Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_15.2995.439ON1261266655e-91
YOR122C (PFY1)5.439ON1261266655e-91
Suva_8.1745.439ON1261266542e-89
Skud_15.2845.439ON1261266533e-89
CAGL0I01078g5.439ON1261266333e-86
KAFR0D050405.439ON1261266255e-85
NDAI0C015805.439ON1261266239e-85
TDEL0D026205.439ON1261266179e-84
KNAG0B042205.439ON1261266161e-83
SAKL0G02640g5.439ON1261266134e-83
NCAS0H020705.439ON1261265978e-81
TPHA0E017405.439ON1261265892e-79
Kpol_1062.275.439ON1261265804e-78
KLTH0F15950g5.439ON1261265771e-77
Ecym_45105.439ON1261265752e-77
ACL168C5.439ON1261265752e-77
KLLA0E02289g5.439ON1261265743e-77
ZYRO0F10142g5.439ON1261265682e-76
TBLA0A065005.439ON1191265587e-75
Kwal_55.214135.439ON58582664e-31
ZYRO0F02574g8.17ON63047671.2
Suva_13.2102.604ON34471615.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_15.299
         (126 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_15.299 Chr15 complement(513420..513787,513992..514004) [381...   260   5e-91
YOR122C Chr15 complement(552298..552665,552875..552887) [381 bp,...   260   5e-91
Suva_8.174 Chr8 complement(310093..310460,310663..310675) [381 b...   256   2e-89
Skud_15.284 Chr15 complement(508731..509098,509302..509314) [381...   256   3e-89
CAGL0I01078g Chr9 (90566..90578,91000..91367) [381 bp, 126 aa] {...   248   3e-86
KAFR0D05040 Chr4 complement(992821..993188,993288..993300) [381 ...   245   5e-85
NDAI0C01580 Chr3 complement(339182..339549,339677..339689) [381 ...   244   9e-85
TDEL0D02620 Chr4 (501856..501868,501937..502304) [381 bp, 126 aa...   242   9e-84
KNAG0B04220 Chr2 (803026..803038,803229..803596) [381 bp, 126 aa...   241   1e-83
SAKL0G02640g Chr7 complement(217953..218320,218467..218479) [381...   240   4e-83
NCAS0H02070 Chr8 complement(403286..403653,403777..403789) [381 ...   234   8e-81
TPHA0E01740 Chr5 (352358..352370,352454..352821) [381 bp, 126 aa...   231   2e-79
Kpol_1062.27 s1062 (61009..61021,61207..61574) [381 bp, 126 aa] ...   228   4e-78
KLTH0F15950g Chr6 (1297129..1297141,1297227..1297594) [381 bp, 1...   226   1e-77
Ecym_4510 Chr4 complement(1019247..1019614,1019714..1019726) [38...   226   2e-77
ACL168C Chr3 complement(62415..62782,62842..62854) [381 bp, 126 ...   226   2e-77
KLLA0E02289g Chr5 complement(212983..213350,213571..213583) [381...   225   3e-77
ZYRO0F10142g Chr6 complement(820724..821091,821172..821184) [381...   223   2e-76
TBLA0A06500 Chr1 (1596802..1596814,1596982..1597328) [360 bp, 11...   219   7e-75
Kwal_55.21413 s55 (825487..825663) [177 bp, 58 aa] {ON} YOR122C ...   107   4e-31
ZYRO0F02574g Chr6 (204383..206275) [1893 bp, 630 aa] {ON} simila...    30   1.2  
Suva_13.210 Chr13 complement(341369..342400) [1032 bp, 344 aa] {...    28   5.8  

>Smik_15.299 Chr15 complement(513420..513787,513992..514004) [381
           bp, 126 aa] {ON} YOR122C (REAL)
          Length = 126

 Score =  260 bits (665), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 126/126 (100%), Positives = 126/126 (100%)

Query: 1   MSWQAYTDNLIGTGKVDKAVIYSRAGDAVWATSGGLSLQPNEIGEIVQGFDNPAGLQSNG 60
           MSWQAYTDNLIGTGKVDKAVIYSRAGDAVWATSGGLSLQPNEIGEIVQGFDNPAGLQSNG
Sbjct: 1   MSWQAYTDNLIGTGKVDKAVIYSRAGDAVWATSGGLSLQPNEIGEIVQGFDNPAGLQSNG 60

Query: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVIIAHYPPTVQAGEATKIVEQLADY 120
           LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVIIAHYPPTVQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVIIAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LIGVQY 126
           LIGVQY
Sbjct: 121 LIGVQY 126

>YOR122C Chr15 complement(552298..552665,552875..552887) [381 bp,
           126 aa] {ON}  PFY1Profilin, binds actin,
           phosphatidylinositol 4,5-bisphosphate, and polyproline
           regions; involved in cytoskeleton organization; required
           for normal timing of actin polymerization in response to
           thermal stress
          Length = 126

 Score =  260 bits (665), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 126/126 (100%), Positives = 126/126 (100%)

Query: 1   MSWQAYTDNLIGTGKVDKAVIYSRAGDAVWATSGGLSLQPNEIGEIVQGFDNPAGLQSNG 60
           MSWQAYTDNLIGTGKVDKAVIYSRAGDAVWATSGGLSLQPNEIGEIVQGFDNPAGLQSNG
Sbjct: 1   MSWQAYTDNLIGTGKVDKAVIYSRAGDAVWATSGGLSLQPNEIGEIVQGFDNPAGLQSNG 60

Query: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVIIAHYPPTVQAGEATKIVEQLADY 120
           LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVIIAHYPPTVQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVIIAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LIGVQY 126
           LIGVQY
Sbjct: 121 LIGVQY 126

>Suva_8.174 Chr8 complement(310093..310460,310663..310675) [381 bp,
           126 aa] {ON} YOR122C (REAL)
          Length = 126

 Score =  256 bits (654), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 122/126 (96%), Positives = 125/126 (99%)

Query: 1   MSWQAYTDNLIGTGKVDKAVIYSRAGDAVWATSGGLSLQPNEIGEIVQGFDNPAGLQSNG 60
           MSWQAYTDNLIGTGKVDKAVI+SRAGDA+WATSGGLSLQPNEIGEIVQGFDNP GLQSNG
Sbjct: 1   MSWQAYTDNLIGTGKVDKAVIFSRAGDAIWATSGGLSLQPNEIGEIVQGFDNPGGLQSNG 60

Query: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVIIAHYPPTVQAGEATKIVEQLADY 120
           LHIQGQKFMLLRADDRSIYGRHDAEGV+CVRTKQTVIIAHYPPTVQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVICVRTKQTVIIAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LIGVQY 126
           LIGVQY
Sbjct: 121 LIGVQY 126

>Skud_15.284 Chr15 complement(508731..509098,509302..509314) [381
           bp, 126 aa] {ON} YOR122C (REAL)
          Length = 126

 Score =  256 bits (653), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 121/126 (96%), Positives = 125/126 (99%)

Query: 1   MSWQAYTDNLIGTGKVDKAVIYSRAGDAVWATSGGLSLQPNEIGEIVQGFDNPAGLQSNG 60
           MSWQAYTDNLIGTGKVDKAVIYSRAGDA+WATSGGLSLQPNEI E+VQGFDNPAGLQSNG
Sbjct: 1   MSWQAYTDNLIGTGKVDKAVIYSRAGDAIWATSGGLSLQPNEISEVVQGFDNPAGLQSNG 60

Query: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVIIAHYPPTVQAGEATKIVEQLADY 120
           LHIQGQKFMLLRADDRSIYGRHDAEGV+CVRTKQTVII+HYPPTVQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVICVRTKQTVIISHYPPTVQAGEATKIVEQLADY 120

Query: 121 LIGVQY 126
           LIGVQY
Sbjct: 121 LIGVQY 126

>CAGL0I01078g Chr9 (90566..90578,91000..91367) [381 bp, 126 aa] {ON}
           highly similar to uniprot|P07274 Saccharomyces
           cerevisiae YOR122c PFY1 profilin
          Length = 126

 Score =  248 bits (633), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 118/126 (93%), Positives = 121/126 (96%)

Query: 1   MSWQAYTDNLIGTGKVDKAVIYSRAGDAVWATSGGLSLQPNEIGEIVQGFDNPAGLQSNG 60
           MSWQAYTDNL+ TGKVDKAVIYS+AGDAVWATSGGLSLQ NEI EIVQGFDNP GLQSNG
Sbjct: 1   MSWQAYTDNLLATGKVDKAVIYSKAGDAVWATSGGLSLQANEISEIVQGFDNPTGLQSNG 60

Query: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVIIAHYPPTVQAGEATKIVEQLADY 120
           LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTV+IAHYPPTVQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVLIAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LIGVQY 126
           LI VQY
Sbjct: 121 LISVQY 126

>KAFR0D05040 Chr4 complement(992821..993188,993288..993300) [381 bp,
           126 aa] {ON} Anc_5.439 YOR122C
          Length = 126

 Score =  245 bits (625), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 115/126 (91%), Positives = 120/126 (95%)

Query: 1   MSWQAYTDNLIGTGKVDKAVIYSRAGDAVWATSGGLSLQPNEIGEIVQGFDNPAGLQSNG 60
           MSWQAYTDNL+ T KVD+AVIYSRAGDA WATSGG++LQPNEI EI QGFDN AGLQSNG
Sbjct: 1   MSWQAYTDNLLATNKVDRAVIYSRAGDAAWATSGGMALQPNEIAEIAQGFDNAAGLQSNG 60

Query: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVIIAHYPPTVQAGEATKIVEQLADY 120
           LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQT+IIAHYPPTVQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTIIIAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LIGVQY 126
           LIGVQY
Sbjct: 121 LIGVQY 126

>NDAI0C01580 Chr3 complement(339182..339549,339677..339689) [381 bp,
           126 aa] {ON} Anc_5.439 YOR122C
          Length = 126

 Score =  244 bits (623), Expect = 9e-85,   Method: Compositional matrix adjust.
 Identities = 115/126 (91%), Positives = 119/126 (94%)

Query: 1   MSWQAYTDNLIGTGKVDKAVIYSRAGDAVWATSGGLSLQPNEIGEIVQGFDNPAGLQSNG 60
           MSWQAYTDNL+ TGKVDKAVIYSRAGD+VWATSGG  LQ NEI EI QGFDNPAGLQSNG
Sbjct: 1   MSWQAYTDNLLATGKVDKAVIYSRAGDSVWATSGGFQLQANEISEICQGFDNPAGLQSNG 60

Query: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVIIAHYPPTVQAGEATKIVEQLADY 120
           LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTV++AHYPPTVQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVLVAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LIGVQY 126
           LI VQY
Sbjct: 121 LISVQY 126

>TDEL0D02620 Chr4 (501856..501868,501937..502304) [381 bp, 126 aa]
           {ON} Anc_5.439 YOR122C
          Length = 126

 Score =  242 bits (617), Expect = 9e-84,   Method: Compositional matrix adjust.
 Identities = 113/126 (89%), Positives = 121/126 (96%)

Query: 1   MSWQAYTDNLIGTGKVDKAVIYSRAGDAVWATSGGLSLQPNEIGEIVQGFDNPAGLQSNG 60
           MSWQAYTDNL+GTGKVDKAVIYSRAGD++WA+SGGL+LQ NEI EI QGFD+P GLQSNG
Sbjct: 1   MSWQAYTDNLLGTGKVDKAVIYSRAGDSIWASSGGLTLQANEIQEIAQGFDSPVGLQSNG 60

Query: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVIIAHYPPTVQAGEATKIVEQLADY 120
           LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQT++IAHYPPTVQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTILIAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LIGVQY 126
           LI VQY
Sbjct: 121 LISVQY 126

>KNAG0B04220 Chr2 (803026..803038,803229..803596) [381 bp, 126 aa]
           {ON} Anc_5.439 YOR122C
          Length = 126

 Score =  241 bits (616), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 112/126 (88%), Positives = 120/126 (95%)

Query: 1   MSWQAYTDNLIGTGKVDKAVIYSRAGDAVWATSGGLSLQPNEIGEIVQGFDNPAGLQSNG 60
           MSWQAYTDNL+GTGKVDKAVIYSRAGD+VWATSGGL+LQPNEI  IV GFDN AGLQSNG
Sbjct: 1   MSWQAYTDNLLGTGKVDKAVIYSRAGDSVWATSGGLTLQPNEISAIVTGFDNQAGLQSNG 60

Query: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVIIAHYPPTVQAGEATKIVEQLADY 120
           LH+QGQKFM LRADDRSIYGRHDAEGV+CVRTKQT+++AHYPPTVQAGEATKIVEQLADY
Sbjct: 61  LHVQGQKFMFLRADDRSIYGRHDAEGVICVRTKQTILVAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LIGVQY 126
           LI VQY
Sbjct: 121 LISVQY 126

>SAKL0G02640g Chr7 complement(217953..218320,218467..218479) [381
           bp, 126 aa] {ON} highly similar to uniprot|P07274
           Saccharomyces cerevisiae YOR122C PFY1 Profilin actin-
           and phosphatidylinositol 4 5-bisphosphate-binding
           protein plays a role in cytoskeleton organization
           required for normal timing of actin polymerization in
           response to thermal stress localizes to plasma membrane
           and cytosol
          Length = 126

 Score =  240 bits (613), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 112/126 (88%), Positives = 119/126 (94%)

Query: 1   MSWQAYTDNLIGTGKVDKAVIYSRAGDAVWATSGGLSLQPNEIGEIVQGFDNPAGLQSNG 60
           MSWQAYTDNL+GTGKVDKA+IYSRAGDA+WATSGGL+LQP EI EI QGFDNP GLQSNG
Sbjct: 1   MSWQAYTDNLLGTGKVDKAIIYSRAGDAIWATSGGLNLQPAEISEIAQGFDNPTGLQSNG 60

Query: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVIIAHYPPTVQAGEATKIVEQLADY 120
           LHIQ QKFML+RADDRSIYGRHDAEGVVCVRTKQT++IAHYPP VQAGEATKIVEQLADY
Sbjct: 61  LHIQSQKFMLIRADDRSIYGRHDAEGVVCVRTKQTILIAHYPPGVQAGEATKIVEQLADY 120

Query: 121 LIGVQY 126
           LI VQY
Sbjct: 121 LISVQY 126

>NCAS0H02070 Chr8 complement(403286..403653,403777..403789) [381 bp,
           126 aa] {ON} Anc_5.439 YOR122C
          Length = 126

 Score =  234 bits (597), Expect = 8e-81,   Method: Compositional matrix adjust.
 Identities = 107/126 (84%), Positives = 119/126 (94%)

Query: 1   MSWQAYTDNLIGTGKVDKAVIYSRAGDAVWATSGGLSLQPNEIGEIVQGFDNPAGLQSNG 60
           MSWQA TDNL+ TGKVD+AV+YSRAGD+VWATSGGL LQPNEI EI +GFDNPAGLQSNG
Sbjct: 1   MSWQACTDNLLATGKVDRAVLYSRAGDSVWATSGGLQLQPNEIAEIARGFDNPAGLQSNG 60

Query: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVIIAHYPPTVQAGEATKIVEQLADY 120
           LH+QGQKFMLLRADD+SIYGRHDAEG+VCVRT QT++IAHYPP+VQAGEATKIVEQLADY
Sbjct: 61  LHVQGQKFMLLRADDKSIYGRHDAEGIVCVRTLQTILIAHYPPSVQAGEATKIVEQLADY 120

Query: 121 LIGVQY 126
           LI V+Y
Sbjct: 121 LISVKY 126

>TPHA0E01740 Chr5 (352358..352370,352454..352821) [381 bp, 126 aa]
           {ON} Anc_5.439 YOR122C
          Length = 126

 Score =  231 bits (589), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 108/126 (85%), Positives = 115/126 (91%)

Query: 1   MSWQAYTDNLIGTGKVDKAVIYSRAGDAVWATSGGLSLQPNEIGEIVQGFDNPAGLQSNG 60
           MSWQAYTDNL+ TGKVDKA +YSRAGDA WA SGGLSL   E  EI +GFD+P+GLQ+ G
Sbjct: 1   MSWQAYTDNLLATGKVDKAALYSRAGDAAWAASGGLSLTAQEATEIAKGFDDPSGLQTTG 60

Query: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVIIAHYPPTVQAGEATKIVEQLADY 120
           LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQT+IIAHYPPTVQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTIIIAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LIGVQY 126
           LIGVQY
Sbjct: 121 LIGVQY 126

>Kpol_1062.27 s1062 (61009..61021,61207..61574) [381 bp, 126 aa]
           {ON} (61009..61021,61207..61574) [381 nt, 127 aa]
          Length = 126

 Score =  228 bits (580), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 116/126 (92%)

Query: 1   MSWQAYTDNLIGTGKVDKAVIYSRAGDAVWATSGGLSLQPNEIGEIVQGFDNPAGLQSNG 60
           MSWQAYTDNL+ TGK+DKAV+YSRAGDAVWA+SGGL+L   EI  I QGFD+P+ LQSNG
Sbjct: 1   MSWQAYTDNLLATGKIDKAVLYSRAGDAVWASSGGLALAATEISGIAQGFDDPSHLQSNG 60

Query: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVIIAHYPPTVQAGEATKIVEQLADY 120
           LHIQGQKFM+LRADDRSIYGRHDAEGVVCVRTKQT+++AHYP TVQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMMLRADDRSIYGRHDAEGVVCVRTKQTILVAHYPATVQAGEATKIVEQLADY 120

Query: 121 LIGVQY 126
           LI VQY
Sbjct: 121 LISVQY 126

>KLTH0F15950g Chr6 (1297129..1297141,1297227..1297594) [381 bp, 126
           aa] {ON} highly similar to uniprot|P07274 Saccharomyces
           cerevisiae YOR122C PFY1 Profilin actin- and
           phosphatidylinositol 4 5-bisphosphate-binding protein
           plays a role in cytoskeleton organization required for
           normal timing of actin polymerization in response to
           thermal stress localizes to plasma membrane and cytosol
          Length = 126

 Score =  226 bits (577), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 103/126 (81%), Positives = 115/126 (91%)

Query: 1   MSWQAYTDNLIGTGKVDKAVIYSRAGDAVWATSGGLSLQPNEIGEIVQGFDNPAGLQSNG 60
           MSWQAYTDNL+GTGK+DKA IYSRAGD++WA SGGLSL  NEIGEI QGF+NP+GLQS G
Sbjct: 1   MSWQAYTDNLLGTGKIDKAAIYSRAGDSLWAASGGLSLPTNEIGEIAQGFENPSGLQSTG 60

Query: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVIIAHYPPTVQAGEATKIVEQLADY 120
           LH+QGQKFML+RADDRSIYGRHDAEGV+CVRTKQT+++ HYP  VQAGEATKIVEQLADY
Sbjct: 61  LHLQGQKFMLIRADDRSIYGRHDAEGVICVRTKQTILVTHYPAGVQAGEATKIVEQLADY 120

Query: 121 LIGVQY 126
           LI V Y
Sbjct: 121 LISVSY 126

>Ecym_4510 Chr4 complement(1019247..1019614,1019714..1019726) [381
           bp, 126 aa] {ON} similar to Ashbya gossypii ACL168C
           1-intron
          Length = 126

 Score =  226 bits (575), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 104/126 (82%), Positives = 114/126 (90%)

Query: 1   MSWQAYTDNLIGTGKVDKAVIYSRAGDAVWATSGGLSLQPNEIGEIVQGFDNPAGLQSNG 60
           MSWQAYTDNLI TGKVDKA+IYSRAGD +WA+SGG+SL+ NEI EI QGFDN  GLQSNG
Sbjct: 1   MSWQAYTDNLIATGKVDKAIIYSRAGDTIWASSGGMSLEANEISEISQGFDNAGGLQSNG 60

Query: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVIIAHYPPTVQAGEATKIVEQLADY 120
           LHIQ QKFMLLRADDRSIYGRH+AEG++ VRTKQT++IAHYP  VQAGEATKIVEQLADY
Sbjct: 61  LHIQSQKFMLLRADDRSIYGRHEAEGIIAVRTKQTILIAHYPAGVQAGEATKIVEQLADY 120

Query: 121 LIGVQY 126
           LI VQY
Sbjct: 121 LISVQY 126

>ACL168C Chr3 complement(62415..62782,62842..62854) [381 bp, 126 aa]
           {ON} Syntenic homolog of Saccharomyces cerevisiae
           YOR122C (PFY1); 1-intron
          Length = 126

 Score =  226 bits (575), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 116/126 (92%)

Query: 1   MSWQAYTDNLIGTGKVDKAVIYSRAGDAVWATSGGLSLQPNEIGEIVQGFDNPAGLQSNG 60
           MSWQAYTDNL+ TGKVDKA IYSRAGD +WA+SGGL+L+P+EI EI QGFDN AGLQ+NG
Sbjct: 1   MSWQAYTDNLLATGKVDKATIYSRAGDTIWASSGGLALEPSEIKEISQGFDNAAGLQANG 60

Query: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVIIAHYPPTVQAGEATKIVEQLADY 120
           LHIQGQKFMLLRAD+RSIYGRH+AEGVV VRTKQT++IAHYP  VQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADERSIYGRHEAEGVVAVRTKQTILIAHYPAGVQAGEATKIVEQLADY 120

Query: 121 LIGVQY 126
           LI VQY
Sbjct: 121 LISVQY 126

>KLLA0E02289g Chr5 complement(212983..213350,213571..213583) [381
           bp, 126 aa] {ON} highly similar to uniprot|P07274
           Saccharomyces cerevisiae YOR122C PFY1 Profilin actin-
           and phosphatidylinositol 4 5-bisphosphate-binding
           protein plays a role in cytoskeleton organization
           required for normal timing of actin polymerization in
           response to thermal stress localizes to plasma membrane
           and cytosol
          Length = 126

 Score =  225 bits (574), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 103/126 (81%), Positives = 116/126 (92%)

Query: 1   MSWQAYTDNLIGTGKVDKAVIYSRAGDAVWATSGGLSLQPNEIGEIVQGFDNPAGLQSNG 60
           MSWQAYTDNL+ TGK+DK+VIYSRAGDAVWA+SGGL LQP EI EI +GFDNP+GLQSNG
Sbjct: 1   MSWQAYTDNLLATGKIDKSVIYSRAGDAVWASSGGLQLQPAEISEIARGFDNPSGLQSNG 60

Query: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVIIAHYPPTVQAGEATKIVEQLADY 120
           LH+QGQKFML++ADDRSIYGRH+AEG+V VRTKQT++I HYPP VQAGEATKIVEQL DY
Sbjct: 61  LHVQGQKFMLIKADDRSIYGRHEAEGIVIVRTKQTILIGHYPPGVQAGEATKIVEQLGDY 120

Query: 121 LIGVQY 126
           LI VQY
Sbjct: 121 LISVQY 126

>ZYRO0F10142g Chr6 complement(820724..821091,821172..821184) [381
           bp, 126 aa] {ON} highly similar to uniprot|P07274
           Saccharomyces cerevisiae YOR122C PFY1 Profilin actin-
           and phosphatidylinositol 4 5-bisphosphate-binding
           protein plays a role in cytoskeleton organization
           required for normal timing of actin polymerization in
           response to thermal stress localizes to plasma membrane
           and cytosol
          Length = 126

 Score =  223 bits (568), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 114/126 (90%)

Query: 1   MSWQAYTDNLIGTGKVDKAVIYSRAGDAVWATSGGLSLQPNEIGEIVQGFDNPAGLQSNG 60
           MSWQAYT+NL+GTGK+DKA IYSRAGD++WA+SGGL+  P EIG+I  GFD P+GLQS G
Sbjct: 1   MSWQAYTENLLGTGKIDKAAIYSRAGDSLWASSGGLTFAPQEIGKIAAGFDEPSGLQSTG 60

Query: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVIIAHYPPTVQAGEATKIVEQLADY 120
           L +QGQKFMLLRADDRSIY RHDAEG+ CVRTKQT+I+AHYPP+VQAGEATKIVEQLADY
Sbjct: 61  LFVQGQKFMLLRADDRSIYARHDAEGMCCVRTKQTIILAHYPPSVQAGEATKIVEQLADY 120

Query: 121 LIGVQY 126
           LIG QY
Sbjct: 121 LIGAQY 126

>TBLA0A06500 Chr1 (1596802..1596814,1596982..1597328) [360 bp, 119
           aa] {ON} Anc_5.439 YOR122C
          Length = 119

 Score =  219 bits (558), Expect = 7e-75,   Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 113/126 (89%), Gaps = 7/126 (5%)

Query: 1   MSWQAYTDNLIGTGKVDKAVIYSRAGDAVWATSGGLSLQPNEIGEIVQGFDNPAGLQSNG 60
           MSWQA       TGKVDKAVIYSRAGD+VWA+SGGL L  NEI EI +GFDNP+GLQSNG
Sbjct: 1   MSWQA-------TGKVDKAVIYSRAGDSVWASSGGLQLGANEIAEIARGFDNPSGLQSNG 53

Query: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVIIAHYPPTVQAGEATKIVEQLADY 120
           LH+Q QKFMLLRADDRSIYGRHDAEG+VCVRTKQT++IAHYPPTVQAGEATKIVEQLADY
Sbjct: 54  LHVQSQKFMLLRADDRSIYGRHDAEGIVCVRTKQTIVIAHYPPTVQAGEATKIVEQLADY 113

Query: 121 LIGVQY 126
           LIGVQY
Sbjct: 114 LIGVQY 119

>Kwal_55.21413 s55 (825487..825663) [177 bp, 58 aa] {ON} YOR122C
           (PFY1) - profilin (actin-binding protein) [contig 130]
           FULL
          Length = 58

 Score =  107 bits (266), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 49/58 (84%), Positives = 53/58 (91%)

Query: 69  MLLRADDRSIYGRHDAEGVVCVRTKQTVIIAHYPPTVQAGEATKIVEQLADYLIGVQY 126
           ML+RADDRSIYGRHDAEGVVCVRTKQT+++ HYP  VQAGEATKIVEQLADYLI V Y
Sbjct: 1   MLIRADDRSIYGRHDAEGVVCVRTKQTILVTHYPAGVQAGEATKIVEQLADYLISVSY 58

>ZYRO0F02574g Chr6 (204383..206275) [1893 bp, 630 aa] {ON} similar
           to uniprot|P43561 Saccharomyces cerevisiae YFL041W
          Length = 630

 Score = 30.4 bits (67), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 23/47 (48%)

Query: 48  QGFDNPAGLQSNGLHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQ 94
           +G+D P  +   GL    ++F L   D+R +Y  +D +    VR K 
Sbjct: 306 KGYDWPKTIDVGGLENAAEEFYLQPLDNRELYDDYDVQITFDVRMKN 352

>Suva_13.210 Chr13 complement(341369..342400) [1032 bp, 344 aa] {ON}
           YMR041C (REAL)
          Length = 344

 Score = 28.1 bits (61), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 31/71 (43%)

Query: 16  VDKAVIYSRAGDAVWATSGGLSLQPNEIGEIVQGFDNPAGLQSNGLHIQGQKFMLLRADD 75
            D A + +R   A W   G + L  + +GE+    DN   ++SNG  +  +   L     
Sbjct: 267 TDLADLATRYAIAEWIDKGPVVLGVSSMGELKHALDNYENVKSNGNKMSLKDQRLASFIQ 326

Query: 76  RSIYGRHDAEG 86
           ++I+  H  E 
Sbjct: 327 KNIFKEHFNEA 337

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.136    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 12,922,084
Number of extensions: 450792
Number of successful extensions: 800
Number of sequences better than 10.0: 23
Number of HSP's gapped: 800
Number of HSP's successfully gapped: 23
Length of query: 126
Length of database: 53,481,399
Length adjustment: 95
Effective length of query: 31
Effective length of database: 42,588,129
Effective search space: 1320231999
Effective search space used: 1320231999
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 59 (27.3 bits)