Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_15.3005.440ON46346318210.0
YOR123C (LEO1)5.440ON46437614550.0
Suva_8.1755.440ON45346414350.0
Skud_15.2855.440ON48750114110.0
TDEL0D026105.440ON4403739401e-123
CAGL0K10230g5.440ON4462749261e-120
SAKL0G02662g5.440ON4793768971e-116
NCAS0H020805.440ON4353658811e-114
ZYRO0F10164g5.440ON4233698721e-113
KNAG0B042105.440ON4632858721e-112
NDAI0C015905.440ON4703658561e-109
KAFR0D050505.440ON4193598471e-109
Kpol_1062.265.440ON4573768461e-108
Kwal_55.214085.440ON4363627941e-101
KLLA0E02311g5.440ON4172377841e-100
KLTH0F15928g5.440ON4233687832e-99
TPHA0E017305.440ON4692287742e-97
ACL167C5.440ON4392347546e-95
Ecym_45115.440ON4612257411e-92
TBLA0A064905.440ON4282447144e-89
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_15.300
         (463 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_15.300 Chr15 complement(514294..515685) [1392 bp, 463 aa] {...   706   0.0  
YOR123C Chr15 complement(553176..554570) [1395 bp, 464 aa] {ON} ...   565   0.0  
Suva_8.175 Chr8 complement(310977..312338) [1362 bp, 453 aa] {ON...   557   0.0  
Skud_15.285 Chr15 complement(509624..511087) [1464 bp, 487 aa] {...   548   0.0  
TDEL0D02610 Chr4 (500294..501616) [1323 bp, 440 aa] {ON} Anc_5.4...   366   e-123
CAGL0K10230g Chr11 complement(996303..997643) [1341 bp, 446 aa] ...   361   e-120
SAKL0G02662g Chr7 complement(218969..220408) [1440 bp, 479 aa] {...   350   e-116
NCAS0H02080 Chr8 complement(404035..405342) [1308 bp, 435 aa] {O...   343   e-114
ZYRO0F10164g Chr6 complement(821488..822759) [1272 bp, 423 aa] {...   340   e-113
KNAG0B04210 Chr2 (801346..802737) [1392 bp, 463 aa] {ON} Anc_5.4...   340   e-112
NDAI0C01590 Chr3 complement(340050..341462) [1413 bp, 470 aa] {O...   334   e-109
KAFR0D05050 Chr4 complement(993511..994770) [1260 bp, 419 aa] {O...   330   e-109
Kpol_1062.26 s1062 (58970..60343) [1374 bp, 457 aa] {ON} (58970....   330   e-108
Kwal_55.21408 s55 (823660..824970) [1311 bp, 436 aa] {ON} YOR123...   310   e-101
KLLA0E02311g Chr5 complement(214032..215285) [1254 bp, 417 aa] {...   306   e-100
KLTH0F15928g Chr6 (1295609..1296880) [1272 bp, 423 aa] {ON} simi...   306   2e-99
TPHA0E01730 Chr5 (350455..351864) [1410 bp, 469 aa] {ON} Anc_5.4...   302   2e-97
ACL167C Chr3 complement(63134..64453) [1320 bp, 439 aa] {ON} Syn...   295   6e-95
Ecym_4511 Chr4 complement(1020312..1021697) [1386 bp, 461 aa] {O...   290   1e-92
TBLA0A06490 Chr1 (1595241..1596527) [1287 bp, 428 aa] {ON} Anc_5...   279   4e-89

>Smik_15.300 Chr15 complement(514294..515685) [1392 bp, 463 aa] {ON}
           YOR123C (REAL)
          Length = 463

 Score =  706 bits (1821), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/463 (77%), Positives = 359/463 (77%)

Query: 1   MSSEILQDSPQNGQIVGDLDATSNNTSNEKIALTQDFNDSKEEEDAELDDLFGXXXXXXX 60
           MSSEILQDSPQNGQIVGDLDATSNNTSNEKIALTQDFNDSKEEEDAELDDLFG       
Sbjct: 1   MSSEILQDSPQNGQIVGDLDATSNNTSNEKIALTQDFNDSKEEEDAELDDLFGDDDDDDN 60

Query: 61  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXVNHRSRHRESLGLDDDEAEEQAMYTRKFYGE 120
                                        VNHRSRHRESLGLDDDEAEEQAMYTRKFYGE
Sbjct: 61  DDDNDDNDGKKSGIENNNNESGGDSDEESVNHRSRHRESLGLDDDEAEEQAMYTRKFYGE 120

Query: 121 DLNDFSDQDEATHTFKEENVELVRHIIPSKGIVNETASHNEIFYARIPNFLTIDPVPFDP 180
           DLNDFSDQDEATHTFKEENVELVRHIIPSKGIVNETASHNEIFYARIPNFLTIDPVPFDP
Sbjct: 121 DLNDFSDQDEATHTFKEENVELVRHIIPSKGIVNETASHNEIFYARIPNFLTIDPVPFDP 180

Query: 181 PSFEAKVNERTSNSASKEDQLDDRLIDENTVRWRYSRDKDQHVFKESNTQIVQWSDGTYS 240
           PSFEAKVNERTSNSASKEDQLDDRLIDENTVRWRYSRDKDQHVFKESNTQIVQWSDGTYS
Sbjct: 181 PSFEAKVNERTSNSASKEDQLDDRLIDENTVRWRYSRDKDQHVFKESNTQIVQWSDGTYS 240

Query: 241 LKVGEECTDILVNDTSNTFLTVSHDQQELIQCYEGGEIKKTLMFIPTSTNSKIHQKLSKA 300
           LKVGEECTDILVNDTSNTFLTVSHDQQELIQCYEGGEIKKTLMFIPTSTNSKIHQKLSKA
Sbjct: 241 LKVGEECTDILVNDTSNTFLTVSHDQQELIQCYEGGEIKKTLMFIPTSTNSKIHQKLSKA 300

Query: 301 VIRRNQRQNKGPGTYIVSMDPEVEKRELEKXXXXXXXXXXXXXXXXXXXXXXPDAAFETG 360
           VIRRNQRQNKGPGTYIVSMDPEVEKRELEK                      PDAAFETG
Sbjct: 301 VIRRNQRQNKGPGTYIVSMDPEVEKRELEKKQSQILRDRRRRQLKEKEKQESPDAAFETG 360

Query: 361 FRKQSSPTAYGTSRRNEYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 420
           FRKQSSPTAYGTSRRNEY                                          
Sbjct: 361 FRKQSSPTAYGTSRRNEYEEDDFLVDDDEEEEAEFDDDDDNEEEEEEEEEEEEEEEDADE 420

Query: 421 XXXXRLRSLKKEGAAMYRQEENEDNNETKRRRVAVIEDDEEED 463
               RLRSLKKEGAAMYRQEENEDNNETKRRRVAVIEDDEEED
Sbjct: 421 ANAARLRSLKKEGAAMYRQEENEDNNETKRRRVAVIEDDEEED 463

>YOR123C Chr15 complement(553176..554570) [1395 bp, 464 aa] {ON}
           LEO1Component of the Paf1 complex; which associates with
           RNA polymerase II and is involved in histone
           methylation; plays a role in regulating Ty1
           transposition; involved in transcription elongation as
           demonstrated by the G-less-based run-on (GLRO) assay
          Length = 464

 Score =  565 bits (1455), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/376 (75%), Positives = 297/376 (78%), Gaps = 9/376 (2%)

Query: 90  VNHRSRHRESLGLDDDEAEEQAMYTRKFYGEDLNDFSDQDEATHTFKEENVELVRHIIPS 149
           +NHRSRHRESLGLDDDEAEEQAMYTRKFYGED N+FSDQDE THTFKEENVELVRHIIPS
Sbjct: 96  INHRSRHRESLGLDDDEAEEQAMYTRKFYGEDANNFSDQDETTHTFKEENVELVRHIIPS 155

Query: 150 KGIVNETASHNEIFYARIPNFLTIDPVPFDPPSFEAKVNERTSNSASKEDQLDDRLIDEN 209
           K  VNETASHNEIFYARIPNFLTIDP+PFDPPSFEAKVNER SNSAS+EDQLDDRLIDEN
Sbjct: 156 KANVNETASHNEIFYARIPNFLTIDPIPFDPPSFEAKVNERASNSASREDQLDDRLIDEN 215

Query: 210 TVRWRYSRDKDQHVFKESNTQIVQWSDGTYSLKVGEECTDILVNDTSNTFLTVSHDQQEL 269
           TVRWRYSRDKDQHVFKESNTQIVQWSDGTYSLKVGEECTDILVNDTSNTFLTVSHDQQEL
Sbjct: 216 TVRWRYSRDKDQHVFKESNTQIVQWSDGTYSLKVGEECTDILVNDTSNTFLTVSHDQQEL 275

Query: 270 IQCYEGGEIKKTLMFIPTSTNSKIHQKLSKAVIRRNQRQNKGPGTYIVSMDPEVEKRELE 329
           IQCYEGGEIKKTLMFIPTSTNSKIHQKLSKAVIRRNQRQ+KGPGTYIVSMDPEVEK+ELE
Sbjct: 276 IQCYEGGEIKKTLMFIPTSTNSKIHQKLSKAVIRRNQRQSKGPGTYIVSMDPEVEKKELE 335

Query: 330 KXXXXXXXXXXXXXXXXXXXXXXPDAAFETGFRKQSSPTAYGTSRRNEYXXXXXXXXXXX 389
           +                      PDAAFETGFRKQ+SPT YG SRRNEY           
Sbjct: 336 RKQSQILRDRRRRQLKEKEKQESPDAAFETGFRKQNSPTTYGASRRNEY-------EEDD 388

Query: 390 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRLRSLKKEGAAMYR--QEENEDNNE 447
                                              RLR+LK+EGAAMYR  +EE +D +E
Sbjct: 389 FLVDDDEEEEAAFDDEEDDNEEEEEEEDADEENASRLRNLKREGAAMYREEEEEEKDRSE 448

Query: 448 TKRRRVAVIEDDEEED 463
           TKRRRVAVIEDDE+ED
Sbjct: 449 TKRRRVAVIEDDEDED 464

 Score = 37.0 bits (84), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 26/38 (68%)

Query: 1  MSSEILQDSPQNGQIVGDLDATSNNTSNEKIALTQDFN 38
          MSSE  QD PQ  QI  ++  T+N+TSNE+ + +QD N
Sbjct: 1  MSSESPQDQPQKEQISNNVGVTTNSTSNEETSRSQDDN 38

>Suva_8.175 Chr8 complement(310977..312338) [1362 bp, 453 aa] {ON}
           YOR123C (REAL)
          Length = 453

 Score =  557 bits (1435), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/464 (63%), Positives = 321/464 (69%), Gaps = 12/464 (2%)

Query: 1   MSSEILQDSPQNGQIVGDLDATSNNTSNEKIALTQDFNDSKEEEDAELDDLFGXXXXXXX 60
           MSSE      QN Q VGDL A  NNT +EK  +TQD ND  E+ + + ++          
Sbjct: 1   MSSESPVGQSQNEQAVGDLGAVPNNTIDEKPDVTQDNND--EKVNNQDEEEEEEEAELDD 58

Query: 61  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXVNHRSRHRESLGLDDDEAEEQAMYTRKFYGE 120
                                         NHR  HRESLGLDDDEAEEQAMYTRKFYGE
Sbjct: 59  LFGDDDDDEKESGNENIKSDNSGNSDEESANHRDHHRESLGLDDDEAEEQAMYTRKFYGE 118

Query: 121 DLNDFSDQDEATHTFKEENVELVRHIIPSKGIVNETASHNEIFYARIPNFLTIDPVPFDP 180
           D NDFSDQDEATHTFKEENVELVRHIIPSK  VNETASHNEIFYARIPNFLTIDP+PFDP
Sbjct: 119 DANDFSDQDEATHTFKEENVELVRHIIPSKANVNETASHNEIFYARIPNFLTIDPIPFDP 178

Query: 181 PSFEAKVNERTSNSASKEDQLDDRLIDENTVRWRYSRDKDQHVFKESNTQIVQWSDGTYS 240
           PSFEAKVNER +NS SKEDQLDDRLIDENTVRWRYSRD DQHVFKESNTQIVQWSDG+YS
Sbjct: 179 PSFEAKVNERANNSISKEDQLDDRLIDENTVRWRYSRDNDQHVFKESNTQIVQWSDGSYS 238

Query: 241 LKVGEECTDILVNDTSNTFLTVSHDQQELIQCYEGGEIKKTLMFIPTSTNSKIHQKLSKA 300
           LKVGEE TDILVNDTSNTFLTVSHDQQEL+QCYEGGEIKKTLMFIPTST+SKIHQKLSKA
Sbjct: 239 LKVGEEYTDILVNDTSNTFLTVSHDQQELMQCYEGGEIKKTLMFIPTSTSSKIHQKLSKA 298

Query: 301 VIRRNQRQNKGPGTYIVSMDPEVEKRELEKXXXXXXXXXXXXXXXXXXXXXXPDAAFETG 360
           V+R+NQRQN+GPGTYI++MDPEVEKRELEK                      PD  FET 
Sbjct: 299 VVRKNQRQNQGPGTYIINMDPEVEKRELEKKQSQILRDRRKRQLKEKEKQESPDVGFETA 358

Query: 361 FRKQSSPTAYGTSRRNEYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 420
           FRKQSSPTAYG +RRNEY                                          
Sbjct: 359 FRKQSSPTAYGATRRNEY---------EEDDFLVDDDEEEEAEFDDDDDNEEEEEEEADE 409

Query: 421 XXXXRLRSLKKEGAAMYRQE-ENEDNNETKRRRVAVIEDDEEED 463
               RLR+LK+EGAAMY++E  ++D+NE+KRRRVAVIEDDE+ED
Sbjct: 410 DNAARLRNLKREGAAMYKEEGGDDDSNESKRRRVAVIEDDEDED 453

>Skud_15.285 Chr15 complement(509624..511087) [1464 bp, 487 aa] {ON}
           YOR123C (REAL)
          Length = 487

 Score =  548 bits (1411), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/501 (61%), Positives = 329/501 (65%), Gaps = 54/501 (10%)

Query: 1   MSSEILQDSPQNGQIVGDLDATSNNTSNEKIALTQDFND--------------------- 39
           MSSE      QNG+ V DLD T NN S +K  +TQD ND                     
Sbjct: 1   MSSETPMGETQNGEAVDDLDGTPNNGSIDKTDVTQDDNDYEVSEQDNNDDEVNEQDNYDG 60

Query: 40  -----------------SKEEEDAELDDLFGXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 82
                            +KEEEDAEL                                  
Sbjct: 61  EVNEKDVNDEKVNKRDDTKEEEDAEL----------DDLFGDDDDDDDDEGTKPENSINS 110

Query: 83  XXXXXXXVNHRSRHRESLGLDDDEAEEQAMYTRKFYGEDLNDFSDQDEATHTFKEENVEL 142
                  V+HRSRHRESLGLDDDEAEEQAMYTRKFYGED ND+SDQDEA HTFKEEN+E+
Sbjct: 111 EDSDDEGVDHRSRHRESLGLDDDEAEEQAMYTRKFYGEDANDYSDQDEAAHTFKEENIEI 170

Query: 143 VRHIIPSKGIVNETASHNEIFYARIPNFLTIDPVPFDPPSFEAKVNERTSNSASKEDQLD 202
           VRHIIP+K  VNETASHNEIFYARIPNFLTID VPFDPPSFEAKVNER  NS SKEDQLD
Sbjct: 171 VRHIIPNKANVNETASHNEIFYARIPNFLTIDAVPFDPPSFEAKVNERAINSTSKEDQLD 230

Query: 203 DRLIDENTVRWRYSRDKDQHVFKESNTQIVQWSDGTYSLKVGEECTDILVNDTSNTFLTV 262
           DRLIDENTVRWRYSRDKDQHVFKESNTQIVQWSDG+YSLKVGEECTDILVNDTSNTFLTV
Sbjct: 231 DRLIDENTVRWRYSRDKDQHVFKESNTQIVQWSDGSYSLKVGEECTDILVNDTSNTFLTV 290

Query: 263 SHDQQELIQCYEGGEIKKTLMFIPTSTNSKIHQKLSKAVIRRNQRQNKGPGTYIVSMDPE 322
           SHDQQELIQCYEGGEIKKTLMFIPTSTNSKIHQKLSKAVIRRNQRQNKGPGTYIV+MDPE
Sbjct: 291 SHDQQELIQCYEGGEIKKTLMFIPTSTNSKIHQKLSKAVIRRNQRQNKGPGTYIVNMDPE 350

Query: 323 VEKRELEKXXXXXXXXXXXXXXXXXXXXXXPDAAFETGFRKQSSPTAYGTSRRNEYXXXX 382
           VEK+ELEK                      PDAAFETGFRKQSSPT+YG SRRNEY    
Sbjct: 351 VEKKELEKKQSQVLRDRRRRQLKEREKQESPDAAFETGFRKQSSPTSYGISRRNEY---- 406

Query: 383 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRLRSLKKEGAAMYRQEE- 441
                                                     RLR+LK+EGAAMY++EE 
Sbjct: 407 -EEDDFLVDDDEEEEAGFDDGDDEEEEEEEEEEEEADQENAARLRNLKREGAAMYKEEEK 465

Query: 442 NEDNNETKRRRVAVIEDDEEE 462
           ++D+NETKRRRVAVIEDDE+E
Sbjct: 466 DDDSNETKRRRVAVIEDDEDE 486

>TDEL0D02610 Chr4 (500294..501616) [1323 bp, 440 aa] {ON} Anc_5.440
           YOR123C
          Length = 440

 Score =  366 bits (940), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 191/373 (51%), Positives = 239/373 (64%), Gaps = 12/373 (3%)

Query: 97  RESLGLDDDEAEEQAMYTRKFYGEDLNDFSDQDEATHTFKEENVELVRHIIPSKGIVNET 156
           R  + +DD+EA+E AMYTRKFYGED ++ SDQ+E+ + F EENVELVRHI+P K +    
Sbjct: 73  RGEMQMDDEEAQEHAMYTRKFYGEDADNMSDQEESANHFTEENVELVRHIVPYKTVGEGA 132

Query: 157 ASHNEIFYARIPNFLTIDPVPFDPPSFEAKVNERTSNSASKEDQLDDRLIDENTVRWRYS 216
              + I+YA++P FLTIDPVPFDPPSFE+KV ER  NS+S+EDQL DRLIDENT+RWRYS
Sbjct: 133 DEKSTIYYAKVPEFLTIDPVPFDPPSFESKVKERL-NSSSREDQLGDRLIDENTIRWRYS 191

Query: 217 RDKDQHVFKESNTQIVQWSDGTYSLKVGEECTDILVNDTSNTFLTVSHDQQELIQCYEGG 276
           RD++Q V+KESN QIVQWSDG  SLK+G E TDILVNDT NTF  VSHD+QEL+QC +GG
Sbjct: 192 RDENQQVYKESNAQIVQWSDGGLSLKLGTEYTDILVNDTDNTFFAVSHDEQELMQCSQGG 251

Query: 277 EIKKTLMFIPTSTNSKIHQKLSKAVIRRNQRQNKGPGTYIVSMDPEVEKRELEKXXXXXX 336
           E+ K+LMFIPTSTNSK+HQKL+KAVIRR+QRQ KGPG Y V+ DPE+EK ELEK      
Sbjct: 252 EVTKSLMFIPTSTNSKMHQKLTKAVIRRDQRQTKGPGVYFVNKDPELEKNELEKKQQQVV 311

Query: 337 XXXXXXXXXXXXXXXXPDAAFE-TGFRKQSSPTA------YGTSRRNEYXXXXXXXXXXX 389
                           PD +    G+RK     +      YG+S+RNEY           
Sbjct: 312 RERRKRQLKEIESRNSPDISTGLNGYRKTPVTASDEQDSYYGSSKRNEY----EQDDFLV 367

Query: 390 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRLRSLKKEGAAMYRQEENEDNNETK 449
                                              RLR LK++G   Y + E E +  TK
Sbjct: 368 DDDEEEEAGYSEEDDVLDDNNDDQEAEDEEDAKAERLRQLKRQGTERYTEPEPESDPSTK 427

Query: 450 RRRVAVIEDDEEE 462
           RR+VA+I+D+++E
Sbjct: 428 RRKVAIIDDEDDE 440

>CAGL0K10230g Chr11 complement(996303..997643) [1341 bp, 446 aa]
           {ON} similar to uniprot|P38439 Saccharomyces cerevisiae
           YOR123c LEO1 extremely hydrophilic protein
          Length = 446

 Score =  361 bits (926), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 179/274 (65%), Positives = 211/274 (77%), Gaps = 6/274 (2%)

Query: 107 AEEQAMYTRKFYGEDLNDFSDQDEATHTFKEENVELVRHIIPSKGIVNETASHNEIFYAR 166
           A+EQ MYTRKFYGED  ++SD DE  HTFKE NV+L+RHIIP K        H+EIFYA+
Sbjct: 106 AKEQEMYTRKFYGEDAVNYSDDDEP-HTFKESNVDLIRHIIPYKTRTTNN-EHDEIFYAK 163

Query: 167 IPNFLTIDPVPFDPPSFEAKVNERTSNSASKEDQLDDRLIDENTVRWRYSRDKDQHVFKE 226
           +P FLTIDPVPFDP +FEA V+ER S SASKEDQL DRLIDENT+RWRYSRD +QHVFKE
Sbjct: 164 VPAFLTIDPVPFDPQTFEATVDERLSKSASKEDQLGDRLIDENTIRWRYSRDAEQHVFKE 223

Query: 227 SNTQIVQWSDGTYSLKVGEECTDILVNDTSNTFLTVSHDQQELIQCYEGGEIKKTLMFIP 286
           SN QIVQWSDG++SLK+G+E TDI+VNDT NTFLTVSHDQQEL+QCY+GGEI KT+MFIP
Sbjct: 224 SNAQIVQWSDGSFSLKLGDEYTDIIVNDTDNTFLTVSHDQQELMQCYDGGEITKTMMFIP 283

Query: 287 TSTNSKIHQKLSKAVIRRNQRQNKGPGTYIVSMDPEVEKRELEKXXXXXXXXXXXXXXXX 346
           TSTNSKIHQKLSKAV RRN RQN GPG+YI+  DPE+EK+ELEK                
Sbjct: 284 TSTNSKIHQKLSKAVSRRNARQNLGPGSYIIKQDPEIEKKELEKLQGQIIRERRKRQQKE 343

Query: 347 XXXXXXPDAAF-ETG-FRKQSSPTAYGTSRRNEY 378
                  +  F ETG F++ ++P+   +SR+NEY
Sbjct: 344 IETRENAENGFAETGEFKRGNTPSR--SSRQNEY 375

>SAKL0G02662g Chr7 complement(218969..220408) [1440 bp, 479 aa] {ON}
           similar to uniprot|P38439 Saccharomyces cerevisiae
           YOR123C LEO1 Component of the Paf1 complex which
           associates with RNA polymerase II and is involved in
           histone methylation
          Length = 479

 Score =  350 bits (897), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 187/376 (49%), Positives = 240/376 (63%), Gaps = 13/376 (3%)

Query: 91  NHRSRHRESLGLDDDEAEEQAMYTRKFYGEDLNDFSDQDEATHTFKEENVELVRHIIPSK 150
           NH S+   + G   +E EEQAMY RKFYG+D+++ SD +++   FKE +VE+ +HI+P K
Sbjct: 113 NHLSKSEANHGSYLEEDEEQAMYNRKFYGDDVDNDSDAEDSQREFKEADVEIAKHIVPYK 172

Query: 151 GIVNETASHNEIFYARIPNFLTIDPVPFDPPSFEAKVNERTSNSASKEDQLDDRLIDENT 210
              N  +   E++YA++P FLTIDPVPFDPPSF+  V  R +  +SKEDQLDDRLIDENT
Sbjct: 173 TTSN--SQDKEVYYAKVPQFLTIDPVPFDPPSFKRNVEGRLAQFSSKEDQLDDRLIDENT 230

Query: 211 VRWRYSRDKDQHVFKESNTQIVQWSDGTYSLKVGEECTDILVNDTSNTFLTVSHDQQELI 270
           +RWRYSRD  Q VFKESN QI+QWSDGT+SL++G+E +D+L+NDT NTFLTVSH+QQEL+
Sbjct: 231 IRWRYSRDSKQQVFKESNAQIIQWSDGTFSLRLGDEFSDVLINDTDNTFLTVSHEQQELM 290

Query: 271 QCYEGGEIKKTLMFIPTSTNSKIHQKLSKAVIRRNQRQNKGPGTYIVSMDPEVEKRELEK 330
           QC EGGEI KT+MFIPTST+SKIHQ+LSKAV+RR QR++ GP TYIV  DPE+E+RELEK
Sbjct: 291 QCVEGGEITKTMMFIPTSTSSKIHQRLSKAVVRREQREHLGPNTYIVRKDPELEQRELEK 350

Query: 331 XXXXXXXXXXXXXXXXXXXXXXPDAAFETGFRKQSSPTAYGTSRRNEYXXXXXXXXXXXX 390
                                  D+    G RK S+ +++G  RRNEY            
Sbjct: 351 KQDQIVRERRKRQLKEQLEKENRDSVEPLGVRK-SATSSFGVGRRNEY------EEDDFL 403

Query: 391 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRLRSLKKEGAAMYRQEENEDNNET-- 448
                                             RLR LK+EGAA Y Q++ E  +E   
Sbjct: 404 VDDEEEEEEGGISGEEEEEAEEEDDDDEDDLNAERLRQLKREGAAQYEQKDEESGSEESS 463

Query: 449 -KRRRVAVIEDDEEED 463
            KRR++AV+ DDEEED
Sbjct: 464 HKRRKIAVL-DDEEED 478

>NCAS0H02080 Chr8 complement(404035..405342) [1308 bp, 435 aa] {ON}
           Anc_5.440 YOR123C
          Length = 435

 Score =  343 bits (881), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 189/365 (51%), Positives = 236/365 (64%), Gaps = 19/365 (5%)

Query: 108 EEQAMYTRKFYGED-LNDFS-DQDEATHTFKEENVELVRHIIPSKGIVNETASHNEIFYA 165
           EE+AMYTRKFYG+D  N +S DQD A H FKEENVEL+RH++P K   +E      ++YA
Sbjct: 81  EEEAMYTRKFYGDDDYNRYSSDQDNALHHFKEENVELIRHMVPYK-TSSEKTDETTVYYA 139

Query: 166 RIPNFLTIDPVPFDPPSFEAKVNERTSNSASKEDQLDDRLIDENTVRWRYSRDKDQHVFK 225
           ++P FLTI+PVPFDP +FE+ V +R SN +SKEDQL DRLIDENTVRWRYSRD +Q VFK
Sbjct: 140 KVPPFLTINPVPFDPIAFESDVRDRLSNYSSKEDQLGDRLIDENTVRWRYSRDANQRVFK 199

Query: 226 ESNTQIVQWSDGTYSLKVGEECTDILVNDTSNTFLTVSHDQQELIQCYEGGEIKKTLMFI 285
           ESN QIVQWSDG++SLK+G+E TDILVN+T+NTFL VSHDQQEL+QCY GGEI KTLMFI
Sbjct: 200 ESNAQIVQWSDGSFSLKLGDEYTDILVNETNNTFLAVSHDQQELMQCYNGGEITKTLMFI 259

Query: 286 PTSTNSKIHQKLSKAVIRRNQRQNKGPGTYIVSMDPEVEKRELEKXXXXXXXXXXXXXXX 345
           PTSTNSKIHQ+LSKAV RRNQR++ GPGT I++ DPEVEKRELEK               
Sbjct: 260 PTSTNSKIHQQLSKAVTRRNQREHLGPGTMIINRDPEVEKRELEKKQGQIIRDRRRRQLK 319

Query: 346 XXXXXXXPDAAFET--GF--RKQSSPT-AYGTSRRNEYXXXXXXXXXXXXXXXXXXXXXX 400
                  PD   +   G+  RK+++P  + G+ R++EY                      
Sbjct: 320 EKELLESPDTTMDVSGGYETRKRNTPNPSLGSRRQDEY---------EEDDFLVDDEDEE 370

Query: 401 XXXXXXXXXXXXXXXXXXXXXXXXRLRSLKKEGAAMYRQEENEDN--NETKRRRVAVIED 458
                                   RLR+ K+ G     QE   +N  + +K+RRVAVI D
Sbjct: 371 DFIEDDEEEEEEEEEEDNDEEKAERLRNAKRSGYDEDNQESGTENESSSSKKRRVAVIND 430

Query: 459 DEEED 463
           DE+++
Sbjct: 431 DEDDE 435

>ZYRO0F10164g Chr6 complement(821488..822759) [1272 bp, 423 aa] {ON}
           similar to uniprot|P38439 Saccharomyces cerevisiae
           YOR123C LEO1 Component of the Paf1 complex which
           associates with RNA polymerase II and is involved in
           histone methylation
          Length = 423

 Score =  340 bits (872), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 192/369 (52%), Positives = 228/369 (61%), Gaps = 22/369 (5%)

Query: 95  RHRESLGLDDDEAEEQAMYTRKFYGEDLNDFSDQDEATHTFKEENVELVRHIIPSKGIVN 154
           RHR+ +  DD+EAEE AMYTRKFYGED++  SD++EA    +EE+VELVRHI+P +    
Sbjct: 76  RHRQEM--DDEEAEEHAMYTRKFYGEDVDRVSDEEEAQEF-REEDVELVRHIVPYRA--T 130

Query: 155 ETASHNEIFYARIPNFLTIDPVPFDPPSFEAKVNERTSNSASKEDQLDDRLIDENTVRWR 214
           +      ++YA+IP FLTIDPVPFDPPSFEA V ER  N ASKEDQL DRLIDENTVRWR
Sbjct: 131 QGTDKPVLYYAKIPEFLTIDPVPFDPPSFEASVKERLGNKASKEDQLGDRLIDENTVRWR 190

Query: 215 YSRDKDQHVFKESNTQIVQWSDGTYSLKVGEECTDILVNDTSNTFLTVSHDQQELIQCYE 274
           YSRD +Q VFKESN QIVQWSDGT+SLK+G+E TDIL NDT NTF  VSHDQQEL+QCYE
Sbjct: 191 YSRDANQQVFKESNAQIVQWSDGTFSLKLGDEYTDILSNDTDNTFFAVSHDQQELMQCYE 250

Query: 275 GGEIKKTLMFIPTSTNSKIHQKLSKAVIRRNQRQNKGPGTYIVSMDPEVEKRELE-KXXX 333
           GGE+ KTLMFIPTST+S++HQKL+KAV+RR+ +Q  GPGTYIV  DPE+E+ ELE K   
Sbjct: 251 GGEVTKTLMFIPTSTSSRMHQKLTKAVMRRDHKQAAGPGTYIVQKDPELERGELEKKQQQ 310

Query: 334 XXXXXXXXXXXXXXXXXXXPDAAFETGFRKQSSPTAYGTSRRNEYXXXXXXXXXXXXXXX 393
                               D         ++ P   G  RRNEY               
Sbjct: 311 VVRERRRRQVKEMESREASGDPDRRAAISAEAEPM--GNIRRNEYEQDDFLVDDDDEEEY 368

Query: 394 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRLRSLKKEGAAMYRQEENEDNNETKRRRV 453
                                          RLR LK+EGA  Y         E KRRRV
Sbjct: 369 ASGSGEEGEEEEEEDEGNVSDEGAE------RLRRLKREGANNY--------EERKRRRV 414

Query: 454 AVIEDDEEE 462
           AVI+D+E+E
Sbjct: 415 AVIDDEEDE 423

>KNAG0B04210 Chr2 (801346..802737) [1392 bp, 463 aa] {ON} Anc_5.440
           YOR123C
          Length = 463

 Score =  340 bits (872), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 170/285 (59%), Positives = 202/285 (70%), Gaps = 6/285 (2%)

Query: 90  VNHRSRHRESLGLDDDEAEEQAMYTRKFYGEDLNDFSDQDEATHTFKEENVELVRHIIPS 149
           V   S  R+ L +D    EE+ MY RKFYGED+ D SD ++A H FKE NVELV+HI+P 
Sbjct: 84  VTGSSPRRKRLDMD----EEEEMYNRKFYGEDV-DMSDTEQAEHEFKEANVELVKHIVPY 138

Query: 150 KGIVNETASHNEIFYARIPNFLTIDPVPFDPPSFEAKVNERTSNSASKEDQLDDRLIDEN 209
           K + ++    N+I+ A++P FL IDP PFDP SFE KV +R   S SKED+L DRLIDEN
Sbjct: 139 KLVPDDAIGTNDIYVAKVPPFLMIDPAPFDPTSFEGKVADRLDGSLSKEDRLGDRLIDEN 198

Query: 210 TVRWRYSRDKDQHVFKESNTQIVQWSDGTYSLKVGEECTDILVNDTSNTFLTVSHDQQEL 269
           TVRWRYSRD +Q VFKESNTQIVQWSDG+YSLK+G E TDIL+NDT NTFLTVSHDQQEL
Sbjct: 199 TVRWRYSRDTNQSVFKESNTQIVQWSDGSYSLKLGNEYTDILINDTDNTFLTVSHDQQEL 258

Query: 270 IQCYEGGEIKKTLMFIPTSTNSKIHQKLSKAVIRRNQRQNKGPGTYIVSMDPEVEKRELE 329
           +QC EGG + KTLMFIPTST+SKIHQKLSKAV RRN  Q+ GPGTYIVS+DPE+EK+ELE
Sbjct: 259 MQCVEGGLVNKTLMFIPTSTSSKIHQKLSKAVARRNVMQSAGPGTYIVSVDPEIEKKELE 318

Query: 330 KXXXXXXXXXXXXXXXXXXXXXXPDAAFETGFRKQSSPTAYGTSR 374
           +                      PD     G R  S+ + +GT R
Sbjct: 319 RKQGQIFKERRRRQLREKELAESPDTTI-GGPRSGSAGSWHGTPR 362

>NDAI0C01590 Chr3 complement(340050..341462) [1413 bp, 470 aa] {ON}
           Anc_5.440 YOR123C
          Length = 470

 Score =  334 bits (856), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 183/365 (50%), Positives = 233/365 (63%), Gaps = 16/365 (4%)

Query: 105 DEAEEQAMYTRKFYGEDLNDFSDQDEATHTFKEENVELVRHIIPSKGIVNETASHNEIFY 164
           D  +E+AMYTRKFYG D + +SD +E  H FKE NVE++RH++P K   +   +   I+Y
Sbjct: 114 DMDDEEAMYTRKFYG-DTDKYSDNEEDAHDFKEANVEIIRHMVPYK--TSSDQADTTIYY 170

Query: 165 ARIPNFLTIDPVPFDPPSFEAKVNERTSNSASKEDQLDDRLIDENTVRWRYSRDKDQHVF 224
           A++P FLTIDP+PFDP SFE KV +R ++ +S+EDQL DRLIDENT+RWRYSRD++Q VF
Sbjct: 171 AKVPPFLTIDPIPFDPVSFETKVKDRLADYSSREDQLGDRLIDENTIRWRYSRDQNQRVF 230

Query: 225 KESNTQIVQWSDGTYSLKVGEECTDILVNDTSNTFLTVSHDQQELIQCYEGGEIKKTLMF 284
           KESN QIVQWSDG++SLK+G+E TDILVNDT NTFLTVSHDQQEL+QCY GGEI KT+MF
Sbjct: 231 KESNAQIVQWSDGSFSLKLGDEYTDILVNDTDNTFLTVSHDQQELMQCYNGGEITKTMMF 290

Query: 285 IPTSTNSKIHQKLSKAVIRRNQRQNKGPGTYIVSMDPEVEKRELEKXXXXXXXXXXXXXX 344
           IPTSTNSKIHQ+LSKAV RRNQRQN GPGT I+  DPE+EK+ELEK              
Sbjct: 291 IPTSTNSKIHQQLSKAVTRRNQRQNLGPGTMIIEKDPELEKKELEKKQGQILRERRKRQL 350

Query: 345 XXXXXXXXPDAAFE-----TGFRKQSSPTAYGTSRRNEYXXXXXXXXXXXXXXXXXXXXX 399
                   PD  F+     +   +  +P++Y  SR++EY                     
Sbjct: 351 KEREIQESPDTTFDVRGSASSKNRSPAPSSYRGSRQDEY------EEDDFLVDDDEEEEF 404

Query: 400 XXXXXXXXXXXXXXXXXXXXXXXXXRLRSLKKEGAAMY--RQEENEDNNETKRRRVAVIE 457
                                    RL+ +KK GA  Y  R+E + +   +KRR+VAV+ 
Sbjct: 405 VGDEDEEEEEEEEEEEEDEDDRKAKRLKEIKKGGAQEYADREESDMEEGSSKRRKVAVLS 464

Query: 458 DDEEE 462
           DDEE+
Sbjct: 465 DDEED 469

>KAFR0D05050 Chr4 complement(993511..994770) [1260 bp, 419 aa] {ON}
           Anc_5.440 YOR123C
          Length = 419

 Score =  330 bits (847), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 183/359 (50%), Positives = 221/359 (61%), Gaps = 9/359 (2%)

Query: 108 EEQAMYTRKFYGEDLNDFSDQDEATHTFKEENVELVRHIIPSKGIVNETASHNEIFYARI 167
           EE+AMY RKFYGE+ +D SD +E    FKE +VELVRH++P K    E      I+Y ++
Sbjct: 67  EEEAMYNRKFYGEEGSDMSDHEEEA-LFKEADVELVRHVVPYK-TFPENEDDKTIYYTKV 124

Query: 168 PNFLTIDPVPFDPPSFEAKVNERTSNSASKEDQLDDRLIDENTVRWRYSRDKDQHVFKES 227
           P FL+IDP+PFDPPSFE KV ERTSN +S EDQL DRLIDENT+RWRYSRD +Q VFKES
Sbjct: 125 PAFLSIDPLPFDPPSFENKVKERTSNFSSVEDQLGDRLIDENTIRWRYSRDAEQRVFKES 184

Query: 228 NTQIVQWSDGTYSLKVGEECTDILVNDTSNTFLTVSHDQQELIQCYEGGEIKKTLMFIPT 287
           N QIVQWSDG+YSLK+G E TDILVN T NTFLTVSHDQQEL+QC +GG+I KTL+FIPT
Sbjct: 185 NAQIVQWSDGSYSLKLGAEYTDILVNGTDNTFLTVSHDQQELMQCVDGGQINKTLIFIPT 244

Query: 288 STNSKIHQKLSKAVIRRNQRQNKGPGTYIVSMDPEVEKRELEKXXXXXXXXXXXXXXXXX 347
           STNSKIHQ+LSKA+ RR+QR + GPGT IV++DPEVEKRELEK                 
Sbjct: 245 STNSKIHQRLSKAIARRDQRVHSGPGTMIVNLDPEVEKRELEKKQTQIIRERRRRQMKEQ 304

Query: 348 XXXXXPD-AAFETGFRKQSSPT-AY-GTSRRNEYXXXXXXXXXXXXXXXXXXXXXXXXXX 404
                P+  AF    R+  +P+  Y  T R +EY                          
Sbjct: 305 ERLESPELGAFSHSNRRSQTPSQGYERTHREDEY--EEDDFLVDDDEEDESVELESGADE 362

Query: 405 XXXXXXXXXXXXXXXXXXXXRLRSLKKEGAAMYRQEENEDNNETKRRRVAVIEDDEEED 463
                               RL+ +K+    +   EE  D N  KRR+  VI DDE+ED
Sbjct: 363 EDDEEEEEAQFSDEDEARAERLKEMKRSNKVVI--EEENDENSPKRRKGPVISDDEDED 419

>Kpol_1062.26 s1062 (58970..60343) [1374 bp, 457 aa] {ON}
           (58970..60343) [1374 nt, 458 aa]
          Length = 457

 Score =  330 bits (846), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 180/376 (47%), Positives = 232/376 (61%), Gaps = 18/376 (4%)

Query: 102 LDDDEAEEQAMYTRKFYGEDLNDFSDQDEATHTFKEENVELVRHIIPSKGIVNETASHNE 161
           +D+DE EEQAMYTRKFYGED  D SDQ+E  H F+EE+V L RH++P+K    E  +   
Sbjct: 85  VDEDEDEEQAMYTRKFYGEDDYDKSDQEEDKHEFREEDVVLTRHVVPTKITSEENDADTT 144

Query: 162 IFYARIPNFLTIDPVPFDPPSFEAKVNERTSNSASKEDQLDDRLIDENTVRWRYSRDKDQ 221
           I+YA++P FLTIDP+PFDPP+FE  V ER +N  SKE+QL+DRLID+NT+RWRYSRD +Q
Sbjct: 145 IYYAKVPPFLTIDPIPFDPPTFENVVRERLTNGLSKEEQLEDRLIDQNTIRWRYSRDDNQ 204

Query: 222 HVFKESNTQIVQWSDGTYSLKVGEECTDILVNDTSNTFLTVSHDQQELIQCYEGGEIKKT 281
            VFKESN  IVQWSDG+YSLK+G+E TDIL+NDT NTFLTVSHDQQEL+QC  GGEI K+
Sbjct: 205 RVFKESNATIVQWSDGSYSLKLGDEYTDILLNDTDNTFLTVSHDQQELMQCVHGGEISKS 264

Query: 282 LMFIPTSTNSKIHQKLSKAVIRRNQRQNKGPGTYIVSMDPEVEKRELEKXXXXXXXXXXX 341
           L+F+P ST SK+HQ+LSKA++RRN  +  GP + IV++DPE+EK+ELEK           
Sbjct: 265 LLFVPISTTSKLHQRLSKAIVRRNATETMGPRSMIVNIDPELEKKELEKKQSQVFRERRK 324

Query: 342 XXXXXXXXXXXPDAAFETGF---------RKQSSPTAYGTSRRNEYXX------XXXXXX 386
                       +    TGF         ++ ++P +YG SRR+EY              
Sbjct: 325 KKQKEIEALESLET---TGFGNNSYSASRKRSTTPMSYGGSRRDEYEEDDFIVDDEEEEP 381

Query: 387 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRLRSLKKEGAAMYRQEENEDNN 446
                                                 RLR LK++G A Y  +E   + 
Sbjct: 382 EYAGEEDDDDLDGFEEEEEEQEEEEEGEDEDADEKRAERLRELKRQGTAAYNDDEKSGSE 441

Query: 447 ETKRRRVAVIEDDEEE 462
             KRR+VAVIEDDE++
Sbjct: 442 SPKRRKVAVIEDDEDD 457

>Kwal_55.21408 s55 (823660..824970) [1311 bp, 436 aa] {ON} YOR123C
           (LEO1) - Product of gene unknown [contig 130] FULL
          Length = 436

 Score =  310 bits (794), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 161/362 (44%), Positives = 221/362 (61%), Gaps = 15/362 (4%)

Query: 110 QAMYTRKFYGEDLNDFSDQDEATHTFKEENVELVRHIIPSKGIVNETASHNEIFYARIPN 169
           QAMY RKFYG++  D +D+  +   F+E +V++V+H++P   + +E      IFYA++P 
Sbjct: 81  QAMYNRKFYGDNAEDSNDEG-SQREFREADVDVVKHVVPYSTVPSE--GDKTIFYAKVPQ 137

Query: 170 FLTIDPVPFDPPSFEAKVNERTSNSASKEDQLDDRLIDENTVRWRYSRDKDQHVFKESNT 229
           FLTIDP+PFDPP+F+ K+ +RT+  +S EDQ+DDRLI+ENTVRWRYSRD  Q VFKESN 
Sbjct: 138 FLTIDPIPFDPPAFQNKIEQRTAQLSSTEDQIDDRLIEENTVRWRYSRDSKQQVFKESNA 197

Query: 230 QIVQWSDGTYSLKVGEECTDILVNDTSNTFLTVSHDQQELIQCYEGGEIKKTLMFIPTST 289
           QIVQWSDGT+SL++G+E TD+L+NDT +T+LTVSHDQQELIQ  +GGE+ K ++FIPTST
Sbjct: 198 QIVQWSDGTFSLRLGDEFTDVLINDTEDTYLTVSHDQQELIQSVKGGEVTKNMIFIPTST 257

Query: 290 NSKIHQKLSKAVIRRNQRQNKGPGTYIVSMDPEVEKRELEKXXXXXXXXXXXXXXXXXXX 349
           NSK HQ+LSKAV R+ QR++ GP TYI+ +DPE+E++ELEK                   
Sbjct: 258 NSKSHQRLSKAVARKEQREHHGPNTYILRVDPELEQKELEKKQGQIIRERRKRQLREQQE 317

Query: 350 XXXPDAAFETGFRKQSSPTAYGTSRRNEYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 409
               D+       K +S   Y  SR +EY                               
Sbjct: 318 REGLDSPAPAAKPKSTSSLGYSQSRYDEY---EDDGFMVDDENNETGEDDEGEDDEDDLL 374

Query: 410 XXXXXXXXXXXXXXXRLRSLKKEGAAMYRQEENEDNN---------ETKRRRVAVIEDDE 460
                          RLR LK+ GA+ YR E +ED++           KRR+VAV++D++
Sbjct: 375 DDNNEEEEDDDLNAERLRQLKRSGASQYRSEGSEDDHVADEEPQDSTLKRRKVAVLDDED 434

Query: 461 EE 462
           +E
Sbjct: 435 DE 436

>KLLA0E02311g Chr5 complement(214032..215285) [1254 bp, 417 aa] {ON}
           similar to uniprot|P38439 Saccharomyces cerevisiae
           YOR123C LEO1 Component of the Paf1 complex which
           associates with RNA polymerase II and is involved in
           histone methylation
          Length = 417

 Score =  306 bits (784), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 151/237 (63%), Positives = 185/237 (78%), Gaps = 6/237 (2%)

Query: 94  SRHRESLGLDDDEAEEQAMYTRKFYGEDLNDFSDQDEATHTFKEENVELVRHIIPSKGIV 153
           S HR    +DD+E EEQAMY RKF GED    S+++      KE +VE+V+H++P K   
Sbjct: 57  SHHR---VIDDEEDEEQAMYNRKFLGEDYEGQSEEEYEKKY-KEVDVEIVKHVVPYK--T 110

Query: 154 NETASHNEIFYARIPNFLTIDPVPFDPPSFEAKVNERTSNSASKEDQLDDRLIDENTVRW 213
              A    I+YA++P FLTIDPVPFDPPSF+ KV +R S  +SKEDQL DRLI+ENT+RW
Sbjct: 111 ANGADDKTIYYAKVPQFLTIDPVPFDPPSFQKKVEDRVSKYSSKEDQLGDRLIEENTIRW 170

Query: 214 RYSRDKDQHVFKESNTQIVQWSDGTYSLKVGEECTDILVNDTSNTFLTVSHDQQELIQCY 273
           RYSRDKD+ VFKESN QIV+WSDGT+SLKVG+E TDILVN+T NT+LTVSH++QELIQC 
Sbjct: 171 RYSRDKDERVFKESNAQIVEWSDGTFSLKVGDEYTDILVNNTENTYLTVSHEEQELIQCV 230

Query: 274 EGGEIKKTLMFIPTSTNSKIHQKLSKAVIRRNQRQNKGPGTYIVSMDPEVEKRELEK 330
           EGGEI K++MF+PTSTNSK+H+ LSKAV RR++R   GP TYI   DPE+EKRELEK
Sbjct: 231 EGGEITKSMMFVPTSTNSKVHKILSKAVARRDERGQHGPNTYITRTDPELEKRELEK 287

>KLTH0F15928g Chr6 (1295609..1296880) [1272 bp, 423 aa] {ON} similar
           to uniprot|P38439 Saccharomyces cerevisiae YOR123C LEO1
           Component of the Paf1 complex which associates with RNA
           polymerase II and is involved in histone methylation
          Length = 423

 Score =  306 bits (783), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 159/368 (43%), Positives = 221/368 (60%), Gaps = 15/368 (4%)

Query: 104 DDEAEEQAMYTRKFYGEDLNDFSDQDEATHTFKEENVELVRHIIPSKGIVNETASHNEIF 163
           ++E +EQAMY RKFYG+   D +D  E +  F+E ++++++HI+P       +     I+
Sbjct: 62  EEEDDEQAMYNRKFYGDKGEDSND--EGSQEFREADIDIMKHIVPYS--TEPSQGDKTIY 117

Query: 164 YARIPNFLTIDPVPFDPPSFEAKVNERTSNSASKEDQLDDRLIDENTVRWRYSRDKDQHV 223
           Y ++P FLTIDP+PFDPP+F++K+ ER +   S EDQ+DDRLI+ENTVRWRYSRDK+Q V
Sbjct: 118 YTKVPQFLTIDPIPFDPPAFQSKIEERAAQRTSVEDQIDDRLIEENTVRWRYSRDKNQRV 177

Query: 224 FKESNTQIVQWSDGTYSLKVGEECTDILVNDTSNTFLTVSHDQQELIQCYEGGEIKKTLM 283
           FKESN  IVQWSDGTYSL++G+E TD+L+NDT +T+L VSHDQQELIQ  +GGE+ K ++
Sbjct: 178 FKESNAHIVQWSDGTYSLRLGDEYTDVLINDTEDTYLAVSHDQQELIQSVKGGEVTKNMI 237

Query: 284 FIPTSTNSKIHQKLSKAVIRRNQRQNKGPGTYIVSMDPEVEKRELEKXXXXXXXXXXXXX 343
           FIPTSTNSK HQ+LSKAV R+ Q+++ GP TYI+ +DPE+E++ELEK             
Sbjct: 238 FIPTSTNSKSHQRLSKAVARKEQQEHHGPNTYILRVDPELEQKELEKKQGQIIRERRKRQ 297

Query: 344 XXXXXXXXXPDAAFETGFRKQSSPTAYGTSRRNEYXXXXXXXXXXXXXXXXXXXXXXXXX 403
                     D+   T   + +S   Y  +R +EY                         
Sbjct: 298 LREQQEREGMDSPAPTSKPRSASRPGYSQTRYDEY--EDDGFMVDDEENESDGGVGGDGN 355

Query: 404 XXXXXXXXXXXXXXXXXXXXXRLRSLKKEGAAMYRQEENEDNN---------ETKRRRVA 454
                                RLR LK++GAA Y  +E  DNN           KRR+VA
Sbjct: 356 EDEEDLLDDEEEEDDDDLNAERLRQLKRKGAAQYNTQEASDNNVESDDAEDSAMKRRKVA 415

Query: 455 VIEDDEEE 462
           V++D+++E
Sbjct: 416 VLDDEDDE 423

>TPHA0E01730 Chr5 (350455..351864) [1410 bp, 469 aa] {ON} Anc_5.440
           YOR123C
          Length = 469

 Score =  302 bits (774), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 140/228 (61%), Positives = 180/228 (78%), Gaps = 9/228 (3%)

Query: 102 LDDDEAEEQAMYTRKFYG-EDLNDFSDQDEATHTFKEENVELVRHIIPSKGI-------V 153
           +D+DE EE AMYTRKFYG ED+N + D+DE  H FKE +VELVRHI+P K +        
Sbjct: 104 MDEDEDEEHAMYTRKFYGDEDVNKY-DEDENMHEFKEADVELVRHIVPYKILEQKNDNSK 162

Query: 154 NETASHNEIFYARIPNFLTIDPVPFDPPSFEAKVNERTSNSASKEDQLDDRLIDENTVRW 213
           ++  S N  +YARIP FLTIDPVPFDPP FE++V ER  N+ + +D++ DRLIDENT+RW
Sbjct: 163 DDATSKNSTYYARIPPFLTIDPVPFDPPQFESEVKERLENTTNVKDRIGDRLIDENTIRW 222

Query: 214 RYSRDKDQHVFKESNTQIVQWSDGTYSLKVGEECTDILVNDTSNTFLTVSHDQQELIQCY 273
           RYSRD +Q VFKESN QI+QWSDG+YSLK+G++ TD+LVND SNTFLTVSHDQQEL+QC 
Sbjct: 223 RYSRDANQTVFKESNAQIIQWSDGSYSLKLGDDYTDLLVNDISNTFLTVSHDQQELMQCV 282

Query: 274 EGGEIKKTLMFIPTSTNSKIHQKLSKAVIRRNQRQNKGPGTYIVSMDP 321
           +GGEI K+ MF+P STNS++HQ+LSKA+ RR+Q   + P + I+++DP
Sbjct: 283 DGGEISKSAMFVPISTNSRLHQRLSKAIARRDQNSTESPRSMIINVDP 330

>ACL167C Chr3 complement(63134..64453) [1320 bp, 439 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR123C
           (LEO1)
          Length = 439

 Score =  295 bits (754), Expect = 6e-95,   Method: Compositional matrix adjust.
 Identities = 136/234 (58%), Positives = 180/234 (76%), Gaps = 7/234 (2%)

Query: 101 GLDDDEAEEQAMYTRKFYGEDL---NDFSDQDEATHTFKEENVELVRHIIPSKGIVNETA 157
           GL  ++ EEQ MY RKFYG+DL   +D SD+DEA    KE ++ELV+H++P   + N+  
Sbjct: 73  GLGAEDNEEQEMYNRKFYGDDLQQASDLSDEDEA-REIKEADLELVKHVVPL--LYNKPL 129

Query: 158 SHNEI-FYARIPNFLTIDPVPFDPPSFEAKVNERTSNSASKEDQLDDRLIDENTVRWRYS 216
               + +Y ++P FLTIDPVPFDPPSF+ ++ +R +  +SKEDQL D LIDENT+RWRYS
Sbjct: 130 EGKRLLYYTKVPQFLTIDPVPFDPPSFQGQIEKRMARFSSKEDQLGDSLIDENTIRWRYS 189

Query: 217 RDKDQHVFKESNTQIVQWSDGTYSLKVGEECTDILVNDTSNTFLTVSHDQQELIQCYEGG 276
           R  DQ VFKESN Q+++WSDGT SLK+G+E TDIL N+  NT+LTVSH+QQE++QC EGG
Sbjct: 190 RGSDQRVFKESNAQVIEWSDGTLSLKLGDEYTDILTNEIENTYLTVSHEQQEIMQCVEGG 249

Query: 277 EIKKTLMFIPTSTNSKIHQKLSKAVIRRNQRQNKGPGTYIVSMDPEVEKRELEK 330
            I  +++FIPTSTNSKIH++L+KA+ RR  R++ GP TYIV  DPE+EKREL+K
Sbjct: 250 TISNSMLFIPTSTNSKIHKRLTKAIARREAREHSGPSTYIVRKDPELEKRELQK 303

>Ecym_4511 Chr4 complement(1020312..1021697) [1386 bp, 461 aa] {ON}
           similar to Ashbya gossypii ACL167C
          Length = 461

 Score =  290 bits (741), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 130/225 (57%), Positives = 173/225 (76%), Gaps = 4/225 (1%)

Query: 99  SLGLDDDEAEEQAMYTRKFYGEDLNDFSDQD--EATHTFKEENVELVRHIIPSKGIVNET 156
            LGL D+E +EQ MY RKFYG+DL   S +   E     KE NV++++H++P     N +
Sbjct: 77  GLGLSDEE-DEQEMYNRKFYGDDLKKTSYESDVEEEREIKEANVQIMKHVVPYY-TTNAS 134

Query: 157 ASHNEIFYARIPNFLTIDPVPFDPPSFEAKVNERTSNSASKEDQLDDRLIDENTVRWRYS 216
              + ++YA++P FLTIDP+PFDPP F++++ +R    +SKEDQL DRLIDENT+RWRYS
Sbjct: 135 EKDSSLYYAKVPQFLTIDPIPFDPPGFQSQIEQRLKRFSSKEDQLGDRLIDENTIRWRYS 194

Query: 217 RDKDQHVFKESNTQIVQWSDGTYSLKVGEECTDILVNDTSNTFLTVSHDQQELIQCYEGG 276
           R  +Q VFKESN QI+QWSDGT+SLK+G+E +DIL+ND  NT++TVSH+Q+EL+QC EGG
Sbjct: 195 RGANQQVFKESNAQIIQWSDGTFSLKLGDEFSDILINDIENTYMTVSHEQEELMQCVEGG 254

Query: 277 EIKKTLMFIPTSTNSKIHQKLSKAVIRRNQRQNKGPGTYIVSMDP 321
           EIKK+++FIPTSTNSK HQ+LS A+ RR  R++ GP TYIV MDP
Sbjct: 255 EIKKSMLFIPTSTNSKTHQRLSAAIARREAREHSGPSTYIVRMDP 299

 Score = 32.3 bits (72), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 27/53 (50%), Gaps = 16/53 (30%)

Query: 425 RLRSLKKEGAAMYRQ----------------EENEDNNETKRRRVAVIEDDEE 461
           RL+ LK EGAA Y+                  EN D +  KRR+VAV++ D+E
Sbjct: 409 RLKQLKIEGAARYQHGSTTTTSPSDLDTKQDPENNDGSAPKRRKVAVLDSDDE 461

>TBLA0A06490 Chr1 (1595241..1596527) [1287 bp, 428 aa] {ON}
           Anc_5.440 YOR123C
          Length = 428

 Score =  279 bits (714), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 134/244 (54%), Positives = 181/244 (74%), Gaps = 8/244 (3%)

Query: 91  NHRSRHRESLGLDDDEAEEQAMYTRKFYGEDLNDFSDQDEATHTFKEENVELVRHIIPSK 150
           N RS + E+     D+ +++AMY +KFYGED  + SD D+  + +KE ++ELVRHI+P K
Sbjct: 41  NRRSEYDEN----SDDEQDKAMYEKKFYGEDGFNRSDDDDNEYEYKESDIELVRHIVPYK 96

Query: 151 GIVN--ETASHNEIFYARIPNFLTIDPVPFDPPSFEAKVNERTSNSASKEDQLDDRLIDE 208
              +  E   H E++YA++P FL +DPVPFD  +FE+ V ER  NS +++ Q+ DRL DE
Sbjct: 97  TRPSNKELDKHRELYYAKVPPFLMVDPVPFDSTNFESAVKERIKNSLNEDTQITDRLRDE 156

Query: 209 NTVRWRYSRDKDQH--VFKESNTQIVQWSDGTYSLKVGEECTDILVNDTSNTFLTVSHDQ 266
           NT+RWRYSRD + +  VFK+SN QI+QWSDG+YSLK+G + TDIL N+T N FLTVSHDQ
Sbjct: 157 NTIRWRYSRDSNDNDKVFKQSNAQIIQWSDGSYSLKLGNDYTDILTNETDNIFLTVSHDQ 216

Query: 267 QELIQCYEGGEIKKTLMFIPTSTNSKIHQKLSKAVIRRNQRQNKGPGTYIVSMDPEVEKR 326
           QEL+QCY GGEI KTLMFIP+ST SKIHQ+L+ AV  R+++   GPG  +++ DPE+EK+
Sbjct: 217 QELMQCYNGGEITKTLMFIPSSTKSKIHQRLTAAVQNRDKKTTSGPGMMLINTDPEIEKK 276

Query: 327 ELEK 330
            LEK
Sbjct: 277 LLEK 280

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.310    0.128    0.355 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 43,103,271
Number of extensions: 1818207
Number of successful extensions: 8469
Number of sequences better than 10.0: 37
Number of HSP's gapped: 8606
Number of HSP's successfully gapped: 60
Length of query: 463
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 350
Effective length of database: 40,524,141
Effective search space: 14183449350
Effective search space used: 14183449350
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 67 (30.4 bits)