYQGYMAR 381

>Smik_14.144 Chr14 (268784..271075) [2292 bp, 763 aa] {ON} YNL186W
            (REAL)
          Length = 763

 Score = 40.8 bits (94), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 36/66 (54%), Gaps = 8/66 (12%)

Query: 1193 YSLFSVFIHRGEA-SYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNFNEGNTATPY 1251
            Y L SV +H G + S GHY  + K  +  G W  Y+DE ++++ E +V    E N    Y
Sbjct: 644  YQLLSVVVHEGRSLSSGHYIAHCKQPD--GSWATYDDEYINKISERDV--LKETNA---Y 696

Query: 1252 FLVYVK 1257
            +L+Y +
Sbjct: 697  YLLYTR 702

>NDAI0F03410 Chr6 complement(820002..822614) [2613 bp, 870 aa] {ON}
            Anc_2.69 YNL186W
          Length = 870

 Score = 40.8 bits (94), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 36/66 (54%), Gaps = 8/66 (12%)

Query: 1193 YSLFSVFIHRGEA-SYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNFNEGNTATPY 1251
            Y L SV +H G + S GHY  +   R  +G W  Y+DE ++++ E ++    E N    Y
Sbjct: 761  YQLLSVVVHEGRSLSSGHYIAHC--RQPDGTWATYDDELINKISELKL--LTEPNA---Y 813

Query: 1252 FLVYVK 1257
            +LVY +
Sbjct: 814  YLVYTR 819

>TPHA0L02290 Chr12 (479360..482941) [3582 bp, 1193 aa] {ON} Anc_5.18
            YMR304W
          Length = 1193

 Score = 40.8 bits (94), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 40/95 (42%), Gaps = 24/95 (25%)

Query: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNFNEGNTATP-- 1250
            Y L  V +H G+ S GHY+  IK  +    W +++DE V +V   +VF+ N G    P  
Sbjct: 448  YKLHGVLVHTGDISTGHYYTMIKP-DLGDQWYRFDDERVWKVDRKQVFDENFGLDKLPDS 506

Query: 1251 ---------------------YFLVYVKQGQEADI 1264
                                 Y LVYVK   E +I
Sbjct: 507  ELRGMTKEEYQSYLITRHTSAYMLVYVKDEVEEEI 541

 Score = 39.3 bits (90), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 67/142 (47%), Gaps = 13/142 (9%)

Query: 971  VKQLFYGTTKQSIVPLSATNKVRTKVERFLSLLINIGDHPKDIYDAFDSYFKDEYLTME- 1029
            + +LF G  K S +     +   ++VE F  + +N+ D  K++  +F++Y + E +  E 
Sbjct: 315  LSELFVGKMK-SYIKCKNVDYESSRVEEFWDIQLNVKD-LKNLQQSFENYIEVELMDGEN 372

Query: 1030 -----EYG--DVTRTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKEVIYMDRYA 1082
                 ++G  D  + V   +FP +L +Q++R  YD       K  +   F + I +  Y 
Sbjct: 373  QYAAPDFGLQDAYKGVVFESFPKVLHLQLKRFEYDFNFDQLIKINDRYEFPDSIDLSPYL 432

Query: 1083 DTENPLLLAKKNETEEMKQKLR 1104
            D +   +L  +NETE    KL 
Sbjct: 433  DKD---VLKNENETESHIYKLH 451

 Score = 35.4 bits (80), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 21/41 (51%)

Query: 735 TGINNIGNTCYLNSLLQYYFSIAPLRRYILDYQKTVENFND 775
            G  N G TCYLNSLLQ YF     R+ + +     E  ND
Sbjct: 209 VGFRNQGATCYLNSLLQSYFFTKYFRKLVYEIPTDEEKPND 249

>Kpol_513.25 s513 (71125..74697) [3573 bp, 1190 aa] {ON}
            (71125..74697) [3573 nt, 1191 aa]
          Length = 1190

 Score = 40.8 bits (94), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 40/92 (43%), Gaps = 24/92 (26%)

Query: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNFNEGNTATP-- 1250
            Y L  V +H G+ S GHY+  IK    +  W +++DE V +V + +VF+ N G    P  
Sbjct: 441  YKLHGVLVHTGDISTGHYYAMIKPTLEDQ-WYRFDDEKVWKVDKKQVFDENFGLDRLPDS 499

Query: 1251 ---------------------YFLVYVKQGQE 1261
                                 Y LVY+ +G E
Sbjct: 500  KLRSMTREEYQSYLITRHTNAYMLVYICEGME 531

 Score = 37.4 bits (85), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 21/41 (51%)

Query: 735 TGINNIGNTCYLNSLLQYYFSIAPLRRYILDYQKTVENFND 775
            G  N G TCYLNSLLQ YF     R+ +       EN ND
Sbjct: 204 VGFRNQGATCYLNSLLQSYFFTKYFRKLVYGIPTNGENPND 244

 Score = 34.3 bits (77), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 23/95 (24%), Positives = 49/95 (51%), Gaps = 10/95 (10%)

Query: 971  VKQLFYGTTKQSIVPLSATNKVRTKVERFLSLLINIGDHPKDIYDAFDSYFKDEYLTME- 1029
            + ++F G  K S +     +   ++VE F  + +N+ +  K + ++F++Y + E +  E 
Sbjct: 310  LNEIFVGKMK-SYIRCKNVDYESSRVEDFWDIQLNVKNF-KSLQESFENYIEVELMNGEN 367

Query: 1030 -----EYG--DVTRTVAVTTFPTILQVQIQRVYYD 1057
                 ++G  D  + V   +FP +L +Q++R  YD
Sbjct: 368  QYAAPDFGLQDAYKGVVFESFPAVLHLQLKRFEYD 402

>TDEL0B02080 Chr2 (369534..372611) [3078 bp, 1025 aa] {ON} Anc_5.712
           YIL156W
          Length = 1025

 Score = 40.8 bits (94), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 43/87 (49%), Gaps = 16/87 (18%)

Query: 693 DQFLTLKAALTKISIERNSNLISNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQY 752
           DQ L+L+   +  +IE++SN   +  +TG               + N+GNTCY+NS+LQ 
Sbjct: 581 DQRLSLQRHYSIPTIEKSSNTYVSLSITG---------------LRNLGNTCYINSMLQC 625

Query: 753 YFSIAPLRRYILDYQKTVENFNDHLSN 779
            F+    R   +   K  E FN + SN
Sbjct: 626 LFATTKFRDLFVS-GKFEEFFNQNYSN 651

>TBLA0B09760 Chr2 complement(2316180..2318876) [2697 bp, 898 aa] {ON}
            Anc_2.69 YNL186W
          Length = 898

 Score = 40.4 bits (93), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 36/66 (54%), Gaps = 8/66 (12%)

Query: 1193 YSLFSVFIHRGEA-SYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNFNEGNTATPY 1251
            Y L SV +H G + S GHY  + K  +  G W  Y+DE ++++ E E+    E N    Y
Sbjct: 755  YQLLSVVVHEGRSLSSGHYIAHCKQPD--GSWATYDDEYINKISEREM--LKEPNA---Y 807

Query: 1252 FLVYVK 1257
            +L+Y +
Sbjct: 808  YLLYTR 813

>CAGL0J11352g Chr10 complement(1103473..1105788) [2316 bp, 771 aa]
            {ON} similar to uniprot|P53874 Saccharomyces cerevisiae
            YNL186w UBP10
          Length = 771

 Score = 40.4 bits (93), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 36/66 (54%), Gaps = 8/66 (12%)

Query: 1193 YSLFSVFIHRGEA-SYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNFNEGNTATPY 1251
            Y L SV +H G + S GHY  + K    +G W  Y+DE ++++ E EV    E N    Y
Sbjct: 662  YELLSVVVHEGRSLSSGHYIAHCK--QPDGSWATYDDEYINKITEREV--LKERNA---Y 714

Query: 1252 FLVYVK 1257
            +++Y +
Sbjct: 715  YVLYTR 720

>KLTH0F03674g Chr6 (321662..325258) [3597 bp, 1198 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
           Ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1198

 Score = 40.4 bits (93), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 24/39 (61%)

Query: 726 NSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYIL 764
           N L P    TG++N+GN+CY+NS LQ    I  L+ Y L
Sbjct: 325 NKLLPPRGTTGLSNLGNSCYMNSALQCLVHIPELKDYFL 363

>NDAI0E00810 Chr5 complement(163826..165307) [1482 bp, 493 aa] {ON}
            Anc_8.742
          Length = 493

 Score = 40.4 bits (93), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 27/48 (56%), Gaps = 2/48 (4%)

Query: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVF 1240
            Y L S+  H+G  + GHY + +K    +G W K+ND  VS + E+E  
Sbjct: 433  YELTSIISHKGTVNEGHYIVVVKVN--DGQWFKFNDSMVSAITEEEAL 478

>TBLA0E01760 Chr5 complement(430209..433847) [3639 bp, 1212 aa] {ON}
           Anc_5.712 YIL156W
          Length = 1212

 Score = 40.4 bits (93), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 26/42 (61%), Gaps = 2/42 (4%)

Query: 735 TGINNIGNTCYLNSLLQYYFSIAPLRRYILDYQKTVENFNDH 776
           TG+ N+GNTCY+NS+LQ  F+    R   L ++   E + DH
Sbjct: 753 TGLRNLGNTCYINSMLQCLFATTEFRNIFLSHK--YEKYMDH 792

>Ecym_4685 Chr4 complement(1332993..1335329) [2337 bp, 778 aa] {ON}
           similar to Ashbya gossypii AGR370W
          Length = 778

 Score = 40.4 bits (93), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 22/31 (70%)

Query: 736 GINNIGNTCYLNSLLQYYFSIAPLRRYILDY 766
           G+ N GNTCY NS+LQ  F+++ LR  IL Y
Sbjct: 134 GLENFGNTCYCNSVLQCLFNLSELRTNILMY 164

 Score = 40.4 bits (93), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 48/167 (28%), Positives = 76/167 (45%), Gaps = 15/167 (8%)

Query: 1094 NETEEMKQKLRVMKNRQRELLSRDNSGLTRKDAFLESIKLLESSVVEKTT-LKTEVKIDV 1152
            NE EE+  +  +    QRE+L+  N        + +S   L+ +  E+T  LK   KI  
Sbjct: 544  NEDEEVNIQDMLSNFNQREMLNGANK------FYCDSCNGLQEA--ERTVGLKQLPKILS 595

Query: 1153 INTLRTNVNNIDNELMSLYNNIN-NLEEKISHQFDDFKEYGYSLFSVFIHRGEA-SYGHY 1210
            ++  R   +      + L+N I   L+ K+  + D      Y L  + IH G    +GHY
Sbjct: 596  LHLKRFKYSEKHQSNIKLFNKIYYPLKLKVCTKSDTIVCKNYELNGIVIHMGGGPQHGHY 655

Query: 1211 WIYIKDRNHNGVWRKYNDETVSEVQEDEVFNF--NEGNTATPYFLVY 1255
             + I   +  G W  Y+DETV  + E+ VF F  +E +  T Y L +
Sbjct: 656  -VAICKHDMFG-WLLYDDETVESIDEETVFKFVGDEKDMTTAYVLFF 700

>Kwal_26.9598 s26 complement(1283781..1287356) [3576 bp, 1191 aa] {ON}
            YMR304W (UBP15) - putative deubiquitinating enzyme
            [contig 363] FULL
          Length = 1191

 Score = 40.4 bits (93), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 42/95 (44%), Gaps = 24/95 (25%)

Query: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNFNEGNTATP-- 1250
            Y+L  V +H G+ S GHY+  IK  N    W +++D+ V +V + + F+ N G+   P  
Sbjct: 439  YNLHCVLVHSGDISAGHYYAMIKP-NVTDQWFRFDDDKVWKVTKTQAFDENFGHDNLPDE 497

Query: 1251 ---------------------YFLVYVKQGQEADI 1264
                                 Y LVY+++  E  +
Sbjct: 498  KLRTFTREQYQNYLIARQTSAYMLVYIREDMEEKV 532

 Score = 39.3 bits (90), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 39/90 (43%), Gaps = 20/90 (22%)

Query: 709 RNSNLISNFLLTGTI----------DPNSLPPENWPT----------GINNIGNTCYLNS 748
           RNS+  S FL+ G++          DP  +   N+            G  N G TCYLNS
Sbjct: 156 RNSSRNSGFLVNGSLNVSVFIRILKDPTGVLWHNFMNYDSKKLTGYIGFKNQGATCYLNS 215

Query: 749 LLQYYFSIAPLRRYILDYQKTVENFNDHLS 778
           LLQ YF     R+ +       E+ ND +S
Sbjct: 216 LLQSYFFTKLFRKMVYKIPSDNESPNDSVS 245

 Score = 35.4 bits (80), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 48/92 (52%), Gaps = 10/92 (10%)

Query: 974  LFYGTTKQSIVPLSATNKVRTKVERFLSLLINIGDHPKDIYDAFDSYFKDEYL------T 1027
            LF G  K  I  ++   +   +VE F  + +N+ +  KD+ ++F++Y + E +       
Sbjct: 311  LFVGKMKSYIRCVNVDYE-SFRVEDFWDIQLNVKN-LKDVKESFENYVEVEMMDGENQYA 368

Query: 1028 MEEYG--DVTRTVAVTTFPTILQVQIQRVYYD 1057
             ++YG  D  + V   +FP +L +Q++R  YD
Sbjct: 369  AQDYGLQDAKKGVVFESFPPVLHLQLKRFEYD 400

>Kwal_33.14430 s33 (669559..671094) [1536 bp, 511 aa] {ON} YNL186W
            (UBP10) - predicted to encode a ubiquitin-processing
            protease [contig 103] PARTIAL
          Length = 511

 Score = 40.0 bits (92), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 34/66 (51%), Gaps = 8/66 (12%)

Query: 1193 YSLFSVFIHRGEA-SYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNFNEGNTATPY 1251
            Y L SV +H G + S GHY  + K  +  G W  Y+DE ++++ E ++           Y
Sbjct: 395  YQLISVVVHEGRSLSSGHYIAHCKQPD--GSWSTYDDEYINKISEKQML-----KEPGAY 447

Query: 1252 FLVYVK 1257
            +LVY +
Sbjct: 448  YLVYTR 453

>KLLA0E08801g Chr5 (784991..787306) [2316 bp, 771 aa] {ON} similar to
            uniprot|P25037 Saccharomyces cerevisiae YDL122W UBP1
            Ubiquitin-specific protease that removes ubiquitin from
            ubiquitinated proteins cleaves at the C terminus of
            ubiquitin fusions irrespective of their size capable of
            cleaving polyubiquitin chains
          Length = 771

 Score = 40.0 bits (92), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 27/49 (55%), Gaps = 3/49 (6%)

Query: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFN 1241
            Y L SV +H G  +YGHY  +   R   G W + +DE+V  V E EV +
Sbjct: 681  YVLRSVIVHYGTHNYGHYIAF---RRFRGCWWRISDESVYIVDEQEVLS 726

>ZYRO0A05962g Chr1 complement(474545..475942) [1398 bp, 465 aa] {ON}
            similar to uniprot|P50102 Saccharomyces cerevisiae
            YMR223W UBP8 Ubiquitin-specific protease that is a
            component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
            acetylation complex required for SAGA-mediated
            deubiquitination of histone H2B
          Length = 465

 Score = 39.7 bits (91), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 32/71 (45%), Gaps = 8/71 (11%)

Query: 1186 DDFKEYGYSLFSVFIHRGEASYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNFNEG 1245
            DD  +  + L  +  HRG  + GHY  + K     G W K+ND  VS + E+E+      
Sbjct: 398  DDVPDIIFELIGIIAHRGTVNEGHYIAFTKVT--TGHWFKFNDSMVSSITEEELLQ---- 451

Query: 1246 NTATPYFLVYV 1256
                 Y L YV
Sbjct: 452  --EQAYLLFYV 460

>AGR370W Chr7 (1416579..1418801) [2223 bp, 740 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YER098W (UBP9) and
            YBL067C (UBP13)
          Length = 740

 Score = 40.0 bits (92), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 46/102 (45%), Gaps = 5/102 (4%)

Query: 1168 MSLYNNIN-NLEEKISHQFDDFKEYGYSLFSVFIHRGEA-SYGHYWIYIKDRNHNGVWRK 1225
            + L+N I+  L  ++   FD      Y L  + IH G    +GHY    K       W  
Sbjct: 566  IKLFNVIHYPLNLRVCSTFDHAVCKDYELNGIVIHMGGGPQHGHYVAICKHELFG--WLL 623

Query: 1226 YNDETVSEVQEDEVFNF-NEGNTATPYFLVYVKQGQEADIEP 1266
            Y+DETV  V ED V  F  + N  T  ++++ K  +E D  P
Sbjct: 624  YDDETVESVGEDAVLRFIGDVNDMTTAYVLFYKSKREDDDTP 665

 Score = 37.7 bits (86), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 22/36 (61%)

Query: 736 GINNIGNTCYLNSLLQYYFSIAPLRRYILDYQKTVE 771
           G+ N GNTCY NS+LQ  +++  LR  +L Y    E
Sbjct: 100 GLENYGNTCYCNSVLQCLYNLKELRVNVLKYPTRAE 135

>Kpol_1044.24 s1044 (56564..58738) [2175 bp, 724 aa] {ON}
            (56564..58738) [2175 nt, 725 aa]
          Length = 724

 Score = 40.0 bits (92), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 35/66 (53%), Gaps = 8/66 (12%)

Query: 1193 YSLFSVFIHRGEA-SYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNFNEGNTATPY 1251
            Y L SV +H G + S GHY  +   R  +G W  Y+DE ++++ E  V    E N    Y
Sbjct: 607  YQLISVVVHEGRSLSSGHYIAHC--RQPDGSWAIYDDEYINKISERNV--LKEPNA---Y 659

Query: 1252 FLVYVK 1257
            +L+Y +
Sbjct: 660  YLIYTR 665

>Skud_14.148 Chr14 (278827..281157) [2331 bp, 776 aa] {ON} YNL186W
            (REAL)
          Length = 776

 Score = 40.0 bits (92), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 36/66 (54%), Gaps = 8/66 (12%)

Query: 1193 YSLFSVFIHRGEA-SYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNFNEGNTATPY 1251
            Y L SV +H G + S GHY  + K  +  G W  Y+DE ++++ E +V    E N    Y
Sbjct: 657  YQLLSVVVHEGRSLSSGHYIAHCKQPD--GNWATYDDEYINKISERDV--LKEPNA---Y 709

Query: 1252 FLVYVK 1257
            +L+Y +
Sbjct: 710  YLLYTR 715

>TDEL0A01100 Chr1 (186399..188384) [1986 bp, 661 aa] {ON} Anc_2.69
            YNL186W
          Length = 661

 Score = 39.7 bits (91), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 37/66 (56%), Gaps = 8/66 (12%)

Query: 1193 YSLFSVFIHRGEA-SYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNFNEGNTATPY 1251
            Y L +V +H G + S GHY ++ K    +G W  Y+DE ++++ E +V    E N    Y
Sbjct: 549  YQLTTVVVHEGRSLSSGHYIVHCK--QPDGTWATYDDEYINKITERDV--LKEPNA---Y 601

Query: 1252 FLVYVK 1257
            +L+Y +
Sbjct: 602  YLLYTR 607

>Ecym_5671 Chr5 complement(1362706..1366236) [3531 bp, 1176 aa] {ON}
            similar to Ashbya gossypii AGL357W
          Length = 1176

 Score = 39.7 bits (91), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 41/95 (43%), Gaps = 24/95 (25%)

Query: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNFNEGNTATP-- 1250
            Y+L  V +H G+ S GHY+  IK    +  W +++D+ V +V + +VF  N G    P  
Sbjct: 436  YNLHGVLVHTGDISTGHYYAMIKP-GLDDKWYRFDDDKVWQVTKKQVFEQNFGFDRLPEY 494

Query: 1251 ---------------------YFLVYVKQGQEADI 1264
                                 Y LVY+K+  E  I
Sbjct: 495  ELRSLSKEQYQNYLIARQTSAYMLVYIKEDMEPTI 529

 Score = 34.3 bits (77), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 18/29 (62%)

Query: 735 TGINNIGNTCYLNSLLQYYFSIAPLRRYI 763
            G+ N G TCYLNSLLQ Y+     R+ +
Sbjct: 199 VGLKNQGATCYLNSLLQSYYFTKYFRKLV 227

>NCAS0G03680 Chr7 complement(682617..684065) [1449 bp, 482 aa] {ON}
            Anc_2.307 YDL122W
          Length = 482

 Score = 39.3 bits (90), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 27/48 (56%), Gaps = 3/48 (6%)

Query: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVF 1240
            Y L +V IH G  +YGHY  Y K  N    W + +DE+V EV E EV 
Sbjct: 422  YDLKAVIIHYGTHNYGHYISYRKFMNQ---WWRISDESVIEVDEMEVL 466

>ZYRO0C09812g Chr3 complement(743861..745969) [2109 bp, 702 aa] {ON}
            some similarities with uniprot|P53874 Saccharomyces
            cerevisiae YNL186W UBP10 Ubiquitin-specific protease that
            deubiquitinates ubiquitin-protein moieties may regulate
            silencing by acting on Sir4p involved in
            posttranscriptionally regulating Gap1p and possibly other
            transporters primarily located in the nucleus
          Length = 702

 Score = 39.7 bits (91), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 35/66 (53%), Gaps = 8/66 (12%)

Query: 1193 YSLFSVFIHRGEA-SYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNFNEGNTATPY 1251
            Y L +V +H G + S GHY ++ K     G W  Y+DE ++ + E +V    E N    Y
Sbjct: 587  YQLITVVVHEGRSLSSGHYIVHCK--QPEGHWATYDDEYINNINEKDV--LREPNA---Y 639

Query: 1252 FLVYVK 1257
            +LVY +
Sbjct: 640  YLVYTR 645

>NDAI0I02530 Chr9 (584472..588065) [3594 bp, 1197 aa] {ON} Anc_5.18
            YMR304W
          Length = 1197

 Score = 39.7 bits (91), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNFNEG 1245
            Y+L  V +H G+ S GHY+  IK  +    W +++DE V +V + +VF  N G
Sbjct: 438  YNLHGVLVHTGDISTGHYYAMIKP-DLEDQWYRFDDEKVWKVTKKQVFEENFG 489

 Score = 35.0 bits (79), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 50/95 (52%), Gaps = 10/95 (10%)

Query: 971  VKQLFYGTTKQSIVPLSATNKVRTKVERFLSLLINIGDHPKDIYDAFDSYFKDEYLTME- 1029
            + +LF G  K  I  ++   +  ++VE F  L +N+ +  K + D+F++Y + E +  E 
Sbjct: 307  LSELFVGKMKSYIKCVNVEYE-SSRVEDFWDLQLNVKNL-KCLKDSFENYIEIELMNGEN 364

Query: 1030 -----EYG--DVTRTVAVTTFPTILQVQIQRVYYD 1057
                 ++G  D  + V   +FP IL +Q++R  YD
Sbjct: 365  QYAAQDFGLQDAEKGVIFESFPPILHLQLKRFEYD 399

 Score = 35.0 bits (79), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 17/29 (58%)

Query: 735 TGINNIGNTCYLNSLLQYYFSIAPLRRYI 763
            G  N G TCYLNSLLQ YF     R+ +
Sbjct: 201 VGFRNQGATCYLNSLLQSYFFTKYFRKLV 229

>SAKL0E13002g Chr5 complement(1070150..1072369) [2220 bp, 739 aa] {ON}
            similar to uniprot|P53874 Saccharomyces cerevisiae
            YNL186W UBP10 Ubiquitin-specific protease that
            deubiquitinates ubiquitin-protein moieties may regulate
            silencing by acting on Sir4p involved in
            posttranscriptionally regulating Gap1p and possibly other
            transporters primarily located in the nucleus
          Length = 739

 Score = 39.3 bits (90), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 34/66 (51%), Gaps = 8/66 (12%)

Query: 1193 YSLFSVFIHRGEA-SYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNFNEGNTATPY 1251
            Y L SV +H G + S GHY  + K  +  G W  Y+DE ++++ E ++           Y
Sbjct: 627  YQLISVVVHEGRSLSSGHYIAHCKQPD--GSWATYDDEYINKITEKQML-----KEPGAY 679

Query: 1252 FLVYVK 1257
            +L+Y +
Sbjct: 680  YLIYTR 685

>NCAS0B00580 Chr2 (86690..88090) [1401 bp, 466 aa] {ON} Anc_8.742
          Length = 466

 Score = 38.9 bits (89), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 59/141 (41%), Gaps = 20/141 (14%)

Query: 962  DEDNEQYDLVKQLFYGTTKQSIVPLSATNKVRTKVERFLSLLINIGDHPKDIYDAFDSYF 1021
            +++N    +   +F G  K SIV     N  +T ++ F+ L ++I D   D+Y   DS+ 
Sbjct: 267  EQENNCPCVAHSIFQGELKSSIVCPECQNDSKTIIDPFMDLSLDIKD-KTDLYQCLDSFH 325

Query: 1022 KDEYLTMEEYG--------DVTRTVAVTTFPTILQVQIQRVYYDRERFMPFKSIE----- 1068
            K E L    Y         D  +   +   P +L +Q++R     E F+   +++     
Sbjct: 326  KKEKLHDFNYHCSRCNTSLDPIKQFTINKLPPMLVLQLKRF----EHFVNGTNVKLNEFV 381

Query: 1069 --PLPFKEVIYMDRYADTENP 1087
              PL      Y DR  + E P
Sbjct: 382  QYPLYLNMRDYCDRNTNQETP 402

 Score = 37.0 bits (84), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 26/48 (54%), Gaps = 2/48 (4%)

Query: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVF 1240
            Y L  +  H G  + GHY + +K  +  G W K+ND  +S ++EDE  
Sbjct: 406  YELTGILSHIGSINEGHYVVVLKIND--GRWFKFNDSMISVIKEDEAL 451

>TBLA0D01070 Chr4 complement(275843..277294) [1452 bp, 483 aa] {ON}
            Anc_8.742 YMR223W
          Length = 483

 Score = 38.9 bits (89), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 36/80 (45%), Gaps = 11/80 (13%)

Query: 1176 NLEEKISHQFDDFKEYGYSLFSVFIHRGEASYGHYWIYIKDRNHNGVWRKYNDETVSEVQ 1235
            NL EK +    D     Y L  +  HRG  + GHY  Y K    +GVW ++ND  V +V 
Sbjct: 409  NLNEKTNKSTPDMI---YELTGIVTHRGTVNEGHYITYTKTA--DGVWYQFNDSVVMKVP 463

Query: 1236 EDEVFNFNEGNTATPYFLVY 1255
             +++           Y L+Y
Sbjct: 464  LEQMLK------EQAYLLIY 477

>KLTH0B07150g Chr2 complement(574195..576465) [2271 bp, 756 aa] {ON}
            some similarities with uniprot|P53874 Saccharomyces
            cerevisiae YNL186W UBP10 Ubiquitin-specific protease that
            deubiquitinates ubiquitin-protein moieties may regulate
            silencing by acting on Sir4p involved in
            posttranscriptionally regulating Gap1p and possibly other
            transporters primarily located in the nucleus
          Length = 756

 Score = 38.9 bits (89), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 34/66 (51%), Gaps = 8/66 (12%)

Query: 1193 YSLFSVFIHRGEA-SYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNFNEGNTATPY 1251
            Y L SV +H G + + GHY  + K    +G W  Y+DE ++++ E ++           Y
Sbjct: 648  YQLISVVVHEGRSLTSGHYIAHCK--QPDGSWSTYDDEYINKISERQML-----KEPGAY 700

Query: 1252 FLVYVK 1257
            +LVY +
Sbjct: 701  YLVYTR 706

>KAFR0C00410 Chr3 complement(85302..87611) [2310 bp, 769 aa] {ON}
           Anc_3.270 YBR058C
          Length = 769

 Score = 38.9 bits (89), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 37/63 (58%), Gaps = 5/63 (7%)

Query: 696 LTLKAALTKISIERNSNLISNFLLTGTIDPNSL---PPENWPTGINNIGNTCYLNSLLQY 752
           L  +  LT++ +E+N N   +F +T +     +   P  N+  G+ N+GN+CYLNS+LQ 
Sbjct: 279 LATEKTLTELQVEQNLNW--DFKMTDSAGHELIKLEPNGNFGCGLINLGNSCYLNSILQA 336

Query: 753 YFS 755
            F+
Sbjct: 337 LFA 339

>Kwal_27.10842 s27 complement(522190..524325) [2136 bp, 711 aa] {ON}
           YER098W (UBP9) - ubiquitin carboxyl-terminal hydrolase
           [contig 33] FULL
          Length = 711

 Score = 38.9 bits (89), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 22/31 (70%)

Query: 736 GINNIGNTCYLNSLLQYYFSIAPLRRYILDY 766
           G  N GNTCY NS+LQ  +++  LR ++L+Y
Sbjct: 144 GYENFGNTCYCNSVLQVLYNLPELRVHLLEY 174

>ZYRO0D07062g Chr4 complement(609322..612903) [3582 bp, 1193 aa] {ON}
            similar to uniprot|P50101 Saccharomyces cerevisiae
            YMR304W UBP15 Ubiquitin-specific protease that may play a
            role in ubiquitin precursor processing
          Length = 1193

 Score = 38.9 bits (89), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 31/58 (53%), Gaps = 1/58 (1%)

Query: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNFNEGNTATP 1250
            Y L  V +H G+ S GHY+  IK    +  W +++DE V +V + + F+ N G    P
Sbjct: 440  YGLHGVLVHTGDISTGHYYALIKPGLEDQ-WYRFDDERVWKVSKKQAFDENFGFDRLP 496

 Score = 37.7 bits (86), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 21/41 (51%)

Query: 735 TGINNIGNTCYLNSLLQYYFSIAPLRRYILDYQKTVENFND 775
            G  N G TCYLNSLLQ YF     RR +     + EN  D
Sbjct: 203 VGFRNQGATCYLNSLLQSYFFTKYFRRLVYQIPTSQENPKD 243

 Score = 33.9 bits (76), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 32/129 (24%), Positives = 58/129 (44%), Gaps = 14/129 (10%)

Query: 971  VKQLFYGTTKQSIVPLSATNKVRTKVERFLSLLINIGDHPKDIYDAFDSYFKDEYL---- 1026
            + ++F G  K S +     +    + E F  + +N+ +  K + D+F++Y + E +    
Sbjct: 309  LNEIFVGKMK-SFIKCINVDYESARTEDFWDIQMNVKNL-KGLKDSFENYIEVELMDGEN 366

Query: 1027 --TMEEYG--DVTRTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKEVI----YM 1078
                ++YG  D  + V   +FP +L +Q++R  YD       K  +   F E I    YM
Sbjct: 367  QYAAQDYGLQDAKKGVVFESFPAVLHLQLKRFEYDFNYDQLVKINDRYEFPERIDLSPYM 426

Query: 1079 DRYADTENP 1087
            D+     NP
Sbjct: 427  DKDVLEANP 435

>YBL067C Chr2 complement(93639..95882) [2244 bp, 747 aa] {ON}
           UBP13Putative ubiquitin carboxyl-terminal hydrolase,
           ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 747

 Score = 38.9 bits (89), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 22/33 (66%)

Query: 736 GINNIGNTCYLNSLLQYYFSIAPLRRYILDYQK 768
           G  N GNTCY NS+LQ  ++++ LR  IL + K
Sbjct: 141 GYENFGNTCYCNSVLQCLYNLSSLRENILQFPK 173

>KAFR0F01560 Chr6 (310936..314451) [3516 bp, 1171 aa] {ON} Anc_1.137
           YJL197W
          Length = 1171

 Score = 38.9 bits (89), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 30/58 (51%), Gaps = 5/58 (8%)

Query: 707 IERNSNLISNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYIL 764
           I++N + +SN+        N         G++N+GNTCY+NS LQ    I  LR Y L
Sbjct: 300 IDKNYHWVSNYF-----KYNDFHHAKGTMGLSNLGNTCYMNSALQCLVHIPQLRDYFL 352

>YMR223W Chr13 (716715..718130) [1416 bp, 471 aa] {ON}
            UBP8Ubiquitin-specific protease that is a component of
            the SAGA (Spt-Ada-Gcn5-Acetyltransferase) acetylation
            complex; required for SAGA-mediated deubiquitination of
            histone H2B
          Length = 471

 Score = 38.5 bits (88), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 25/48 (52%), Gaps = 2/48 (4%)

Query: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVF 1240
            Y L  +  H+G  + GHY  + K     G W K+ND  VS + ++EV 
Sbjct: 411  YELIGIVSHKGTVNEGHYIAFCKISG--GQWFKFNDSMVSSISQEEVL 456

>AGL357W Chr7 (33383..36883) [3501 bp, 1166 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YMR304W (UBP15)
          Length = 1166

 Score = 38.9 bits (89), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 41/95 (43%), Gaps = 24/95 (25%)

Query: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNFNEG------- 1245
            Y+L  V +H G+ S GHY+  IK    +  W +++D+ V  V + +VF  N G       
Sbjct: 427  YNLHGVLVHTGDISTGHYYAMIKPGLEDA-WYRFDDDKVWRVTKKQVFEQNFGFDKLSEY 485

Query: 1246 ----------------NTATPYFLVYVKQGQEADI 1264
                               + Y LVY+++  E+ I
Sbjct: 486  DLRSLTKEQYQNYLIARQTSAYMLVYIREDMESTI 520

 Score = 34.3 bits (77), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 18/29 (62%)

Query: 735 TGINNIGNTCYLNSLLQYYFSIAPLRRYI 763
            G+ N G TCYLNSLLQ Y+     R+ +
Sbjct: 190 VGLKNQGATCYLNSLLQSYYFTKYFRKLV 218

>Skud_13.392 Chr13 (690758..692179) [1422 bp, 473 aa] {ON} YMR223W
            (REAL)
          Length = 473

 Score = 38.5 bits (88), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 25/48 (52%), Gaps = 2/48 (4%)

Query: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVF 1240
            Y L  +  H+G  + GHY  + K     G W K+ND  VS + ++EV 
Sbjct: 413  YELIGIVSHKGTVNEGHYIAFCKISG--GQWFKFNDSMVSSISQEEVL 458

>YNL186W Chr14 (289498..291876) [2379 bp, 792 aa] {ON}
            UBP10Ubiquitin-specific protease that deubiquitinates
            ubiquitin-protein moieties; may regulate silencing by
            acting on Sir4p; involved in posttranscriptionally
            regulating Gap1p and possibly other transporters;
            primarily located in the nucleus
          Length = 792

 Score = 38.5 bits (88), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 35/66 (53%), Gaps = 8/66 (12%)

Query: 1193 YSLFSVFIHRGEA-SYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNFNEGNTATPY 1251
            Y L SV +H G + S GHY  + K  +  G W  Y+DE ++ + E +V    E N    Y
Sbjct: 674  YQLLSVVVHEGRSLSSGHYIAHCKQPD--GSWATYDDEYINIISERDV--LKEPNA---Y 726

Query: 1252 FLVYVK 1257
            +L+Y +
Sbjct: 727  YLLYTR 732

>Smik_13.431 Chr13 (700800..702215) [1416 bp, 471 aa] {ON} YMR223W
            (REAL)
          Length = 471

 Score = 38.1 bits (87), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 24/48 (50%), Gaps = 2/48 (4%)

Query: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVF 1240
            Y L  +  HRG  + GHY  + K     G W K+ND  V+ + + EV 
Sbjct: 411  YELIGIVSHRGTVNEGHYIAFCKIS--GGQWFKFNDSVVTSIAQGEVL 456

>Suva_13.407 Chr13 (697513..698928) [1416 bp, 471 aa] {ON} YMR223W
            (REAL)
          Length = 471

 Score = 38.1 bits (87), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 25/48 (52%), Gaps = 2/48 (4%)

Query: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVF 1240
            Y L  +  H+G  + GHY  + K     G W K+ND  VS + ++EV 
Sbjct: 411  YELIGIVSHKGTVNEGHYIAFCKISG--GQWFKFNDSMVSSISQEEVL 456

>KLLA0A00396g Chr1 (29717..32755) [3039 bp, 1012 aa] {ON} similar to
           uniprot|P40453 Saccharomyces cerevisiae YIL156W UBP7
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 1012

 Score = 38.5 bits (88), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 20/30 (66%)

Query: 735 TGINNIGNTCYLNSLLQYYFSIAPLRRYIL 764
           TG+ N+GNTCY+NS+LQ  F  +  R   L
Sbjct: 588 TGLRNMGNTCYINSMLQCLFGCSQFRDLFL 617

>SAKL0D03322g Chr4 (270137..272434) [2298 bp, 765 aa] {ON} similar
           to uniprot|P38237 YBR058C Saccharomyces cerevisiae UBP14
           Ubiquitin-specific protease that specifically
           disassembles unanchored ubiquitin chains
          Length = 765

 Score = 38.1 bits (87), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 34/57 (59%), Gaps = 1/57 (1%)

Query: 702 LTKISIERNSNLISNFLLTGTIDPNSLPP-ENWPTGINNIGNTCYLNSLLQYYFSIA 757
           L ++ +E+N N     + +   +   LP  + +  G+NN+GN+CY+NS+LQ  F+ A
Sbjct: 279 LVELQVEQNMNWDFQMVDSKGNELKHLPASKEYGCGLNNLGNSCYMNSVLQVLFNGA 335

>SAKL0C04246g Chr3 (412865..416758) [3894 bp, 1297 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
           Ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1297

 Score = 38.1 bits (87), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 24/39 (61%)

Query: 726 NSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYIL 764
           N L P +   G+ N+G+TC++NS+LQ    I  LR Y L
Sbjct: 342 NRLSPSSGTMGLANLGSTCHINSVLQCLTHITELRDYFL 380

>NDAI0E04180 Chr5 complement(941527..944010) [2484 bp, 827 aa] {ON}
            Anc_7.390 YBL067C
          Length = 827

 Score = 38.1 bits (87), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 40/143 (27%), Positives = 59/143 (41%), Gaps = 24/143 (16%)

Query: 950  FQIESGSEPIKYDEDNEQYD-LVKQLFYGTTKQSIVPLSATNKVRTKVERFLSLLINIGD 1008
            F I   S+ I+ D  N Q D  + + F G     I  LS  N V ++ E FL   I + +
Sbjct: 521  FLINQLSDYIQTDCANPQDDNFINESFQGILTNRIKCLSCDN-VTSRDEPFLDFPIEVQE 579

Query: 1009 HPK--DIYDAFDSYFKDEYL------------TMEEYGDVTRTVAVTTFPTILQVQIQRV 1054
            H +  DI     SY + E L            T++E     RTV +   P  L + ++R 
Sbjct: 580  HKEFTDISTILKSYHQKEMLGGHNKFYCSQCCTLQE---AQRTVGLKKLPNTLALHLKRF 636

Query: 1055 YYDRERFMPFKSIEPLPFKEVIY 1077
             Y  E F   K      F +++Y
Sbjct: 637  KYSEEHFTNIKL-----FNKIVY 654

 Score = 37.0 bits (84), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 36/74 (48%), Gaps = 5/74 (6%)

Query: 1193 YSLFSVFIHRGEA-SYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNF--NEGNTAT 1249
            Y L  + +H G +   GHY    K   +   W  ++DET S + E+EV +F  +E +  T
Sbjct: 672  YKLQGIVVHMGSSPQQGHYVAICKTDKYG--WLLFDDETASWINEEEVLSFIGDEKSQNT 729

Query: 1250 PYFLVYVKQGQEAD 1263
             Y L Y +   E D
Sbjct: 730  AYVLFYEEVKDEND 743

>KNAG0E01290 Chr5 complement(254460..258050) [3591 bp, 1196 aa] {ON}
            Anc_5.18 YMR304W
          Length = 1196

 Score = 38.1 bits (87), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 37/70 (52%), Gaps = 7/70 (10%)

Query: 1179 EKISHQFDDFKEYGYSLFSVFIHRGEASYGHYWIYIKDRNHNGV---WRKYNDETVSEVQ 1235
            EK S Q  + +   Y+L  V +H G+ S GHY+  I+     GV   W +++D+ V  V 
Sbjct: 427  EKGSEQLSNKEACIYNLHGVLVHAGDISTGHYYTMIRP----GVSDEWYRFDDDKVWRVT 482

Query: 1236 EDEVFNFNEG 1245
            + + F+ N G
Sbjct: 483  KKQAFDENFG 492

 Score = 36.2 bits (82), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 17/29 (58%)

Query: 735 TGINNIGNTCYLNSLLQYYFSIAPLRRYI 763
            G  N G TCYLNSLLQ YF     RR +
Sbjct: 203 VGFKNQGATCYLNSLLQSYFFTKYFRRLV 231

 Score = 34.7 bits (78), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 49/95 (51%), Gaps = 10/95 (10%)

Query: 971  VKQLFYGTTKQSIVPLSATNKVRTKVERFLSLLINIGDHPKDIYDAFDSYFKDEYLTME- 1029
            + +LF G  K  I  ++   +  ++VE F  L +N+ +  K + ++F +Y + E +  E 
Sbjct: 309  LNELFVGKMKSYIKCINVDYE-SSRVEDFWDLQLNVKNL-KGLEESFSNYIEIELMNGEN 366

Query: 1030 -----EYG--DVTRTVAVTTFPTILQVQIQRVYYD 1057
                 +YG  D  + V   +FP +L +Q++R  YD
Sbjct: 367  QYAAQDYGLQDAEKGVIFESFPPVLHLQLKRFEYD 401

>Suva_2.50 Chr2 complement(90700..92952) [2253 bp, 750 aa] {ON}
           YBL067C (REAL)
          Length = 750

 Score = 38.1 bits (87), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 43/89 (48%), Gaps = 13/89 (14%)

Query: 719 LTGTIDPNSLP---PENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYILDY-QKTVENFN 774
           +  TI   S+P     N   G  N GNTCY NS+LQ  ++++ LR  IL + +K +E   
Sbjct: 122 ILATIASESMPYGDGSNKVFGYENFGNTCYCNSVLQCLYNLSSLRENILQFPEKPIE--- 178

Query: 775 DHLSNSGHVRRIGGRK---ISKGEVERSV 800
              SN      + G K    ++   E+SV
Sbjct: 179 ---SNQSRKHDMKGNKPRIFTEASFEKSV 204

>TDEL0G00410 Chr7 complement(82945..86505) [3561 bp, 1186 aa] {ON}
           Anc_5.18 YMR304W
          Length = 1186

 Score = 38.1 bits (87), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 23/44 (52%)

Query: 735 TGINNIGNTCYLNSLLQYYFSIAPLRRYILDYQKTVENFNDHLS 778
            G  N G TCYLNSLLQ Y+     RR +       EN ND ++
Sbjct: 203 VGFRNQGATCYLNSLLQSYYFTKYFRRLVYQIPTEGENPNDSVT 246

 Score = 37.4 bits (85), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 30/58 (51%), Gaps = 1/58 (1%)

Query: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNFNEGNTATP 1250
            Y L  V +H G+ S GHY+  IK    +  W +++D+ V    + ++F+ N G    P
Sbjct: 440  YKLHGVLVHTGDISTGHYYTLIKPSTKDE-WYRFDDDRVWRATKKQIFDDNFGFDRLP 496

 Score = 33.9 bits (76), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 60/130 (46%), Gaps = 16/130 (12%)

Query: 971  VKQLFYGTTKQSIVPLSAT-NKVRTKVERFLSLLINIGDHPKDIYDAFDSYFKDEYLTME 1029
            + +LF G  K  I  ++     VRT  E F  + +N+ +  +D+  +F++Y + E +  E
Sbjct: 309  INELFVGKMKSYIRCINVDYQSVRT--EDFWDIQLNVKNM-RDLQTSFENYIEVELMDGE 365

Query: 1030 -EYG-------DVTRTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKEVI----Y 1077
             +Y        D  + V   +FP +L +Q++R  YD       K  +   F + I    Y
Sbjct: 366  NQYAAQGHGLQDAKKGVVFESFPPVLHLQLKRFEYDFNYDQLIKVNDRYEFPDSIDLAPY 425

Query: 1078 MDRYADTENP 1087
            MD  A  +NP
Sbjct: 426  MDSEALEQNP 435

>KNAG0B02370 Chr2 complement(463599..465860) [2262 bp, 753 aa] {ON}
           Anc_7.390 YBL067C
          Length = 753

 Score = 38.1 bits (87), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 31/58 (53%), Gaps = 9/58 (15%)

Query: 736 GINNIGNTCYLNSLLQYYFSIAPLRRYILDYQKTVENFNDHLSNSGHVRR--IGGRKI 791
           G  N GNTCY NS+LQ  F++   R  IL +    E   D L    H+R+  + GRK+
Sbjct: 115 GYENFGNTCYCNSILQCLFNLTEFRNSILQFP---ERAPDEL----HLRKTEMPGRKL 165

 Score = 37.7 bits (86), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 42/88 (47%), Gaps = 4/88 (4%)

Query: 1180 KISHQFDDFKEYGYSLFSVFIHRGEA-SYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDE 1238
            +++ +FD      Y L  V +H G    +GHY    K  N    W  ++DETV  + E +
Sbjct: 582  EVASKFDPSVSKKYELTGVVLHMGGGPQHGHYVSVCKTDNFG--WLFFDDETVETLDEPQ 639

Query: 1239 VFNFNEGNTATPY-FLVYVKQGQEADIE 1265
            V NF    T +   ++++ K+  E D E
Sbjct: 640  VLNFTGDTTTSTTAYVLFYKETDEGDDE 667

>CAGL0L01639g Chr12 (178104..181547) [3444 bp, 1147 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197w UBP12
           ubiquitin C-terminal hydrolase
          Length = 1147

 Score = 38.1 bits (87), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 32/58 (55%), Gaps = 3/58 (5%)

Query: 736 GINNIGNTCYLNSLLQYYFSIAPLRRYIL--DYQKTVENFNDHLSNSGHVRRIGGRKI 791
           G++N+GNTCY+NS LQ    I  LR Y     Y++ + N ++ L  +G V    G  I
Sbjct: 290 GLSNLGNTCYMNSGLQCLVHIPKLRDYFFYGGYEQEI-NLDNPLGYNGTVATAFGNLI 346

>Ecym_4009 Chr4 (19798..24351) [4554 bp, 1517 aa] {ON} similar to
            Ashbya gossypii AFR296C
          Length = 1517

 Score = 38.1 bits (87), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 20/30 (66%)

Query: 735  TGINNIGNTCYLNSLLQYYFSIAPLRRYIL 764
            TG+ N+ NTCY+NS+LQ  FS +  R   L
Sbjct: 1105 TGLRNMSNTCYINSMLQCLFSTSAFRNLFL 1134

>KNAG0J00800 Chr10 complement(134836..137133) [2298 bp, 765 aa] {ON}
            Anc_3.270 YBR058C
          Length = 765

 Score = 37.7 bits (86), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 26/44 (59%), Gaps = 3/44 (6%)

Query: 1193 YSLFSVFIHRGEASY-GHYWIYIKDRNHNGVWRKYNDETVSEVQ 1235
            Y L+ +  H+G ++  GHY  YI+ R+  G W  YNDE +  V+
Sbjct: 707  YKLYGIVCHKGNSTQSGHYVAYIRQRD--GQWTLYNDEKIVCVE 748

 Score = 34.7 bits (78), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 32/56 (57%), Gaps = 5/56 (8%)

Query: 702 LTKISIERNSNLISNFLLTGTIDPNSL---PPENWPTGINNIGNTCYLNSLLQYYF 754
           LT++ +E+N N   +F +T       +   P +    G+ N+GN+CYLNS+LQ  F
Sbjct: 286 LTELQVEQNMNW--DFQMTDESGHELVKLNPSKEVGCGLINMGNSCYLNSVLQCLF 339

>CAGL0H06721g Chr8 complement(667816..671061) [3246 bp, 1081 aa]
           {ON} similar to uniprot|P40453 Saccharomyces cerevisiae
           YIL156w UBP7
          Length = 1081

 Score = 38.1 bits (87), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 31/53 (58%), Gaps = 2/53 (3%)

Query: 709 RNSNLISNFLLTGTIDPNSLPPENWP-TGINNIGNTCYLNSLLQYYFSIAPLR 760
           RN  L   F +  TI+ NS P   +  TG+ N+GNTCY+N +LQ  F+   L+
Sbjct: 622 RNQTLTRKFSIP-TIEKNSNPYVAYSVTGLRNLGNTCYINCMLQSLFATNELK 673

>SAKL0E15136g Chr5 complement(1258870..1261983) [3114 bp, 1037 aa]
           {ON} uniprot|Q875P1 Saccharomyces kluyveri UBP7
          Length = 1037

 Score = 38.1 bits (87), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 48/209 (22%), Positives = 85/209 (40%), Gaps = 48/209 (22%)

Query: 735 TGINNIGNTCYLNSLLQYYFSIAPLRRYILDYQKTVENFNDHLSNSGHVRRIGGRKISKG 794
           TG+ N+G+TCY+NS+LQ  F+    R   L        ++D++S  G++ R         
Sbjct: 613 TGLRNLGSTCYINSMLQCLFATRKFRDIFLS-----PKYHDYISK-GYIHR--------A 658

Query: 795 EVERSVQFIYQLRNLFYAMVHSRERCVTPSKELAYLAFAPSNIEVEFEVEGNKPADGAAI 854
           ++ RS         LF  M  +    V PS  L     A +++  +F++  N   D    
Sbjct: 659 QISRSFHM------LFKKMYMNGGCSVVPSGFLK----ACNSMRPDFKIP-NDQQDTQEF 707

Query: 855 PIGLKEEATQESCTTKENDPKSIGSKMEDNTNRDTHRNPSNTEKNEPNNVQIVGG----- 909
            + L ++   E      +DP+ + +        D             +N+Q+ G      
Sbjct: 708 LLFLLDQLHDEL-----SDPEQVANDYPQLLLHDD------------DNLQVDGKEYDKW 750

Query: 910 -DDTTDLNSLTRVAKISSDQLENALEMGR 937
            +D+   N L+ +  I   Q+EN L+  R
Sbjct: 751 FEDSISKNGLSPIDSIFQGQMENCLQCQR 779

>Kwal_55.19645 s55 (62575..65487) [2913 bp, 970 aa] {ON} YIL156W
           (UBP7) - Ubiquitin-specific protease [contig 159] FULL
          Length = 970

 Score = 37.7 bits (86), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 20/30 (66%)

Query: 735 TGINNIGNTCYLNSLLQYYFSIAPLRRYIL 764
           TG+ N+GNTCY+NS+LQ  F+    R   L
Sbjct: 556 TGLRNMGNTCYINSMLQCLFATRKFRDLFL 585

>TPHA0O01640 Chr15 complement(325844..328084) [2241 bp, 746 aa] {ON}
            Anc_2.69 YNL186W
          Length = 746

 Score = 37.7 bits (86), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 31/66 (46%), Gaps = 8/66 (12%)

Query: 1193 YSLFSVFIHRGEA-SYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNFNEGNTATPY 1251
            Y L SV +H G + S GHY  + K    +G W  Y+DE  + + E  V           Y
Sbjct: 616  YQLISVVVHEGRSLSSGHYIAHCK--QPDGTWATYDDEYTNIISERNVL-----KEPNAY 668

Query: 1252 FLVYVK 1257
            +LVY +
Sbjct: 669  YLVYTR 674

 Score = 33.1 bits (74), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 33/71 (46%), Gaps = 16/71 (22%)

Query: 710 NSNLISNFLL-------TGTIDPNSLPPENW--------PTGINNIGNTCYLNSLLQYYF 754
           NS ++SNF          GT + +S   +NW        P G+ N G TCY N+ +Q   
Sbjct: 264 NSEILSNFYQFNEDVDDIGT-NKDSRIIKNWGPILSGLKPCGLLNHGVTCYTNAAVQAML 322

Query: 755 SIAPLRRYILD 765
            I  ++ Y+ D
Sbjct: 323 HIPAIQHYLFD 333

>KLTH0H07370g Chr8 (655985..658330) [2346 bp, 781 aa] {ON} some
            similarities with uniprot|Q01477 Saccharomyces cerevisiae
            YER151C UBP3 Ubiquitin-specific protease that interacts
            with Bre5p to co-regulate anterograde and retrograde
            transport between endoplasmic reticulum and Golgi
            compartments inhibitor of gene silencing cleaves
            ubiquitin fusions but not polyubiquitin
          Length = 781

 Score = 37.7 bits (86), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 37/75 (49%), Gaps = 6/75 (8%)

Query: 1188 FKEYG--YSLFSVFIHRG-EASYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNFN- 1243
            +KE G  Y L  V  H G   S GHY   +     N  W + +D  V E+++DEV     
Sbjct: 707  YKEAGTNYKLIGVVYHHGVSPSGGHYTCDVYQETLNK-WYRIDDTNVQEIEKDEVLKGGE 765

Query: 1244 EGN-TATPYFLVYVK 1257
            EGN + T Y L+Y K
Sbjct: 766  EGNDSRTAYILIYQK 780

>CAGL0G05247g Chr7 complement(491024..493867) [2844 bp, 947 aa] {ON}
           similar to uniprot|P32571 Saccharomyces cerevisiae
           YDR069c DOA4 ubiquitin-specific protease
          Length = 947

 Score = 37.7 bits (86), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 32/60 (53%), Gaps = 3/60 (5%)

Query: 732 NWPTGINNIGNTCYLNSLLQYYFSIAPLRRYILD--YQKTVENFNDHLSNSGHVRRIGGR 789
           N+  G+ N+GN+CY+N +LQ       L +  L+  Y+K + N N  L + G + R   R
Sbjct: 580 NFTVGLENMGNSCYMNCILQCIMGTNELSQIFLNNSYEKHI-NINSKLGSKGVLARYFAR 638

>NCAS0A14370 Chr1 (2830136..2832325) [2190 bp, 729 aa] {ON}
           Anc_7.390
          Length = 729

 Score = 37.4 bits (85), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 21/31 (67%)

Query: 736 GINNIGNTCYLNSLLQYYFSIAPLRRYILDY 766
           G  N GNTCY NS+LQ  +++  LR  +L+Y
Sbjct: 138 GYENFGNTCYCNSVLQCLYNLTELRLNLLEY 168

>Kpol_1018.93 s1018 (248094..250361) [2268 bp, 755 aa] {ON}
            (248094..250361) [2268 nt, 756 aa]
          Length = 755

 Score = 37.4 bits (85), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 38/85 (44%), Gaps = 6/85 (7%)

Query: 1185 FDDFKEYGYSLFSVFIHRGEA-SYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNF- 1242
            FD      Y L  + IH G    +GHY    K       W  Y+DETV  V E +V    
Sbjct: 588  FDRSISKKYELSGIIIHLGAGPQHGHYVAMCKTEKFG--WLLYDDETVEAVLEKDVLRHV 645

Query: 1243 -NEGNTATPYFLVY-VKQGQEADIE 1265
             +  + AT Y L Y   + Q++D+E
Sbjct: 646  GDSNDLATAYILFYKTIETQDSDME 670

 Score = 36.6 bits (83), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 33/59 (55%)

Query: 736 GINNIGNTCYLNSLLQYYFSIAPLRRYILDYQKTVENFNDHLSNSGHVRRIGGRKISKG 794
           G  N GNTCY NS+LQ  ++ + LR  ++ Y +  +   +   NS  ++ + G + ++G
Sbjct: 128 GFENFGNTCYCNSVLQCLYNFSELRDNLILYPEEAKFDPEQFDNSISIKNVIGDEENQG 186

>TPHA0D04660 Chr4 complement(1017401..1020538) [3138 bp, 1045 aa]
           {ON} Anc_5.712 YIL156W
          Length = 1045

 Score = 37.4 bits (85), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 20/26 (76%)

Query: 735 TGINNIGNTCYLNSLLQYYFSIAPLR 760
           TG+ N+GNTCY++S+LQ  F+   LR
Sbjct: 625 TGLRNLGNTCYISSMLQCLFATTTLR 650

>NCAS0G00170 Chr7 (22237..25329) [3093 bp, 1030 aa] {ON} Anc_5.712
          Length = 1030

 Score = 37.4 bits (85), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 20/30 (66%)

Query: 735 TGINNIGNTCYLNSLLQYYFSIAPLRRYIL 764
           TG+ N+GNTCY+NS+LQ  F+    R   L
Sbjct: 608 TGLRNLGNTCYINSMLQCLFATRRFRDLFL 637

>KLLA0C06974g Chr3 complement(604344..605684) [1341 bp, 446 aa] {ON}
            similar to uniprot|P50102 Saccharomyces cerevisiae
            YMR223W UBP8 Ubiquitin-specific protease that is a
            component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
            acetylation complex required for SAGA-mediated
            deubiquitination of histone H2B
          Length = 446

 Score = 36.6 bits (83), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 29/65 (44%), Gaps = 8/65 (12%)

Query: 1192 GYSLFSVFIHRGEASYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNFNEGNTATPY 1251
             Y L +V  H+G    GHY    K  +  G W K+ND  V+ V E++V           Y
Sbjct: 388  AYDLLNVVSHQGTVDQGHYTTVSKTED--GQWFKFNDSVVTSVTEEQVLE------QQAY 439

Query: 1252 FLVYV 1256
             L Y+
Sbjct: 440  LLFYI 444

>CAGL0G02563g Chr7 complement(235498..237393) [1896 bp, 631 aa] {ON}
           weakly similar to uniprot|P36026 Saccharomyces
           cerevisiae YKR098c UBP11 ubiquitin C-terminal hydrolase
          Length = 631

 Score = 37.0 bits (84), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 18/29 (62%)

Query: 736 GINNIGNTCYLNSLLQYYFSIAPLRRYIL 764
           GI N+GNTCY+NS+LQ  F     R   L
Sbjct: 214 GIRNMGNTCYMNSMLQCLFGSTQFRDLFL 242

>Smik_5.318 Chr5 complement(474889..477618) [2730 bp, 909 aa] {ON}
            YER151C (REAL)
          Length = 909

 Score = 37.0 bits (84), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 36/68 (52%), Gaps = 4/68 (5%)

Query: 1193 YSLFSVFIHRGEAS-YGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNFNE--GNTAT 1249
            Y L  V  H G +S  GHY   +  + HN  W + +D  ++E+++D+V    E   ++ T
Sbjct: 841  YKLTGVIYHHGVSSDGGHYTADVYHKEHNK-WYRIDDVNITELEDDDVLKGGEEASDSRT 899

Query: 1250 PYFLVYVK 1257
             Y L+Y K
Sbjct: 900  AYILMYQK 907

>AFR296C Chr6 complement(972519..976028) [3510 bp, 1169 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL156W
           (UBP7) and YKR098C (UBP11)
          Length = 1169

 Score = 37.0 bits (84), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%), Gaps = 3/49 (6%)

Query: 735 TGINNIGNTCYLNSLLQYYFSIAPLRRYILD--YQKTVENFN-DHLSNS 780
           TG+ N+ NTCY+NS+LQ  FS    R   L   Y + +++ N D++S S
Sbjct: 746 TGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYLKSSNMDNMSRS 794

>KNAG0L02200 Chr12 complement(394140..397625) [3486 bp, 1161 aa]
           {ON} Anc_5.712 YIL156W
          Length = 1161

 Score = 37.0 bits (84), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 19/26 (73%)

Query: 735 TGINNIGNTCYLNSLLQYYFSIAPLR 760
           TG+ N+GNTCY+NS++Q  F+    R
Sbjct: 691 TGLRNLGNTCYINSMIQCLFATKSFR 716

>TPHA0E00870 Chr5 complement(174245..176392) [2148 bp, 715 aa] {ON}
           Anc_7.390 YBL067C
          Length = 715

 Score = 36.6 bits (83), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 20/31 (64%)

Query: 736 GINNIGNTCYLNSLLQYYFSIAPLRRYILDY 766
           G  N GNTCY NS+LQ  ++I  LR  ++ Y
Sbjct: 113 GYENFGNTCYCNSVLQCLYNIPELRDNVIKY 143

>CAGL0M11198g Chr13 (1102767..1104152) [1386 bp, 461 aa] {ON} similar
            to uniprot|P50102 Saccharomyces cerevisiae YMR223w UBP8
          Length = 461

 Score = 36.6 bits (83), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 29/64 (45%), Gaps = 8/64 (12%)

Query: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNFNEGNTATPYF 1252
            Y L  +  H G  + GHY  + K  N  G W K+ND  V+++ E +V           Y 
Sbjct: 401  YELIGIISHTGSVNEGHYVAFCKIEN--GEWFKFNDSMVTKILEKDVLK------EQAYL 452

Query: 1253 LVYV 1256
            L Y+
Sbjct: 453  LFYI 456

>KNAG0C03580 Chr3 complement(699604..701934) [2331 bp, 776 aa] {ON}
           Anc_7.390 YBL067C
          Length = 776

 Score = 36.6 bits (83), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 22/41 (53%)

Query: 736 GINNIGNTCYLNSLLQYYFSIAPLRRYILDYQKTVENFNDH 776
           G  N GNTCY NS+LQ  + +   R  +L+Y +  E    H
Sbjct: 162 GYENFGNTCYCNSVLQCLYHLPEFRLRVLEYPEKPEEQERH 202

>YIL156W Chr9 (48091..51306) [3216 bp, 1071 aa] {ON}
           UBP7Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 1071

 Score = 36.6 bits (83), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 19/26 (73%)

Query: 735 TGINNIGNTCYLNSLLQYYFSIAPLR 760
           TG+ N+GNTCY+NS++Q  F+    R
Sbjct: 609 TGLRNLGNTCYINSMIQCLFAAKTFR 634

>NDAI0F00200 Chr6 (35966..39283) [3318 bp, 1105 aa] {ON} Anc_5.712
          Length = 1105

 Score = 36.6 bits (83), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 19/26 (73%)

Query: 735 TGINNIGNTCYLNSLLQYYFSIAPLR 760
           TG+ N+GNTCY+NS+LQ  F+    R
Sbjct: 678 TGLRNLGNTCYINSMLQCLFATRLFR 703

>Skud_2.38 Chr2 complement(77293..79539) [2247 bp, 748 aa] {ON}
           YBL067C (REAL)
          Length = 748

 Score = 36.2 bits (82), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 21/31 (67%)

Query: 736 GINNIGNTCYLNSLLQYYFSIAPLRRYILDY 766
           G  N GNTCY NS+LQ  ++++ +R  IL +
Sbjct: 142 GYENFGNTCYCNSVLQCLYNLSSVRENILQF 172

>KLLA0E20351g Chr5 (1810593..1812686) [2094 bp, 697 aa] {ON} similar
           to uniprot|P39967 Saccharomyces cerevisiae YER098W UBP9
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 697

 Score = 36.2 bits (82), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 19/31 (61%)

Query: 736 GINNIGNTCYLNSLLQYYFSIAPLRRYILDY 766
           G  N GNTCY NS+LQ  +++   R  IL Y
Sbjct: 116 GYENFGNTCYCNSVLQCLYNLTEFRTEILKY 146

>Smik_9.13 Chr9 (25877..29059) [3183 bp, 1060 aa] {ON} YIL156W
           (REAL)
          Length = 1060

 Score = 36.6 bits (83), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 19/26 (73%)

Query: 735 TGINNIGNTCYLNSLLQYYFSIAPLR 760
           TG+ N+GNTCY+NS++Q  F+    R
Sbjct: 598 TGLRNLGNTCYINSMIQCLFAAKTFR 623

>TBLA0D00620 Chr4 complement(159706..163221) [3516 bp, 1171 aa] {ON}
           Anc_7.390 YBL067C
          Length = 1171

 Score = 36.2 bits (82), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 37/75 (49%), Gaps = 16/75 (21%)

Query: 705 ISIERNSNLISNFLLTGTIDPN--SLPPENWPT-----------GINNIGNTCYLNSLLQ 751
           I+ ER++++I       TID N  +L P   P            G  N GNTCY NS+LQ
Sbjct: 476 INTERSASIIPTIT---TIDHNHSALQPRTNPLIPFGDGSNKVFGYENFGNTCYCNSVLQ 532

Query: 752 YYFSIAPLRRYILDY 766
             +++  LR  IL +
Sbjct: 533 CLYNMTNLRTNILQF 547

>Skud_5.289 Chr5 complement(460660..463392) [2733 bp, 910 aa] {ON}
            YER151C (REAL)
          Length = 910

 Score = 36.2 bits (82), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 35/69 (50%), Gaps = 4/69 (5%)

Query: 1193 YSLFSVFIHRGEAS-YGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNFNE--GNTAT 1249
            Y L  V  H G  S  GHY   +    HN  W + +D  ++E+++D+V    E   ++ T
Sbjct: 842  YKLTGVIYHHGVGSDGGHYTADVYHSEHNK-WYRIDDVNITELEDDDVLKGGEEASDSRT 900

Query: 1250 PYFLVYVKQ 1258
             Y L+Y K+
Sbjct: 901  AYILMYQKK 909

>TDEL0C01570 Chr3 complement(269169..271466) [2298 bp, 765 aa] {ON}
            Anc_7.390 YBL067C
          Length = 765

 Score = 36.2 bits (82), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 40/79 (50%), Gaps = 4/79 (5%)

Query: 1193 YSLFSVFIHRGEA-SYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNF-NEGNTATP 1250
            Y L  + +H G    +GHY    K  N N  W  ++DETV  V E  V  F  + ++ T 
Sbjct: 615  YELTGIVVHMGGGPQHGHYVSLCK--NDNFGWLLFDDETVEAVHESTVSKFIGDRDSLTT 672

Query: 1251 YFLVYVKQGQEADIEPLKR 1269
             ++++ K+  +++ + L R
Sbjct: 673  AYVLFYKEIAQSENQDLSR 691

 Score = 34.3 bits (77), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 19/31 (61%)

Query: 736 GINNIGNTCYLNSLLQYYFSIAPLRRYILDY 766
           G  N GNTCY NS+LQ  +++   R  +L +
Sbjct: 125 GYENFGNTCYCNSVLQCLYNLTEFRLLLLQH 155

>Suva_9.30 Chr9 (41061..42434,42912..44726) [3189 bp, 1062 aa] {ON}
           YIL156W (REAL)
          Length = 1062

 Score = 36.2 bits (82), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 19/26 (73%)

Query: 735 TGINNIGNTCYLNSLLQYYFSIAPLR 760
           TG+ N+GNTCY+NS++Q  F+    R
Sbjct: 602 TGLRNLGNTCYINSMIQCLFAAKVFR 627

>KLTH0E00814g Chr5 (80059..82983) [2925 bp, 974 aa] {ON} similar to
           uniprot|P40453 Saccharomyces cerevisiae YIL156W UBP7
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 974

 Score = 36.2 bits (82), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 19/30 (63%)

Query: 735 TGINNIGNTCYLNSLLQYYFSIAPLRRYIL 764
           TG+ NIG TCY+NS+LQ  F+    R   L
Sbjct: 556 TGLRNIGCTCYVNSMLQCLFATKAFRDLFL 585

>ZYRO0F01276g Chr6 (102883..105213) [2331 bp, 776 aa] {ON} similar
           to uniprot|P38237 YBR058C Saccharomyces cerevisiae UBP14
           Ubiquitin-specific protease that specifically
           disassembles unanchored ubiquitin chains
          Length = 776

 Score = 36.2 bits (82), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 36/63 (57%), Gaps = 5/63 (7%)

Query: 696 LTLKAALTKISIERNSNLISNFLLTGTIDPNSL---PPENWPTGINNIGNTCYLNSLLQY 752
           L  +  L ++ +E+N N   +F +T +   + L   P +    G+ N+GN+CYLNS+LQ 
Sbjct: 283 LASEKTLVELQVEQNMNW--DFQMTDSAGKDLLKLKPDQEHGCGLINLGNSCYLNSVLQC 340

Query: 753 YFS 755
            F+
Sbjct: 341 LFN 343

>TPHA0C02770 Chr3 (604690..607602) [2913 bp, 970 aa] {ON} Anc_8.188
           YDR069C
          Length = 970

 Score = 36.2 bits (82), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 34/68 (50%), Gaps = 3/68 (4%)

Query: 736 GINNIGNTCYLNSLLQYYFSIAPLRRYILD--YQKTVENFNDHLSNSGHVRRIGGRKISK 793
           G+ N+GN+CYLN ++Q   S     R  L+  Y+K + N    L + G + R   R I+ 
Sbjct: 609 GLENMGNSCYLNCIIQCLLSSHEFTRIFLNNSYEKHI-NLKSKLGSKGVLARNFARLINT 667

Query: 794 GEVERSVQ 801
              E S Q
Sbjct: 668 MYTEGSEQ 675

>Kpol_1064.48 s1064 (88495..89895) [1401 bp, 466 aa] {ON}
            (88495..89895) [1401 nt, 467 aa]
          Length = 466

 Score = 35.8 bits (81), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 53/124 (42%), Gaps = 16/124 (12%)

Query: 973  QLFYGTTKQSIVPLSATNKVRTKVERFLSLLINIGDHPKDIYDAFDSYFKDEYLTMEEYG 1032
            ++F G  K SIV     +  +T +E F+ L ++I      +Y+  +S+ K E L   +Y 
Sbjct: 275  KVFQGFLKSSIVCPECNSDAKTTIEPFMDLSLDIKG-KNTLYECLNSFHKKEQLHDFDYH 333

Query: 1033 --------DVTRTVAVTTFPTILQVQIQRVYYDRERFMPFKSI---EPLPFKEVIYMDRY 1081
                    D T+ +AV     +L  Q +R     E  +   SI   + + F   + M  Y
Sbjct: 334  CKNCNTSQDPTKQLAVAKLSPVLLFQFKRF----EHLLSGSSIKLNDVIEFPLYLNMKDY 389

Query: 1082 ADTE 1085
             D E
Sbjct: 390  CDVE 393

>YER151C Chr5 complement(469686..472424) [2739 bp, 912 aa] {ON}
            UBP3Ubiquitin-specific protease involved in transport and
            osmotic response; interacts with Bre5p to co-regulate
            anterograde and retrograde transport between the ER and
            Golgi; involved in transcription elongation in response
            to osmostress through phosphorylation at Ser695 by Hog1p;
            inhibitor of gene silencing; cleaves ubiquitin fusions
            but not polyubiquitin; also has mRNA binding activity
          Length = 912

 Score = 35.8 bits (81), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 36/69 (52%), Gaps = 4/69 (5%)

Query: 1193 YSLFSVFIHRGEAS-YGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNFNE--GNTAT 1249
            Y L  V  H G +S  GHY   +    HN  W + +D  ++E+++D+V    E   ++ T
Sbjct: 844  YKLTGVIYHHGVSSDGGHYTADVYHSEHNK-WYRIDDVNITELEDDDVLKGGEEASDSRT 902

Query: 1250 PYFLVYVKQ 1258
             Y L+Y K+
Sbjct: 903  AYILMYQKR 911

>KNAG0D01930 Chr4 (324705..327665) [2961 bp, 986 aa] {ON} Anc_8.188
           YDR069C
          Length = 986

 Score = 35.8 bits (81), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 48/94 (51%), Gaps = 8/94 (8%)

Query: 705 ISIERNSNLISNFLLTGTID--PNSLPPE---NWPTGINNIGNTCYLNSLLQYYFSIAPL 759
           ++    S+L +N +LT T +    S  P+   ++  G+ N+GN+CYLN ++Q       L
Sbjct: 585 VTASSKSHLPNNSILTSTGNHVAESTGPQFDLDFMVGLENMGNSCYLNCIIQCLLGNNEL 644

Query: 760 RRYILD--YQKTVENFNDHLSNSGHVRRIGGRKI 791
            +  LD  ++K V N N  L + G + R   R I
Sbjct: 645 IKIFLDNSFEKYV-NLNSKLGSKGVLARYFSRLI 677

>ZYRO0B03300g Chr2 (273903..276344) [2442 bp, 813 aa] {ON} similar to
            uniprot|P39967 Saccharomyces cerevisiae YER098W UBP9
            Ubiquitin-specific protease that cleaves
            ubiquitin-protein fusions
          Length = 813

 Score = 35.8 bits (81), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 30/66 (45%), Gaps = 5/66 (7%)

Query: 1193 YSLFSVFIHRGEA-SYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNF--NEGNTAT 1249
            Y L  + +H G    +GHY    K  N N  W  ++DETV  V E  V +F  +     T
Sbjct: 658  YELSGIVVHMGGGPQHGHYVSLCK--NDNFGWLLFDDETVESVSEKTVLDFVGDSSTLTT 715

Query: 1250 PYFLVY 1255
             Y L Y
Sbjct: 716  AYVLFY 721

 Score = 33.9 bits (76), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 19/31 (61%)

Query: 736 GINNIGNTCYLNSLLQYYFSIAPLRRYILDY 766
           G  N GNTCY NS+LQ  +++   R  +L +
Sbjct: 132 GFENFGNTCYCNSVLQCLYNMTEFRIQMLQH 162

>KLTH0H07678g Chr8 (677217..679802) [2586 bp, 861 aa] {ON} similar
           to uniprot|P32571 Saccharomyces cerevisiae YDR069C DOA4
           Ubiquitin hydrolase required for recycling ubiquitin
           from proteasome-bound ubiquitinated intermediates acts
           at the late endosome/prevacuolar compartment to recover
           ubiquitin from ubiquitinated membrane proteins en route
           to the vacuole
          Length = 861

 Score = 35.8 bits (81), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 28/52 (53%), Gaps = 3/52 (5%)

Query: 732 NWPTGINNIGNTCYLNSLLQYYFSIAPLRRYILD--YQKTVENFNDHLSNSG 781
           N+  G+ N+GN+CY+N ++Q       L +  LD  Y+  V N N  L + G
Sbjct: 492 NFTVGLTNLGNSCYMNCIIQCLLGTHELTQIFLDDSYKNHV-NLNSKLGSKG 542

>Skud_9.12 Chr9 (25211..28402) [3192 bp, 1064 aa] {ON} YIL156W
           (REAL)
          Length = 1064

 Score = 35.8 bits (81), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 19/26 (73%)

Query: 735 TGINNIGNTCYLNSLLQYYFSIAPLR 760
           TG+ N+GNTCY+NS++Q  F+    R
Sbjct: 601 TGLRNLGNTCYINSMIQCLFAAKIFR 626

>NCAS0B04280 Chr2 (777104..779872) [2769 bp, 922 aa] {ON} Anc_8.188
          Length = 922

 Score = 35.8 bits (81), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 31/59 (52%), Gaps = 3/59 (5%)

Query: 735 TGINNIGNTCYLNSLLQYYFSIAPLRRYILD--YQKTVENFNDHLSNSGHVRRIGGRKI 791
            G+ NIGN+CYLN ++Q       L +  L+  Y++ + N N  L + G + +   R I
Sbjct: 559 VGLQNIGNSCYLNCIIQCLLGTHELTKIFLNNFYERHI-NLNSKLGSKGVLAKYFARLI 616

>SAKL0F12430g Chr6 (969369..971633) [2265 bp, 754 aa] {ON} similar
           to uniprot|P39967 Saccharomyces cerevisiae YER098W UBP9
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 754

 Score = 35.8 bits (81), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 19/31 (61%)

Query: 736 GINNIGNTCYLNSLLQYYFSIAPLRRYILDY 766
           G  N GNTCY NS+LQ  +++   R  +L Y
Sbjct: 147 GYENFGNTCYCNSVLQCLYNLTEFRLNVLQY 177

>Kpol_1032.28 s1032 complement(57514..60162) [2649 bp, 882 aa] {ON}
           complement(57514..60162) [2649 nt, 883 aa]
          Length = 882

 Score = 35.8 bits (81), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 32/58 (55%), Gaps = 3/58 (5%)

Query: 736 GINNIGNTCYLNSLLQYYFSIAPLRRYILD--YQKTVENFNDHLSNSGHVRRIGGRKI 791
           G+ N+GN+CY+N ++Q   S   L +  L+  Y+K + N N  L + G + +   R +
Sbjct: 520 GLENMGNSCYMNCIIQCLLSTHELSQIFLNNSYEKHI-NLNSKLGSKGVLAKYFARLV 576

>TDEL0A01620 Chr1 (291670..294057) [2388 bp, 795 aa] {ON} Anc_8.202
            YER151C
          Length = 795

 Score = 35.4 bits (80), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 38/71 (53%), Gaps = 8/71 (11%)

Query: 1193 YSLFSVFIHRGEAS-YGHYW--IYIKDRNHNGVWRKYNDETVSEVQEDEVFNFNEG--NT 1247
            YSL  V  H G +S  GHY   +Y K+ +    W + +D  ++EVQ+D V    E   ++
Sbjct: 728  YSLSGVIYHHGLSSDGGHYTADVYHKETDK---WYRIDDINITEVQKDSVLKGGEDGVDS 784

Query: 1248 ATPYFLVYVKQ 1258
             T Y L+Y K+
Sbjct: 785  RTAYILMYQKK 795

>KLTH0C06732g Chr3 complement(584097..586241) [2145 bp, 714 aa] {ON}
           some similarities with uniprot|P39967 Saccharomyces
           cerevisiae YER098W UBP9 Ubiquitin-specific protease that
           cleaves ubiquitin-protein fusions
          Length = 714

 Score = 35.4 bits (80), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 21/31 (67%)

Query: 736 GINNIGNTCYLNSLLQYYFSIAPLRRYILDY 766
           G  N GNTCY NS+LQ  +++  LR  +L++
Sbjct: 144 GYENFGNTCYCNSVLQVIYNLPELRVNLLEF 174

>KAFR0C02590 Chr3 complement(503330..506266) [2937 bp, 978 aa] {ON}
            Anc_8.188 YDR069C
          Length = 978

 Score = 35.4 bits (80), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 38/85 (44%), Gaps = 9/85 (10%)

Query: 1176 NLEEKISHQF---DDFKEYGYSLFSVFIHRGEASYGHYWIYIKDRNHNGVWRKYNDETVS 1232
            NL   +S++       K + Y L+ V  H G    GHY  Y+     NG W  ++D T  
Sbjct: 895  NLPPGVSNELPARGQIKPFNYRLYGVACHFGSLYGGHYTAYVDKGIGNG-WYYFDDTTYR 953

Query: 1233 EVQEDEVFNFNEGNTATPYFLVYVK 1257
             ++ D+     E  +++ Y L Y +
Sbjct: 954  PLKNDK-----EPISSSAYVLFYTR 973

>TBLA0B01930 Chr2 (439859..442918) [3060 bp, 1019 aa] {ON} Anc_8.202
            YER151C
          Length = 1019

 Score = 35.4 bits (80), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 36/69 (52%), Gaps = 6/69 (8%)

Query: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNHNGV--WRKYNDETVSEVQEDEVFNFNEGNT--A 1248
            Y L  V  H G +S G +  Y  D  H  V  W + +D TV+E+++D+V    E +T   
Sbjct: 952  YELTGVVYHHGLSSDGGH--YTADIYHKEVDKWYRIDDVTVTELEKDDVLKGGENSTDSR 1009

Query: 1249 TPYFLVYVK 1257
            T Y L+Y K
Sbjct: 1010 TAYILMYQK 1018

>KAFR0K01810 Chr11 (375304..377448) [2145 bp, 714 aa] {ON} Anc_7.390
           YBL067C
          Length = 714

 Score = 35.0 bits (79), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 25/51 (49%)

Query: 736 GINNIGNTCYLNSLLQYYFSIAPLRRYILDYQKTVENFNDHLSNSGHVRRI 786
           G  N GNTCY NS+LQ  F +   R  IL + +        L  SG+  RI
Sbjct: 123 GYENFGNTCYCNSILQCLFFLDDFRIDILKHPRKESIDGRKLKYSGNTPRI 173

>Kpol_1055.31 s1055 complement(78247..80715) [2469 bp, 822 aa] {ON}
            complement(78247..80715) [2469 nt, 823 aa]
          Length = 822

 Score = 35.0 bits (79), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 41/84 (48%), Gaps = 6/84 (7%)

Query: 1179 EKISHQFDDFKEYGYSLFSVFIHRGEASYGHYWIYIKDRNHNGV--WRKYNDETVSEVQE 1236
            E +S    D K   Y L  V  H G +S G +  Y  D  H  +  W + +D  + E+++
Sbjct: 739  ESLSPASIDTKNRAYELTGVIYHHGLSSDGGH--YTADVYHKELDKWYRIDDVNIIELEK 796

Query: 1237 DEVFNFNE-GN-TATPYFLVYVKQ 1258
            D+V    E GN T T Y L+Y K+
Sbjct: 797  DDVLKGGEDGNDTRTAYILIYRKK 820

>Suva_2.228 Chr2 complement(385322..388105) [2784 bp, 927 aa] {ON}
           YDR069C (REAL)
          Length = 927

 Score = 35.0 bits (79), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 32/62 (51%), Gaps = 3/62 (4%)

Query: 732 NWPTGINNIGNTCYLNSLLQYYFSIAPLRRYILD--YQKTVENFNDHLSNSGHVRRIGGR 789
           ++  G+ N+GN+CY+N ++Q       L +  LD  Y K + N N  L + G + +   R
Sbjct: 560 DFAVGLENLGNSCYMNCIIQCILGTHELTQIFLDDSYAKHI-NINSKLGSKGILAKYFAR 618

Query: 790 KI 791
            +
Sbjct: 619 LV 620

>TDEL0D06430 Chr4 complement(1151544..1153154) [1611 bp, 536 aa]
           {ON} Anc_3.575 YFR051C
          Length = 536

 Score = 34.7 bits (78), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 55/116 (47%), Gaps = 14/116 (12%)

Query: 821 VTPSKELAYLAFAPSNIEVEFEVEGNKPADGAAIPIGLKEEATQESCTTKENDPKSIGSK 880
            +P+ + +YL    S  EV  E  G+KP + A  P+G   + T +S        ++IG+ 
Sbjct: 209 ASPAAQQSYLH---SQKEVAVESYGSKPVETAQRPVGRGMKLTGQS-------KRNIGTS 258

Query: 881 MEDNT-NRDTHRNPSNTEKNEPNNVQIVGGDDTTDLNSLTRVAKISSDQLENALEM 935
              +T  R + + P   E+ +P N  I+     T    +TR   ISS +L+  LE+
Sbjct: 259 ARSSTATRASQQEP---EEEKPANNGILISIKETVNAEITRDGAISSSELKGVLEL 311

>YDR069C Chr4 complement(584939..587719) [2781 bp, 926 aa] {ON}
           DOA4Ubiquitin isopeptidase, required for recycling
           ubiquitin from proteasome-bound ubiquitinated
           intermediates, acts at the late endosome/prevacuolar
           compartment to recover ubiquitin from ubiquitinated
           membrane proteins en route to the vacuole
          Length = 926

 Score = 35.0 bits (79), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 32/62 (51%), Gaps = 3/62 (4%)

Query: 732 NWPTGINNIGNTCYLNSLLQYYFSIAPLRRYILD--YQKTVENFNDHLSNSGHVRRIGGR 789
           ++  G+ N+GN+CY+N ++Q       L +  LD  Y K + N N  L + G + +   R
Sbjct: 559 DFAVGLENLGNSCYMNCIIQCILGTHELTQIFLDDSYAKHI-NINSKLGSKGILAKYFAR 617

Query: 790 KI 791
            +
Sbjct: 618 LV 619

>Skud_4.323 Chr4 complement(560596..563376) [2781 bp, 926 aa] {ON}
           YDR069C (REAL)
          Length = 926

 Score = 35.0 bits (79), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 32/62 (51%), Gaps = 3/62 (4%)

Query: 732 NWPTGINNIGNTCYLNSLLQYYFSIAPLRRYILD--YQKTVENFNDHLSNSGHVRRIGGR 789
           ++  G+ N+GN+CY+N ++Q       L +  LD  Y K + N N  L + G + +   R
Sbjct: 559 DFAVGLENLGNSCYMNCIIQCILGTHELTQIFLDDSYAKHI-NINSKLGSKGILAKYFAR 617

Query: 790 KI 791
            +
Sbjct: 618 LV 619

>Suva_4.295 Chr4 complement(520439..522787) [2349 bp, 782 aa] {ON}
           YBR058C (REAL)
          Length = 782

 Score = 34.7 bits (78), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 30/51 (58%), Gaps = 1/51 (1%)

Query: 702 LTKISIERNSNLISNFLLTGTIDPNSLPPEN-WPTGINNIGNTCYLNSLLQ 751
           L ++ IE+N N     + +   +   LP  N +  G+ N+GN+CYLNS++Q
Sbjct: 289 LVQLQIEQNENWQFKMVDSSGKELKKLPASNEYGCGLINLGNSCYLNSVMQ 339

>ZYRO0B16544g Chr2 complement(1342476..1345610) [3135 bp, 1044 aa]
           {ON} similar to uniprot|P40453 Saccharomyces cerevisiae
           YIL156W UBP7 Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 1044

 Score = 34.7 bits (78), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 29/51 (56%), Gaps = 1/51 (1%)

Query: 735 TGINNIGNTCYLNSLLQYYFSIAPLRRYILDYQKTVENFNDHLSNSGHVRR 785
           TG+ N+G TCY+NS+LQ  F+   + R + +       FN  L ++G + +
Sbjct: 599 TGLRNLGATCYINSMLQCLFATN-MFRDLFEPSNYERFFNPELEDTGKLSK 648

>Smik_4.307 Chr4 complement(551719..554508) [2790 bp, 929 aa] {ON}
           YDR069C (REAL)
          Length = 929

 Score = 34.7 bits (78), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 32/62 (51%), Gaps = 3/62 (4%)

Query: 732 NWPTGINNIGNTCYLNSLLQYYFSIAPLRRYILD--YQKTVENFNDHLSNSGHVRRIGGR 789
           ++  G+ N+GN+CY+N ++Q       L +  LD  Y K + N N  L + G + +   R
Sbjct: 562 DFAVGLENLGNSCYMNCIIQCILGTHELTQIFLDDSYAKHI-NINSKLGSKGILAKYFAR 620

Query: 790 KI 791
            +
Sbjct: 621 LV 622

>KAFR0A04210 Chr1 (843659..844981) [1323 bp, 440 aa] {ON} Anc_8.742
            YMR223W
          Length = 440

 Score = 34.3 bits (77), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 28/127 (22%), Positives = 56/127 (44%), Gaps = 16/127 (12%)

Query: 970  LVKQLFYGTTKQSIVPLSATNKVRTKVERFLSLLINIGDHPKDIYDAFDSYFKDEYLTME 1029
            L+  +F G  K SIV     +  +T  + ++ L ++I D    +Y   DS+ K E  T+ 
Sbjct: 251  LIHSIFQGKLKSSIVCPECHDNSKTVTDPYIDLSLDIKD-KATLYQCLDSFHKKE--TLH 307

Query: 1030 EYG----------DVTRTVAVTTFPTILQVQIQRV-YYDRERFMPFKSIEPLPFKEVIYM 1078
            +Y           D  + + +   P +L +Q++R  + +  + +   +   + F   + M
Sbjct: 308  DYNYHCPNCDTMQDPIKQLTIDKLPPVLVLQLKRFEHLNNGQNVKLNAF--IEFPTYLNM 365

Query: 1079 DRYADTE 1085
             +Y  TE
Sbjct: 366  KKYCHTE 372

 Score = 33.9 bits (76), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 26/48 (54%), Gaps = 2/48 (4%)

Query: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVF 1240
            Y L  V  H G  + GHY   +K  ++N  W K+ND  V+ + E+EV 
Sbjct: 380  YELNGVISHIGTVNEGHYIATLKLDSNN--WFKFNDSMVTSISEEEVL 425

>Skud_11.338 Chr11 complement(614651..616789) [2139 bp, 712 aa] {ON}
           YKR098C (REAL)
          Length = 712

 Score = 34.7 bits (78), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 18/30 (60%)

Query: 735 TGINNIGNTCYLNSLLQYYFSIAPLRRYIL 764
           TG+ N  NTCY+NS++Q  F   P R   L
Sbjct: 292 TGLQNPCNTCYINSIIQCLFGSTPFRDLFL 321

>CAGL0A04477g Chr1 (442089..444401) [2313 bp, 770 aa] {ON} similar
           to uniprot|P38187 Saccharomyces cerevisiae YBL067c UBP13
           or uniprot|P39967 Saccharomyces cerevisiae YER098w UBP9
           ubiquitin carboxyl-terminal hydrolase
          Length = 770

 Score = 34.7 bits (78), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 19/31 (61%)

Query: 736 GINNIGNTCYLNSLLQYYFSIAPLRRYILDY 766
           G  N GNTCY NS+LQ  +++   R  +L Y
Sbjct: 151 GYENFGNTCYCNSVLQCLYNLPEFRNDMLRY 181

>NCAS0A03840 Chr1 (780031..782784) [2754 bp, 917 aa] {ON} Anc_8.202
            YER151C
          Length = 917

 Score = 34.7 bits (78), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 31/68 (45%), Gaps = 2/68 (2%)

Query: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNF--NEGNTATP 1250
            Y L  V  H G +  G ++           W + +D  +SE++ D V +   N+  T T 
Sbjct: 849  YKLTGVIYHHGSSPDGGHYTADVFHQQTNKWYRIDDVNISELKNDHVLDADDNDMGTRTA 908

Query: 1251 YFLVYVKQ 1258
            Y L+Y K+
Sbjct: 909  YILIYEKK 916

>SAKL0H18986g Chr8 (1683752..1686433) [2682 bp, 893 aa] {ON} similar
           to uniprot|P32571 Saccharomyces cerevisiae YDR069C DOA4
           Ubiquitin hydrolase required for recycling ubiquitin
           from proteasome-bound ubiquitinated intermediates acts
           at the late endosome/prevacuolar compartment to recover
           ubiquitin from ubiquitinated membrane proteins en route
           to the vacuole
          Length = 893

 Score = 34.3 bits (77), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 27/51 (52%), Gaps = 1/51 (1%)

Query: 732 NWPTGINNIGNTCYLNSLLQYYFSIAPLRRYIL-DYQKTVENFNDHLSNSG 781
           ++  G+ N+GN+CY+N ++Q       L +  L D  K   NFN  L + G
Sbjct: 520 DFSVGLVNLGNSCYMNCIIQCLLGTHELSQMFLNDSYKNHINFNSKLGSKG 570

>KNAG0G01590 Chr7 complement(354369..356384) [2016 bp, 671 aa] {ON}
           Anc_8.188 YDR069C
          Length = 671

 Score = 34.3 bits (77), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 40/136 (29%), Positives = 59/136 (43%), Gaps = 27/136 (19%)

Query: 700 AALTKISIERNSNL------ISNFLLTGTIDPNSL-----PPENWPT---GINNIGNTCY 745
           A +TK  +  NSN+      I   L TG  +P +L     P    PT   GI N GN CY
Sbjct: 296 AIITKNDLGNNSNMAGPAFSIQLPLFTGN-NPQTLSNTHKPNYTSPTVIKGIQNEGNCCY 354

Query: 746 LNSLLQYYFSIAPLRRYILD--YQKTVENFNDHLSNSGHVRRIGGR------KISKGEVE 797
           +N ++Q            LD  Y  T+ N N  L + G V +   +      ++S+  ++
Sbjct: 355 MNCIIQCLLCFPEFTNKFLDNAYLGTI-NVNSRLGHQGLVVKNWAKIIQAFFQVSQENIQ 413

Query: 798 RSV---QFIYQLRNLF 810
            +V   +F  Q  NLF
Sbjct: 414 PAVSITEFREQWANLF 429

 Score = 32.3 bits (72), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 46/125 (36%), Gaps = 21/125 (16%)

Query: 1148 VKIDVINTLRTNVNNIDNELMSLYNNINNLEEK------ISHQFDDFKEYG--------Y 1193
             K    +TL T + N+   L+  +N  +NL  K        +  D  +  G        Y
Sbjct: 553  CKTKTHSTLGTTITNVPEVLIIHFNRFDNLLNKKECFVKYPYLLDLSQGNGLLGKCDVPY 612

Query: 1194 SLFSVFIHRGEASYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNFNEGNTATPYFL 1253
             L +V  H G    GHY  Y    + NG W  ++D     V   E        + + Y L
Sbjct: 613  KLVAVACHTGTLFSGHYTAYCFKNSENG-WYHFDDTQCKPVSNGECI------SQSAYLL 665

Query: 1254 VYVKQ 1258
             Y KQ
Sbjct: 666  FYQKQ 670

>CAGL0I05522g Chr9 complement(521749..523923) [2175 bp, 724 aa] {ON}
           some similarities with uniprot|P39967 Saccharomyces
           cerevisiae YER098w UBP9 or uniprot|P38187 Saccharomyces
           cerevisiae YBL067c UBP13
          Length = 724

 Score = 34.3 bits (77), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 20/31 (64%)

Query: 736 GINNIGNTCYLNSLLQYYFSIAPLRRYILDY 766
           G  N G+TCY NS+LQ  +++   R+ IL +
Sbjct: 122 GYENFGHTCYCNSVLQCIYNLPEFRKSILQF 152

 Score = 33.5 bits (75), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 37/79 (46%), Gaps = 5/79 (6%)

Query: 1185 FDDFKEYGYSLFSVFIHRGEA-SYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNF- 1242
            FD+     Y L  V +H G + ++GHY    K   +   W  Y+DET+  + E+ V +  
Sbjct: 575  FDNSLCKTYELTGVVLHVGASPTHGHYVSICKHEKYG--WLMYDDETIESIPEEAVTSHV 632

Query: 1243 -NEGNTATPYFLVYVKQGQ 1260
                N  T Y L Y ++ Q
Sbjct: 633  GEPNNPITAYVLFYSEKIQ 651

>Suva_5.280 Chr5 complement(441123..443840) [2718 bp, 905 aa] {ON}
            YER151C (REAL)
          Length = 905

 Score = 34.3 bits (77), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 35/69 (50%), Gaps = 4/69 (5%)

Query: 1193 YSLFSVFIHRGEAS-YGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNFNE--GNTAT 1249
            Y L  V  H G +S  GHY   +    HN  W + +D  + E+++D+V    E   ++ T
Sbjct: 837  YKLTGVIYHHGISSDGGHYTADVYHSEHNK-WYRIDDVNIIELEDDDVLKGGEEASDSRT 895

Query: 1250 PYFLVYVKQ 1258
             Y L+Y K+
Sbjct: 896  AYILMYQKK 904

>YER144C Chr5 complement(457806..460223) [2418 bp, 805 aa] {ON}
           UBP5Putative ubiquitin-specific protease, closest
           paralog of Doa4p but has no functional overlap;
           concentrates at the bud neck
          Length = 805

 Score = 33.9 bits (76), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 24/47 (51%), Gaps = 2/47 (4%)

Query: 735 TGINNIGNTCYLNSLLQYYFSIAPLRRYILDYQKTVENFNDHLSNSG 781
            G+ NIGN CY+N +LQ       L R  LD   T  NF +  S+ G
Sbjct: 446 VGLENIGNCCYMNCILQCLVGTHDLVRMFLD--NTYLNFINFDSSRG 490

>KNAG0G02930 Chr7 (644555..645934) [1380 bp, 459 aa] {ON} Anc_8.742
            YMR223W
          Length = 459

 Score = 33.9 bits (76), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 40/170 (23%), Positives = 70/170 (41%), Gaps = 25/170 (14%)

Query: 938  QQDVTECIGNVLFQIESG-SEPIKYDEDNE--------QYDLVKQLFYGTTKQSIVPLSA 988
            QQD  E +  +L Q+        + DED E         + +V   F GT + SIV    
Sbjct: 226  QQDAHEFLQFLLNQLHCDYKRERQVDEDKEVRSSSSQLCHCIVHSSFQGTLRSSIVCPEC 285

Query: 989  TNKVRTKVERFLSLLINIGDHPKDIYDAFDSYFKDEYLTMEEYG--------DVTRTVAV 1040
             +  +T ++ FL L ++I    + +YD  DS+ + E L   +Y         D  + + +
Sbjct: 286  QDDSKTMLDPFLDLSLDIKGQ-RTLYDCLDSFHRREQLHDFDYHCPRCQTSRDPIKQLTI 344

Query: 1041 TTFPTILQVQIQRVYYDRERFMPFKSI---EPLPFKEVIYMDRYADTENP 1087
                  L +Q++R     E     +++   +P+ F   + M RY     P
Sbjct: 345  ERLAPTLVLQLKRF----EHLTSGQNVKLNDPVQFPLHLDMSRYCTGGEP 390

>Skud_2.177 Chr2 complement(322000..324348) [2349 bp, 782 aa] {ON}
           YBR058C (REAL)
          Length = 782

 Score = 33.9 bits (76), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 31/51 (60%), Gaps = 1/51 (1%)

Query: 702 LTKISIERNSNLISNFL-LTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQ 751
           L ++ +E+N N     +  +G      LP +++  G+ N+GN+CYLNS+LQ
Sbjct: 289 LVQLQVEQNENWQFRMVDSSGKEFKRLLPNKDYGCGLINLGNSCYLNSVLQ 339

>NDAI0A03680 Chr1 (837931..841281) [3351 bp, 1116 aa] {ON} 
          Length = 1116

 Score = 33.5 bits (75), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 25/47 (53%), Gaps = 1/47 (2%)

Query: 736 GINNIGNTCYLNSLLQYYFSIAPLRRYILDYQ-KTVENFNDHLSNSG 781
           G+ N+GN+CYLN ++Q       L +  L+Y  +   N N  L + G
Sbjct: 748 GLQNMGNSCYLNCIIQCLLGTHELTKIFLNYSFERYINLNSKLGSKG 794

>KAFR0B02370 Chr2 complement(460558..463047) [2490 bp, 829 aa] {ON}
            Anc_8.202 YER151C
          Length = 829

 Score = 33.5 bits (75), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 35/68 (51%), Gaps = 2/68 (2%)

Query: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNFNE--GNTATP 1250
            YSL  V  H G +  G ++      + +  W + +D  ++E++ED+V    E   ++ T 
Sbjct: 762  YSLTGVIYHHGLSPDGGHYTADVLHSESKKWYRIDDVNINELEEDDVLKGGEEDNDSRTA 821

Query: 1251 YFLVYVKQ 1258
            Y L+Y K+
Sbjct: 822  YILMYQKK 829

>KAFR0H00150 Chr8 (14149..16119) [1971 bp, 656 aa] {ON} Anc_5.712
           YIL156W possible pseudogene; NNN added to avoid internal
           stop codon
          Length = 656

 Score = 33.1 bits (74), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 17/26 (65%)

Query: 735 TGINNIGNTCYLNSLLQYYFSIAPLR 760
            G+ N GNTCY+NS++Q  F    LR
Sbjct: 238 VGLRNQGNTCYINSMVQCLFGTKVLR 263

>Kwal_26.9151 s26 complement(1095026..1096390) [1365 bp, 454 aa] {ON}
            YMR223W (UBP8) - putative deubiquitinating enzyme [contig
            70] FULL
          Length = 454

 Score = 33.1 bits (74), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 26/64 (40%), Gaps = 8/64 (12%)

Query: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNFNEGNTATPYF 1252
            Y L +V  H G  + GHY    K     G W ++ND  +  + E+E            Y 
Sbjct: 394  YELVAVISHEGSVNQGHYTSMCKIP--GGQWFRFNDSMIVSISEEEALR------QQAYL 445

Query: 1253 LVYV 1256
            L YV
Sbjct: 446  LFYV 449

>TPHA0K00240 Chr11 (39455..39889,39976..40065) [525 bp, 174 aa] {ON}
           Anc_5.581 YML036W
          Length = 174

 Score = 32.0 bits (71), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 49/102 (48%), Gaps = 10/102 (9%)

Query: 466 ESLSSLDP-KNIGLYFDALTYIANRKGAYQLIAYCGKQDIIGQEALENALLVFKIEPKEC 524
           E L +L P  NIG   +A      ++G+  L+     +  +GQE+ E+A  + K    E 
Sbjct: 75  ECLLALSPTSNIG---EAFNRFGIQQGSTDLVVLQIVE--VGQESTESANDIVKGTEVEF 129

Query: 525 N----IAELNEATLLSIYKFETSNKSQVTSGHLTNLKNALRL 562
           N    +   NE TL  IYK + S + + T G    L NA++L
Sbjct: 130 NNDNLLHTYNEQTLRKIYKLDNSFQPKTTEGFSQALVNAIQL 171

>CAGL0I06765g Chr9 (655806..658469) [2664 bp, 887 aa] {ON} similar
           to uniprot|P32571 Saccharomyces cerevisiae YDR069c DOA4
           ubiquitin-specific protease
          Length = 887

 Score = 33.1 bits (74), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 13/44 (29%), Positives = 26/44 (59%)

Query: 722 TIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYILD 765
           T+  N +   ++  G+ N+GN+CY+N ++Q  F+   L +  L+
Sbjct: 512 TLSCNQMMDTSFTVGLENMGNSCYINCIIQCIFATTELIKIFLN 555

>Ecym_5544 Chr5 (1102256..1104760) [2505 bp, 834 aa] {ON} similar to
            Ashbya gossypii AGR139C
          Length = 834

 Score = 33.1 bits (74), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 34/66 (51%), Gaps = 4/66 (6%)

Query: 1193 YSLFSVFIHRG-EASYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNFNE--GNTAT 1249
            Y L  V  H G  +S GHY   +  ++    W + +D TV+E+ ++EV    E   ++ T
Sbjct: 767  YKLTGVVYHHGLSSSGGHYTADVLHQDEEK-WYRIDDTTVTEINKEEVVTGGEEGSHSRT 825

Query: 1250 PYFLVY 1255
             Y L+Y
Sbjct: 826  AYILIY 831

>SAKL0H04994g Chr8 complement(445232..446596) [1365 bp, 454 aa] {ON}
            similar to uniprot|P50102 Saccharomyces cerevisiae
            YMR223W UBP8 Ubiquitin-specific protease that is a
            component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
            acetylation complex required for SAGA-mediated
            deubiquitination of histone H2B
          Length = 454

 Score = 32.7 bits (73), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 23/48 (47%), Gaps = 2/48 (4%)

Query: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVF 1240
            Y L  +  H+G  + GHY    K     G W K+ND  V+ V E +V 
Sbjct: 394  YELIGLISHQGSVNQGHYTSICKIP--GGQWFKFNDSMVTAVAEIDVL 439

>CAGL0H05335g Chr8 complement(512683..514134) [1452 bp, 483 aa] {ON}
           weakly similar to uniprot|Q02863 Saccharomyces
           cerevisiae YPL072w UBP16
          Length = 483

 Score = 32.7 bits (73), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 28/51 (54%), Gaps = 1/51 (1%)

Query: 714 ISNFLLTGTIDPN-SLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYI 763
           + N L +  I+ + +  P+ + TG+ N GN CY NS++Q   SI     YI
Sbjct: 50  VKNILFSKNINGSLASRPDKYTTGLVNKGNYCYANSVIQALSSIDYFSDYI 100

>YKR098C Chr11 complement(633026..635179) [2154 bp, 717 aa] {ON}
           UBP11Ubiquitin-specific protease that cleaves ubiquitin
           from ubiquitinated proteins
          Length = 717

 Score = 32.7 bits (73), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 21/41 (51%)

Query: 724 DPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYIL 764
           D N L  E   TG+ N  NTCY+NS++Q  F     R   L
Sbjct: 287 DSNDLLSELSITGLQNPCNTCYINSIIQCLFGTTLFRDLFL 327

>TBLA0E02570 Chr5 complement(646995..649352) [2358 bp, 785 aa] {ON}
           Anc_3.270 YBR058C
          Length = 785

 Score = 32.7 bits (73), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 36/64 (56%), Gaps = 1/64 (1%)

Query: 693 DQFLTLKAALTKISIERNSNLISNFLLTGTIDPNSLPP-ENWPTGINNIGNTCYLNSLLQ 751
           D     +  L ++ +E+N N     + +   +  SL   +++  G+ N+GN+CYLNS+LQ
Sbjct: 283 DNVAASEKTLVELQVEQNMNWNFQMVDSEGKELKSLKAGDDFGVGLINLGNSCYLNSILQ 342

Query: 752 YYFS 755
            +++
Sbjct: 343 CFYN 346

>NCAS0I01620 Chr9 complement(299269..301656) [2388 bp, 795 aa] {ON}
           Anc_3.270 YBR058C
          Length = 795

 Score = 32.7 bits (73), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 32/56 (57%), Gaps = 1/56 (1%)

Query: 701 ALTKISIERNSNLISNFLLTGTIDPNSLPP-ENWPTGINNIGNTCYLNSLLQYYFS 755
           +L ++ +E+N N     + +   +   LPP +    G  N+GN+CYLNS+LQ  F+
Sbjct: 298 SLIELQVEQNMNWNFKMVDSHGNELIQLPPSKELGCGFINLGNSCYLNSVLQCLFN 353

>Ecym_6248 Chr6 (468203..469603) [1401 bp, 466 aa] {ON} similar to
            Ashbya gossypii AFR551W
          Length = 466

 Score = 32.7 bits (73), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 28/64 (43%), Gaps = 8/64 (12%)

Query: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNFNEGNTATPYF 1252
            Y L ++  H G    GHY      R +  +W K+ND  V+ + E+++           Y 
Sbjct: 409  YKLSAIISHHGTVHQGHYTTIC--RINGDIWAKFNDSMVTVISEEDMLK------EQAYL 460

Query: 1253 LVYV 1256
            L YV
Sbjct: 461  LYYV 464

>KLTH0E04356g Chr5 complement(394583..395791,395863..395877) [1224
           bp, 407 aa] {ON} similar to uniprot|Q6B1J7 Saccharomyces
           cerevisiae YLR360W VPS38 involved in vacuolar protein
           targeting
          Length = 407

 Score = 32.3 bits (72), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 41/79 (51%), Gaps = 6/79 (7%)

Query: 702 LTKISIERNSN------LISNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFS 755
           L   S+ R+SN      L+ ++LL   I    +     P  ++  G+T  +N+ L  Y +
Sbjct: 315 LNATSLARDSNRISTNTLLGHYLLFLHILSEKILFVRLPHRLSYYGSTSVINNQLPLYLT 374

Query: 756 IAPLRRYILDYQKTVENFN 774
            +P ++++ D+++ V+ FN
Sbjct: 375 SSPTQQHVADFERAVDLFN 393

>NDAI0C05900 Chr3 complement(1350639..1353119) [2481 bp, 826 aa]
           {ON} Anc_8.188 YDR069C
          Length = 826

 Score = 32.7 bits (73), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 38/72 (52%), Gaps = 4/72 (5%)

Query: 718 LLTGTIDPNSLPPE---NWPTGINNIGNTCYLNSLLQYYFSIAPLRR-YILDYQKTVENF 773
           LL  T +P  + P+   ++ TG+ N+ N+CY+N ++Q   S   L + Y+ +   T  N 
Sbjct: 438 LLPPTANPQQIVPKLDLDFTTGLENVKNSCYMNCVIQCLLSTHDLTKLYLTNAFLTQINV 497

Query: 774 NDHLSNSGHVRR 785
            + L + G + +
Sbjct: 498 ENKLGSKGFLSK 509

>AGR139C Chr7 complement(1010460..1012829) [2370 bp, 789 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YER151C
            (UBP3)
          Length = 789

 Score = 32.7 bits (73), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 36/70 (51%), Gaps = 4/70 (5%)

Query: 1189 KEYGYSLFSVFIHRG-EASYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNFNE--G 1245
            K+  Y L  V  H G   S GHY   +  +  +  W + +D  V+E+++++VF   +   
Sbjct: 719  KDTTYRLTGVVYHHGLSPSGGHYTADVLHQTQDK-WYRIDDNNVTEIRQEDVFKRGDEAS 777

Query: 1246 NTATPYFLVY 1255
            ++ T Y L+Y
Sbjct: 778  DSKTAYILIY 787

>TPHA0D04350 Chr4 complement(934597..937161) [2565 bp, 854 aa] {ON}
            Anc_8.202 YER151C
          Length = 854

 Score = 32.7 bits (73), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 33/118 (27%), Positives = 52/118 (44%), Gaps = 30/118 (25%)

Query: 1164 DNELMSLYNNINNLEEKISHQFDDFKEYG---------------------YSLFSVFIHR 1202
            DN +M+ YN+IN   EKI  +      YG                     Y L  V  H 
Sbjct: 742  DNNMMN-YNSINGRIEKIRKKIS----YGHELVIPEESLSPHSWSQTNRKYQLTGVIYHH 796

Query: 1203 GEAS-YGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNFNE--GNTATPYFLVYVK 1257
            G +S  GHY   + ++  +  W + +D  ++E+++D+V    E   +T T Y L+Y K
Sbjct: 797  GLSSDGGHYTADVFNKTADK-WYRIDDINITELKKDDVLKGGEDGTDTRTAYILMYQK 853

>Kwal_14.2008 s14 (571638..572912) [1275 bp, 424 aa] {ON} YDR069C
           (DOA4) - ubiquitin isopeptidase [contig 424] PARTIAL
          Length = 424

 Score = 32.3 bits (72), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 36/83 (43%), Gaps = 18/83 (21%)

Query: 736 GINNIGNTCYLNSLLQYYFSIAPLRRYILD--YQKTVENFNDHLSNSGHVRR-------- 785
           G+ N+GN+CY+N ++Q       L +  LD  Y+  V N N  L + G + +        
Sbjct: 57  GLVNLGNSCYMNCIIQCLLGTRELVQIFLDDSYKNHV-NLNSRLGSKGVLAKYFSQLIHN 115

Query: 786 -------IGGRKISKGEVERSVQ 801
                    GRK + G    +VQ
Sbjct: 116 MQQQAISASGRKSTSGNERNAVQ 138

>TBLA0F03610 Chr6 (890140..893574) [3435 bp, 1144 aa] {ON} Anc_8.188
           YDR069C
          Length = 1144

 Score = 32.7 bits (73), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 35/72 (48%), Gaps = 12/72 (16%)

Query: 736 GINNIGNTCYLNSLLQYYFSIAPLRRYILD--YQKTVENFNDHLSNSGHVRRIGGRKISK 793
           G+ N+GN+CYLN ++Q   +   L +  L+  Y+K + N N          ++G + I  
Sbjct: 736 GLENMGNSCYLNCIIQCLLNNHELTKMFLNNSYEKHI-NINS---------KLGSKGILA 785

Query: 794 GEVERSVQFIYQ 805
               R V  +YQ
Sbjct: 786 KSFARLVHSMYQ 797

>Suva_11.335 Chr11 complement(617850..620024) [2175 bp, 724 aa] {ON}
           YKR098C (REAL)
          Length = 724

 Score = 32.7 bits (73), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 23/40 (57%), Gaps = 2/40 (5%)

Query: 735 TGINNIGNTCYLNSLLQYYFSIAPLRRYIL--DYQKTVEN 772
           TG+ N  NTCY+NS++Q  FS    R   L   Y+  +EN
Sbjct: 296 TGLRNPCNTCYINSMVQCLFSTTLFRDLFLTKKYKLFLEN 335

>ZYRO0B11044g Chr2 complement(869260..871740) [2481 bp, 826 aa] {ON}
            similar to uniprot|Q01477 Saccharomyces cerevisiae
            YER151C UBP3 Ubiquitin-specific protease that interacts
            with Bre5p to co-regulate anterograde and retrograde
            transport between endoplasmic reticulum and Golgi
            compartments inhibitor of gene silencing cleaves
            ubiquitin fusions but not polyubiquitin
          Length = 826

 Score = 32.3 bits (72), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 36/68 (52%), Gaps = 4/68 (5%)

Query: 1193 YSLFSVFIHRGEAS-YGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNFNE--GNTAT 1249
            Y L  V  H G +S  GHY   +  R  +  W + +D ++ E+++++V    E  G++ T
Sbjct: 759  YHLTGVIYHHGVSSDGGHYTADVYHRESDK-WYRIDDVSIIELEKEDVLKGGEESGDSRT 817

Query: 1250 PYFLVYVK 1257
             Y L+Y K
Sbjct: 818  AYILMYQK 825

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.133    0.379 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 145,518,609
Number of extensions: 7058675
Number of successful extensions: 30894
Number of sequences better than 10.0: 427
Number of HSP's gapped: 31959
Number of HSP's successfully gapped: 539
Length of query: 1272
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1151
Effective length of database: 39,606,813
Effective search space: 45587441763
Effective search space used: 45587441763
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 72 (32.3 bits)