Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_15.2985.434ON31231216550.0
Suva_8.1735.434ON31231215030.0
YOR120W (GCY1)5.434ON31231214980.0
Skud_15.2835.434ON31231214960.0
CAGL0I01100g5.434ON31030911691e-162
NDAI0C016005.434ON31331211661e-161
KNAG0C049105.434ON31331211631e-161
NCAS0H020605.434ON32230611391e-157
SAKL0G02530g5.434ON31231211281e-155
Suva_2.5405.434ON31231211271e-155
Smik_4.6345.434ON31231211231e-155
Skud_4.6375.434ON31231211201e-154
CAGL0A02816g5.434ON31030911151e-153
YDR368W (YPR1)5.434ON31231211151e-153
NCAS0F033805.434ON31331310761e-148
KAFR0E038405.434ON31031210741e-147
TBLA0A02825singletonON31131210671e-146
NDAI0B056705.434ON31831210551e-144
ZYRO0F10032g5.434ON31031010521e-144
TDEL0E019105.434ON31131210491e-143
Kpol_1062.295.434ON31130910471e-143
KAFR0E03850singletonON31131310441e-143
KLLA0B14707gsingletonON31031210371e-142
TBLA0A065105.434ON31231210361e-141
TPHA0E017605.434ON31030910331e-141
KLTH0E00220gsingletonON30630510211e-139
KLTH0A00528gsingletonON30630510211e-139
Kwal_47.18084na 1ON30930410101e-138
KLTH0A03476gna 1ON30830210071e-137
KLTH0E15532gsingletonON3093039991e-136
TDEL0D00230singletonON3123119781e-133
TPHA0G00210singletonON3113129781e-133
KLTH0F16060g5.434ON3093099561e-129
TBLA0A02835singletonON3113129551e-129
Kwal_55.214265.434ON3083099191e-124
KLLA0D10109gsingletonON3093029191e-124
AER401W5.434ON3133148481e-113
NDAI0A070003.108ON3202905732e-71
NCAS0I024203.108ON3202905575e-69
Smik_2.289singletonON3443205431e-66
SAKL0C10626gsingletonON3222975368e-66
Kwal_56.226113.108ON3213075332e-65
YBR149W (ARA1)3.108ON3443215352e-65
Skud_2.2763.108ON3443115352e-65
Suva_4.3983.108ON3443215326e-65
Smik_2.2883.108ON3443085318e-65
KLTH0C10010g3.108ON3213135271e-64
KLLA0F02728g3.108ON3303045133e-62
KAFR0G013503.108ON3243015072e-61
KNAG0K020703.108ON3232955036e-61
SAKL0C09922g3.108ON3223064914e-59
ZYRO0B06138g3.108ON3283234821e-57
TDEL0D051603.108ON3253154768e-57
Ecym_55085.409ON3263274593e-54
ACL107C5.409ON3543084534e-53
Ecym_7160na 2ON2712934457e-53
NCAS0A066605.409ON3263074402e-51
KLLA0F03256g7.468ON2852804372e-51
TBLA0F01720singletonON3263044384e-51
KLTH0F16610g5.409ON3293104314e-50
CAGL0I01122g5.409ON3263084281e-49
KNAG0B03780singletonON3263094262e-49
KLTH0G02420gna 3ON2893214232e-49
SAKL0F14278g7.468ON2862804223e-49
KNAG0D013707.468ON2822914223e-49
KAFR0C05320singletonON3273064211e-48
CAGL0C04543g7.468ON2872874181e-48
TDEL0C033207.468ON2832924162e-48
Kpol_1013.827.468ON2852814144e-48
TBLA0A00630singletonON3283104176e-48
SAKL0G01914g5.409ON3293094166e-48
TPHA0E018605.409ON3263104151e-47
Kwal_47.182197.468ON2932864084e-47
YJR096W7.468ON2822924075e-47
KLLA0E21627g5.409ON3293114097e-47
ZYRO0A06336g5.409ON3273064062e-46
TDEL0E021505.409ON3293114062e-46
YHR104W (GRE3)5.409ON3273074053e-46
Skud_10.3187.468ON2822894014e-46
Kwal_33.13276na 4ON3022804015e-46
KAFR0G009207.468ON2862874006e-46
NDAI0D016005.409ON3273094036e-46
Kwal_55.215365.409ON3293114028e-46
ZYRO0G17600g7.468ON2832923971e-45
NCAS0H005607.468ON2842923962e-45
KLTH0G05786g7.468ON2862863953e-45
Suva_15.3005.409ON3273073959e-45
Suva_12.1847.468ON2822923901e-44
SAKL0F02574gna 3ON2893113892e-44
KLTH0F01892gna 4ON3022733885e-44
Smik_8.1825.409ON3273053896e-44
Smik_10.3847.468ON2822923866e-44
Kwal_47.18893na 3ON2892953798e-43
ABL209Cna 2ON3102873791e-42
Skud_8.1655.409ON3273053801e-42
KLLA0F05775g7.285ON3093143642e-40
CAGL0J09394g7.285ON3113093512e-38
NCAS0A137407.285ON3093003485e-38
Smik_4.1137.285ON3123103372e-36
Kpol_1020.137.285ON3133313353e-36
Skud_4.1317.285ON3123123345e-36
Kwal_47.19278na 5ON3143283302e-35
YDL124W7.285ON3123133223e-34
NDAI0A023007.285ON3133343199e-34
KLTH0G00638gna 5ON3133093181e-33
SAKL0F09746g7.285ON3123103121e-32
SAKL0F00704gna 5ON3153083111e-32
KAFR0B012007.285ON3153053102e-32
ZYRO0E09614gna 5ON3083133075e-32
ZYRO0C09196g7.285ON3122912971e-30
KNAG0C041107.285ON3113052962e-30
TDEL0D02790singletonON3293082963e-30
Kpol_381.8singletonON3093232934e-30
TBLA0F019807.285ON3023132872e-29
Ecym_32647.285ON3113272743e-27
Kwal_33.13274singletonON108891877e-17
TBLA0G01120singletonON3431021023e-04
Suva_4.1227.285ON206183993e-04
Suva_12.272singletonON265204970.001
NCAS0C02450singletonON343292940.003
Ecym_22962.604ON340181910.006
Kpol_400.9singletonON341330860.023
KNAG0M023402.604ON309156860.025
Suva_9.17singletonON308206830.060
TBLA0B10110singletonON34583820.076
Kpol_449.4singletonON34182820.083
Suva_14.10na 6ON376100810.10
YDL243C (AAD4)singletonON32999780.24
KLLA0B09658g3.462ON342266780.25
TBLA0E05040singletonON342315770.32
NCAS0C019908.565ON343220770.36
KLTH0E16852gsingletonON375137760.52
KLLA0F19360gsingletonON34473740.71
KAFR0A053603.462ON346160740.75
NCAS0A129502.604ON32382730.93
Ecym_60682.402ON1002130741.1
ZYRO0F00858g2.604ON34699721.5
Smik_14.1na 6ON37699711.9
Skud_10.383na 7ON37699712.1
YNL331C (AAD14)na 6ON376118712.1
Smik_3.210singletonON362131702.4
Suva_5.2077.378ON767194712.5
Smik_79.1singletonON253131693.1
KAFR0F03890singletonON319217675.6
NDAI0B009305.76ON94073676.4
YFL056C (AAD6)singletonON21299658.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_15.298
         (312 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_15.298 Chr15 (512239..513177) [939 bp, 312 aa] {ON} YOR120W...   642   0.0  
Suva_8.173 Chr8 (308911..309849) [939 bp, 312 aa] {ON} YOR120W (...   583   0.0  
YOR120W Chr15 (551114..552052) [939 bp, 312 aa] {ON}  GCY1Putati...   581   0.0  
Skud_15.283 Chr15 (507542..508480) [939 bp, 312 aa] {ON} YOR120W...   580   0.0  
CAGL0I01100g Chr9 complement(91693..92625) [933 bp, 310 aa] {ON}...   454   e-162
NDAI0C01600 Chr3 complement(342011..342952) [942 bp, 313 aa] {ON...   453   e-161
KNAG0C04910 Chr3 complement(949367..950308) [942 bp, 313 aa] {ON...   452   e-161
NCAS0H02060 Chr8 (400615..401583) [969 bp, 322 aa] {ON} Anc_5.434     443   e-157
SAKL0G02530g Chr7 (208952..209890) [939 bp, 312 aa] {ON} similar...   439   e-155
Suva_2.540 Chr2 (964433..965371) [939 bp, 312 aa] {ON} YDR368W (...   438   e-155
Smik_4.634 Chr4 (1133924..1134862) [939 bp, 312 aa] {ON} YDR368W...   437   e-155
Skud_4.637 Chr4 (1136769..1137707) [939 bp, 312 aa] {ON} YDR368W...   436   e-154
CAGL0A02816g Chr1 (296851..297783) [933 bp, 310 aa] {ON} highly ...   434   e-153
YDR368W Chr4 (1213904..1214842) [939 bp, 312 aa] {ON}  YPR1NADPH...   434   e-153
NCAS0F03380 Chr6 (682072..683013) [942 bp, 313 aa] {ON} Anc_5.434     419   e-148
KAFR0E03840 Chr5 complement(763027..763959) [933 bp, 310 aa] {ON...   418   e-147
TBLA0A02825 Chr1 complement(681691..682626) [936 bp, 311 aa] {ON}     415   e-146
NDAI0B05670 Chr2 (1383187..1384143) [957 bp, 318 aa] {ON} Anc_5....   410   e-144
ZYRO0F10032g Chr6 (813814..814746) [933 bp, 310 aa] {ON} uniprot...   409   e-144
TDEL0E01910 Chr5 complement(361621..362556) [936 bp, 311 aa] {ON...   408   e-143
Kpol_1062.29 s1062 complement(63895..64830) [936 bp, 311 aa] {ON...   407   e-143
KAFR0E03850 Chr5 complement(764595..765530) [936 bp, 311 aa] {ON}     406   e-143
KLLA0B14707g Chr2 complement(1291951..1292883) [933 bp, 310 aa] ...   404   e-142
TBLA0A06510 Chr1 complement(1597737..1598675) [939 bp, 312 aa] {...   403   e-141
TPHA0E01760 Chr5 complement(354862..355794) [933 bp, 310 aa] {ON...   402   e-141
KLTH0E00220g Chr5 complement(12415..13335) [921 bp, 306 aa] {ON}...   397   e-139
KLTH0A00528g Chr1 complement(46253..47173) [921 bp, 306 aa] {ON}...   397   e-139
Kwal_47.18084 s47 complement(677816..678745) [930 bp, 309 aa] {O...   393   e-138
KLTH0A03476g Chr1 complement(298735..299661) [927 bp, 308 aa] {O...   392   e-137
KLTH0E15532g Chr5 complement(1380466..1381395) [930 bp, 309 aa] ...   389   e-136
TDEL0D00230 Chr4 (37458..38396) [939 bp, 312 aa] {ON}  possible ...   381   e-133
TPHA0G00210 Chr7 (31978..32913) [936 bp, 311 aa] {ON}                 381   e-133
KLTH0F16060g Chr6 complement(1304479..1305408) [930 bp, 309 aa] ...   372   e-129
TBLA0A02835 Chr1 complement(683118..684053) [936 bp, 311 aa] {ON}     372   e-129
Kwal_55.21426 s55 complement(832981..833907) [927 bp, 308 aa] {O...   358   e-124
KLLA0D10109g Chr4 (854495..855424) [930 bp, 309 aa] {ON} similar...   358   e-124
AER401W Chr5 (1406905..1407846) [942 bp, 313 aa] {ON} Syntenic h...   331   e-113
NDAI0A07000 Chr1 complement(1596632..1597594) [963 bp, 320 aa] {...   225   2e-71
NCAS0I02420 Chr9 complement(454156..455118) [963 bp, 320 aa] {ON...   219   5e-69
Smik_2.289 Chr2 (526189..527223) [1035 bp, 344 aa] {ON} YBR149W ...   213   1e-66
SAKL0C10626g Chr3 (962421..963389) [969 bp, 322 aa] {ON} similar...   211   8e-66
Kwal_56.22611 s56 complement(202750..203715) [966 bp, 321 aa] {O...   209   2e-65
YBR149W Chr2 (539987..541021) [1035 bp, 344 aa] {ON}  ARA1NADP+ ...   210   2e-65
Skud_2.276 Chr2 (507436..508470) [1035 bp, 344 aa] {ON} YBR149W ...   210   2e-65
Suva_4.398 Chr4 (709192..710226) [1035 bp, 344 aa] {ON} YBR149W ...   209   6e-65
Smik_2.288 Chr2 (524564..525598) [1035 bp, 344 aa] {ON} YBR149W ...   209   8e-65
KLTH0C10010g Chr3 (829145..830110) [966 bp, 321 aa] {ON} similar...   207   1e-64
KLLA0F02728g Chr6 (249240..250232) [993 bp, 330 aa] {ON} similar...   202   3e-62
KAFR0G01350 Chr7 (304389..305363) [975 bp, 324 aa] {ON} Anc_3.10...   199   2e-61
KNAG0K02070 Chr11 complement(419556..420527) [972 bp, 323 aa] {O...   198   6e-61
SAKL0C09922g Chr3 (897779..898747) [969 bp, 322 aa] {ON} similar...   193   4e-59
ZYRO0B06138g Chr2 complement(491830..492816) [987 bp, 328 aa] {O...   190   1e-57
TDEL0D05160 Chr4 complement(935981..936958) [978 bp, 325 aa] {ON...   187   8e-57
Ecym_5508 Chr5 (1035144..1036124) [981 bp, 326 aa] {ON} similar ...   181   3e-54
ACL107C Chr3 complement(152564..153628) [1065 bp, 354 aa] {ON} S...   179   4e-53
Ecym_7160 Chr7 (334780..335595) [816 bp, 271 aa] {ON} similar to...   176   7e-53
NCAS0A06660 Chr1 (1316398..1317378) [981 bp, 326 aa] {ON}             174   2e-51
KLLA0F03256g Chr6 (306731..307588) [858 bp, 285 aa] {ON} highly ...   172   2e-51
TBLA0F01720 Chr6 complement(430289..431269) [981 bp, 326 aa] {ON}     173   4e-51
KLTH0F16610g Chr6 complement(1346319..1347308) [990 bp, 329 aa] ...   170   4e-50
CAGL0I01122g Chr9 (93934..94914) [981 bp, 326 aa] {ON} highly si...   169   1e-49
KNAG0B03780 Chr2 (725307..726287) [981 bp, 326 aa] {ON}               168   2e-49
KLTH0G02420g Chr7 complement(188767..189636) [870 bp, 289 aa] {O...   167   2e-49
SAKL0F14278g Chr6 (1143922..1144782) [861 bp, 286 aa] {ON} highl...   167   3e-49
KNAG0D01370 Chr4 complement(230193..231041) [849 bp, 282 aa] {ON...   167   3e-49
KAFR0C05320 Chr3 complement(1065934..1066917) [984 bp, 327 aa] {...   166   1e-48
CAGL0C04543g Chr3 (434137..435000) [864 bp, 287 aa] {ON} highly ...   165   1e-48
TDEL0C03320 Chr3 (591171..592022) [852 bp, 283 aa] {ON} Anc_7.46...   164   2e-48
Kpol_1013.82 s1013 complement(200564..201421) [858 bp, 285 aa] {...   164   4e-48
TBLA0A00630 Chr1 complement(126399..127385) [987 bp, 328 aa] {ON}     165   6e-48
SAKL0G01914g Chr7 (162612..163601) [990 bp, 329 aa] {ON} highly ...   164   6e-48
TPHA0E01860 Chr5 complement(373074..374054) [981 bp, 326 aa] {ON...   164   1e-47
Kwal_47.18219 s47 (737925..738806) [882 bp, 293 aa] {ON} YJR096W...   161   4e-47
YJR096W Chr10 (611195..612043) [849 bp, 282 aa] {ON} Putative xy...   161   5e-47
KLLA0E21627g Chr5 complement(1929294..1930283) [990 bp, 329 aa] ...   162   7e-47
ZYRO0A06336g Chr1 complement(505818..506801) [984 bp, 327 aa] {O...   160   2e-46
TDEL0E02150 Chr5 complement(403001..403990) [990 bp, 329 aa] {ON...   160   2e-46
YHR104W Chr8 (323409..324392) [984 bp, 327 aa] {ON}  GRE3Aldose ...   160   3e-46
Skud_10.318 Chr10 (568560..569408) [849 bp, 282 aa] {ON} YJR096W...   159   4e-46
Kwal_33.13276 s33 (153537..154445) [909 bp, 302 aa] {ON} YDL124W...   159   5e-46
KAFR0G00920 Chr7 complement(215664..216524) [861 bp, 286 aa] {ON...   158   6e-46
NDAI0D01600 Chr4 (382637..383620) [984 bp, 327 aa] {ON}               159   6e-46
Kwal_55.21536 s55 complement(877191..878180) [990 bp, 329 aa] {O...   159   8e-46
ZYRO0G17600g Chr7 (1455426..1456277) [852 bp, 283 aa] {ON} highl...   157   1e-45
NCAS0H00560 Chr8 complement(96020..96874) [855 bp, 284 aa] {ON} ...   157   2e-45
KLTH0G05786g Chr7 complement(460135..460995) [861 bp, 286 aa] {O...   156   3e-45
Suva_15.300 Chr15 (525715..526698) [984 bp, 327 aa] {ON} YHR104W...   156   9e-45
Suva_12.184 Chr12 (289608..290456) [849 bp, 282 aa] {ON} YJR096W...   154   1e-44
SAKL0F02574g Chr6 complement(220827..221696) [870 bp, 289 aa] {O...   154   2e-44
KLTH0F01892g Chr6 (149177..150085) [909 bp, 302 aa] {ON} similar...   154   5e-44
Smik_8.182 Chr8 (299804..300787) [984 bp, 327 aa] {ON} YHR104W (...   154   6e-44
Smik_10.384 Chr10 (600097..600945) [849 bp, 282 aa] {ON} YJR096W...   153   6e-44
Kwal_47.18893 s47 (1017098..1017967) [870 bp, 289 aa] {ON} YJR09...   150   8e-43
ABL209C Chr2 complement(11410..12342) [933 bp, 310 aa] {ON} Synt...   150   1e-42
Skud_8.165 Chr8 (297201..298184) [984 bp, 327 aa] {ON} YHR104W (...   150   1e-42
KLLA0F05775g Chr6 (560270..561199) [930 bp, 309 aa] {ON} highly ...   144   2e-40
CAGL0J09394g Chr10 (925839..926774) [936 bp, 311 aa] {ON} simila...   139   2e-38
NCAS0A13740 Chr1 complement(2699208..2700137) [930 bp, 309 aa] {...   138   5e-38
Smik_4.113 Chr4 (216885..217823) [939 bp, 312 aa] {ON} YDL124W (...   134   2e-36
Kpol_1020.13 s1020 (27790..28731) [942 bp, 313 aa] {ON} (27790.....   133   3e-36
Skud_4.131 Chr4 (235946..236884) [939 bp, 312 aa] {ON} YDL124W (...   133   5e-36
Kwal_47.19278 s47 complement(1169418..1170362) [945 bp, 314 aa] ...   131   2e-35
YDL124W Chr4 (240259..241197) [939 bp, 312 aa] {ON} NADPH-depend...   128   3e-34
NDAI0A02300 Chr1 (516594..517535) [942 bp, 313 aa] {ON} Anc_7.285     127   9e-34
KLTH0G00638g Chr7 (43280..44221) [942 bp, 313 aa] {ON} similar t...   127   1e-33
SAKL0F09746g Chr6 complement(746292..747230) [939 bp, 312 aa] {O...   124   1e-32
SAKL0F00704g Chr6 (60941..61888) [948 bp, 315 aa] {ON} similar t...   124   1e-32
KAFR0B01200 Chr2 (224411..225358) [948 bp, 315 aa] {ON} Anc_7.28...   124   2e-32
ZYRO0E09614g Chr5 complement(765913..766839) [927 bp, 308 aa] {O...   122   5e-32
ZYRO0C09196g Chr3 complement(698826..699764) [939 bp, 312 aa] {O...   119   1e-30
KNAG0C04110 Chr3 (806389..807324) [936 bp, 311 aa] {ON} Anc_7.28...   118   2e-30
TDEL0D02790 Chr4 complement(533517..534506) [990 bp, 329 aa] {ON}     118   3e-30
Kpol_381.8 s381 complement(20844..21359,21366..21695,21698..2178...   117   4e-30
TBLA0F01980 Chr6 (493378..494286) [909 bp, 302 aa] {ON} Anc_7.28...   115   2e-29
Ecym_3264 Chr3 complement(503010..503945) [936 bp, 311 aa] {ON} ...   110   3e-27
Kwal_33.13274 s33 (151643..151969) [327 bp, 108 aa] {ON} YJR096W...    77   7e-17
TBLA0G01120 Chr7 complement(285827..286858) [1032 bp, 343 aa] {O...    44   3e-04
Suva_4.122 Chr4 (228898..228945,228942..229163,229167..229517) [...    43   3e-04
Suva_12.272 Chr12 complement(441543..442262,442266..442340) [795...    42   0.001
NCAS0C02450 Chr3 complement(455582..456613) [1032 bp, 343 aa] {O...    41   0.003
Ecym_2296 Chr2 complement(574287..575309) [1023 bp, 340 aa] {ON}...    40   0.006
Kpol_400.9 s400 complement(19154..20179) [1026 bp, 341 aa] {ON} ...    38   0.023
KNAG0M02340 Chr13 complement(431237..432166) [930 bp, 309 aa] {O...    38   0.025
Suva_9.17 Chr9 (18179..19105) [927 bp, 308 aa] {ON} YNL331C (REAL)     37   0.060
TBLA0B10110 Chr2 complement(2432572..2433609) [1038 bp, 345 aa] ...    36   0.076
Kpol_449.4 s449 (14334..15359) [1026 bp, 341 aa] {ON} (14334..15...    36   0.083
Suva_14.10 Chr14 complement(10349..11479) [1131 bp, 376 aa] {ON}...    36   0.10 
YDL243C Chr4 complement(17577..18566) [990 bp, 329 aa] {ON}  AAD...    35   0.24 
KLLA0B09658g Chr2 complement(837873..838901) [1029 bp, 342 aa] {...    35   0.25 
TBLA0E05040 Chr5 (1303453..1304481) [1029 bp, 342 aa] {ON}             34   0.32 
NCAS0C01990 Chr3 (365857..366888) [1032 bp, 343 aa] {ON} Anc_8.565     34   0.36 
KLTH0E16852g Chr5 complement(1496072..1497199) [1128 bp, 375 aa]...    34   0.52 
KLLA0F19360g Chr6 (1792778..1793812) [1035 bp, 344 aa] {ON} high...    33   0.71 
KAFR0A05360 Chr1 complement(1056443..1057483) [1041 bp, 346 aa] ...    33   0.75 
NCAS0A12950 Chr1 complement(2551851..2552822) [972 bp, 323 aa] {...    33   0.93 
Ecym_6068 Chr6 (126754..129762) [3009 bp, 1002 aa] {ON} similar ...    33   1.1  
ZYRO0F00858g Chr6 (68107..69147) [1041 bp, 346 aa] {ON} similar ...    32   1.5  
Smik_14.1 Chr14 complement(607..1737) [1131 bp, 376 aa] {ON} YNL...    32   1.9  
Skud_10.383 Chr10 (684416..685546) [1131 bp, 376 aa] {ON} YNL331...    32   2.1  
YNL331C Chr14 complement(16118..17248) [1131 bp, 376 aa] {ON}  A...    32   2.1  
Smik_3.210 Chr3 (309527..310615) [1089 bp, 362 aa] {ON} YNL331C ...    32   2.4  
Suva_5.207 Chr5 complement(314580..316883) [2304 bp, 767 aa] {ON...    32   2.5  
Smik_79.1 Chr79 complement(3..761) [759 bp, 253 aa] {ON} YNL331C...    31   3.1  
KAFR0F03890 Chr6 complement(761303..762262) [960 bp, 319 aa] {ON}      30   5.6  
NDAI0B00930 Chr2 (215394..218216) [2823 bp, 940 aa] {ON} Anc_5.7...    30   6.4  
YFL056C Chr6 complement(14793..15431) [639 bp, 212 aa] {ON}  AAD...    30   8.4  

>Smik_15.298 Chr15 (512239..513177) [939 bp, 312 aa] {ON} YOR120W
           (REAL)
          Length = 312

 Score =  642 bits (1655), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/312 (100%), Positives = 312/312 (100%)

Query: 1   MSTTLHDSTKTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNED 60
           MSTTLHDSTKTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNED
Sbjct: 1   MSTTLHDSTKTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNED 60

Query: 61  QVGQAIKDSGVPREEIFVTTKLWSTQHHEPAKALDESLQRLGLDYVDLYLIHWPARLDTN 120
           QVGQAIKDSGVPREEIFVTTKLWSTQHHEPAKALDESLQRLGLDYVDLYLIHWPARLDTN
Sbjct: 61  QVGQAIKDSGVPREEIFVTTKLWSTQHHEPAKALDESLQRLGLDYVDLYLIHWPARLDTN 120

Query: 121 YIKDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDLL 180
           YIKDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDLL
Sbjct: 121 YIKDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDLL 180

Query: 181 ASPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKIAK 240
           ASPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKIAK
Sbjct: 181 ASPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKIAK 240

Query: 241 KNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFTLSNEDFEAINNISKEKGEKRV 300
           KNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFTLSNEDFEAINNISKEKGEKRV
Sbjct: 241 KNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFTLSNEDFEAINNISKEKGEKRV 300

Query: 301 VNPNWSPFEAFK 312
           VNPNWSPFEAFK
Sbjct: 301 VNPNWSPFEAFK 312

>Suva_8.173 Chr8 (308911..309849) [939 bp, 312 aa] {ON} YOR120W
           (REAL)
          Length = 312

 Score =  583 bits (1503), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/312 (88%), Positives = 297/312 (95%)

Query: 1   MSTTLHDSTKTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNED 60
           MS TL  STKTL LNTGA+IPQVGLGTWQSKDNDAYKSV+AALK GY+HIDTAAIY NED
Sbjct: 1   MSATLQYSTKTLPLNTGAKIPQVGLGTWQSKDNDAYKSVVAALKDGYRHIDTAAIYGNED 60

Query: 61  QVGQAIKDSGVPREEIFVTTKLWSTQHHEPAKALDESLQRLGLDYVDLYLIHWPARLDTN 120
           QVGQAIKDSGVPREEIFVTTKLW TQHHEPAKALD+SL+RLGLDYVDLYL+HWP RLD N
Sbjct: 61  QVGQAIKDSGVPREEIFVTTKLWCTQHHEPAKALDQSLKRLGLDYVDLYLMHWPVRLDPN 120

Query: 121 YIKDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDLL 180
           YIKDG ILS+PTK DGSR VD+TNWNFIKTWELMQELPKT KT+A+GVSNFSINNLKDLL
Sbjct: 121 YIKDGHILSIPTKEDGSRPVDITNWNFIKTWELMQELPKTNKTRAVGVSNFSINNLKDLL 180

Query: 181 ASPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKIAK 240
           ASPGN+LTPAANQVE+HPLLPQNELI+FCKSK IM+EAYSPLGSTDAPLLKEP +L+IAK
Sbjct: 181 ASPGNQLTPAANQVELHPLLPQNELIDFCKSKGIMVEAYSPLGSTDAPLLKEPVVLEIAK 240

Query: 241 KNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFTLSNEDFEAINNISKEKGEKRV 300
           KNNVQPGHVVISWHAQRGYVVLPKSVNPDRI+TNRK+FTLS+EDFEAINNISKEKGEKRV
Sbjct: 241 KNNVQPGHVVISWHAQRGYVVLPKSVNPDRIKTNRKVFTLSDEDFEAINNISKEKGEKRV 300

Query: 301 VNPNWSPFEAFK 312
           VNP+WSPFEAFK
Sbjct: 301 VNPDWSPFEAFK 312

>YOR120W Chr15 (551114..552052) [939 bp, 312 aa] {ON}  GCY1Putative
           NADP(+) coupled glycerol dehydrogenase, proposed to be
           involved in an alternative pathway for glycerol
           catabolism; also has mRNA binding activity; member of
           the aldo-keto reductase (AKR) family
          Length = 312

 Score =  581 bits (1498), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/312 (89%), Positives = 294/312 (94%)

Query: 1   MSTTLHDSTKTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNED 60
           M  TLHDSTK LSLNTGAQIPQ+GLGTWQSK+NDAYK+VL ALK GY+HIDTAAIYRNED
Sbjct: 1   MPATLHDSTKILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNED 60

Query: 61  QVGQAIKDSGVPREEIFVTTKLWSTQHHEPAKALDESLQRLGLDYVDLYLIHWPARLDTN 120
           QVGQAIKDSGVPREEIFVTTKLW TQHHEP  ALD+SL+RLGLDYVDLYL+HWPARLD  
Sbjct: 61  QVGQAIKDSGVPREEIFVTTKLWCTQHHEPEVALDQSLKRLGLDYVDLYLMHWPARLDPA 120

Query: 121 YIKDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDLL 180
           YIK+ DILSVPTK DGSRAVD+TNWNFIKTWELMQELPKTGKTKA+GVSNFSINNLKDLL
Sbjct: 121 YIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDLL 180

Query: 181 ASPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKIAK 240
           AS GNKLTPAANQVEIHPLLPQ+ELINFCKSK I++EAYSPLGSTDAPLLKEP IL+IAK
Sbjct: 181 ASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIAK 240

Query: 241 KNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFTLSNEDFEAINNISKEKGEKRV 300
           KNNVQPGHVVISWH QRGYVVLPKSVNPDRI+TNRKIFTLS EDFEAINNISKEKGEKRV
Sbjct: 241 KNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTEDFEAINNISKEKGEKRV 300

Query: 301 VNPNWSPFEAFK 312
           V+PNWSPFE FK
Sbjct: 301 VHPNWSPFEVFK 312

>Skud_15.283 Chr15 (507542..508480) [939 bp, 312 aa] {ON} YOR120W
           (REAL)
          Length = 312

 Score =  580 bits (1496), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/312 (88%), Positives = 294/312 (94%)

Query: 1   MSTTLHDSTKTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNED 60
           M  TL DST+TLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALK GY+HIDTAAIYRNED
Sbjct: 1   MPATLQDSTRTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNED 60

Query: 61  QVGQAIKDSGVPREEIFVTTKLWSTQHHEPAKALDESLQRLGLDYVDLYLIHWPARLDTN 120
           QVGQAI+DSGVPRE+IFVTTKLW TQHHEPAKALD+SL+RLGLDYVDLYL+HWP RLD +
Sbjct: 61  QVGQAIRDSGVPREKIFVTTKLWCTQHHEPAKALDQSLRRLGLDYVDLYLMHWPVRLDPD 120

Query: 121 YIKDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDLL 180
           YIKDG+ILSVPTK DGSRAVD+TNWNFIKTWELMQELPKTGK KA+GVSNFSINNLKDLL
Sbjct: 121 YIKDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDLL 180

Query: 181 ASPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKIAK 240
           AS GNKLTPAANQVEIHPLLPQNELI+FC+ K IMIE YSPLGSTDAPLLKEP IL+IAK
Sbjct: 181 ASKGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIAK 240

Query: 241 KNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFTLSNEDFEAINNISKEKGEKRV 300
           KNNVQP HVVISWHAQRGYVVLPKSVNPDR++ NRKIFTLS+EDFEAIN ISK KGEKRV
Sbjct: 241 KNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFTLSDEDFEAINGISKAKGEKRV 300

Query: 301 VNPNWSPFEAFK 312
           V+PNWSPFEAFK
Sbjct: 301 VHPNWSPFEAFK 312

>CAGL0I01100g Chr9 complement(91693..92625) [933 bp, 310 aa] {ON}
           highly similar to uniprot|P14065 Saccharomyces
           cerevisiae YOR120w GCY1 or uniprot|Q12458 Saccharomyces
           cerevisiae YDR368w YPR1
          Length = 310

 Score =  454 bits (1169), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 209/309 (67%), Positives = 256/309 (82%), Gaps = 1/309 (0%)

Query: 3   TTLHDSTKTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNEDQV 62
             LH +T TL LNTGA IP +GLGTWQS +N+ Y + L ALKAGY+HIDTAAIY+NE+++
Sbjct: 2   AALHKNTSTLKLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEEI 61

Query: 63  GQAIKDSGVPREEIFVTTKLWSTQHHEPAKALDESLQRLGLDYVDLYLIHWPARLDTNYI 122
           G+AI+DS +PR E+FVTTKLW TQH  P +ALD+SL+RLGLDYVDLYL+HWP  L T+ I
Sbjct: 62  GRAIRDSNIPRNELFVTTKLWGTQHRNPTEALDQSLKRLGLDYVDLYLMHWPVALKTDLI 121

Query: 123 KDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDLLAS 182
           KDG++L +P + DGSR VD+ +WNF+KTWELMQELPK  K +AIGVSNFSINNLK+LL S
Sbjct: 122 KDGNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKE-KARAIGVSNFSINNLKELLNS 180

Query: 183 PGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKIAKKN 242
            GNK+ PAANQ+EIHPLLPQ+ELINFCK K I++EAYSPLGSTDAP+LKE  I +IAKKN
Sbjct: 181 KGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIAKKN 240

Query: 243 NVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFTLSNEDFEAINNISKEKGEKRVVN 302
            V  G +VISWHAQRGYVVLPKSV P+RI  N++ F LS+EDF  ++N +K+ GE+RVV+
Sbjct: 241 GVNAGQLVISWHAQRGYVVLPKSVKPERIHGNQETFKLSDEDFATLSNYAKKHGERRVVS 300

Query: 303 PNWSPFEAF 311
           PNW PF+ F
Sbjct: 301 PNWGPFKPF 309

>NDAI0C01600 Chr3 complement(342011..342952) [942 bp, 313 aa] {ON}
           Anc_5.434
          Length = 313

 Score =  453 bits (1166), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 210/312 (67%), Positives = 260/312 (83%), Gaps = 1/312 (0%)

Query: 1   MSTTLHDSTKTLSLNTGAQIPQVGLGTWQS-KDNDAYKSVLAALKAGYKHIDTAAIYRNE 59
           M +TL +ST T  LNTGA IP VGLGTWQS  +N+ Y++V+ ALKAGY+HIDTAAIY+NE
Sbjct: 1   MGSTLKNSTATYKLNTGATIPAVGLGTWQSTNENEGYEAVMNALKAGYRHIDTAAIYKNE 60

Query: 60  DQVGQAIKDSGVPREEIFVTTKLWSTQHHEPAKALDESLQRLGLDYVDLYLIHWPARLDT 119
           DQVG+AI DSG+PREEIFVTTKLW TQH +P  AL++SL+RLGLDYVDLYL+HWP     
Sbjct: 61  DQVGKAINDSGIPREEIFVTTKLWGTQHRDPETALNQSLERLGLDYVDLYLMHWPVAFKP 120

Query: 120 NYIKDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDL 179
           + IKDG+  ++P   +G R +D+T WNF+KTWELMQELPKTGKT+A+GVSNFSINNLK L
Sbjct: 121 DSIKDGNYSTMPMLPNGQRDLDLTTWNFVKTWELMQELPKTGKTRAVGVSNFSINNLKAL 180

Query: 180 LASPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKIA 239
           L+SPGNKL PAANQVE HPLLPQ+EL  FCK K I++EAYSPLGST+AP+L EP I++IA
Sbjct: 181 LSSPGNKLVPAANQVEAHPLLPQDELQKFCKEKGIILEAYSPLGSTNAPILTEPKIIEIA 240

Query: 240 KKNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFTLSNEDFEAINNISKEKGEKR 299
           KK+NVQP  VVISWH Q+G+VVLPKSV+ +RI+ N + F LS ++ +++NN+SKEKGE+R
Sbjct: 241 KKHNVQPAQVVISWHVQKGHVVLPKSVHEERIKANFQTFELSKDEMDSLNNLSKEKGERR 300

Query: 300 VVNPNWSPFEAF 311
           +V PNW+PF  F
Sbjct: 301 IVQPNWAPFVPF 312

>KNAG0C04910 Chr3 complement(949367..950308) [942 bp, 313 aa] {ON}
           Anc_5.434 YOR120W
          Length = 313

 Score =  452 bits (1163), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 211/312 (67%), Positives = 256/312 (82%), Gaps = 1/312 (0%)

Query: 1   MSTTLHDSTKTLSLNTGAQIPQVGLGTWQSKD-NDAYKSVLAALKAGYKHIDTAAIYRNE 59
           MS TL  +T  L LNTGA I  +GLGTW+S    DAY SV+AAL+AGY+HIDTAAIY NE
Sbjct: 1   MSATLSKNTSLLKLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNE 60

Query: 60  DQVGQAIKDSGVPREEIFVTTKLWSTQHHEPAKALDESLQRLGLDYVDLYLIHWPARLDT 119
            +VG+AI++SGVPR EIFVTTKLW TQH EP  ALD+SL+RLGLDYVDLYL+HWP R+  
Sbjct: 61  AEVGRAIRESGVPRGEIFVTTKLWCTQHKEPELALDQSLKRLGLDYVDLYLMHWPVRMRG 120

Query: 120 NYIKDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDL 179
             + +GD +  PT  +G R +D+T+WNF+KTWELMQ+LP+TGKT+AIGVSNFSINNLKDL
Sbjct: 121 ENMPEGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINNLKDL 180

Query: 180 LASPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKIA 239
           LASPGNK+ PAANQVE+HPLLPQ EL++FC  K I+IEAYSPLGS DAP+LKEP I++IA
Sbjct: 181 LASPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIEIA 240

Query: 240 KKNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFTLSNEDFEAINNISKEKGEKR 299
           KKN V    VVISW+ QRGY+VLPKSVN +RIE N   FTL++EDFEA+NNISK +G KR
Sbjct: 241 KKNGVSAAQVVISWNVQRGYIVLPKSVNKERIEANLLTFTLTSEDFEAVNNISKVQGTKR 300

Query: 300 VVNPNWSPFEAF 311
           +++P+W PF+ F
Sbjct: 301 IIDPDWEPFKPF 312

>NCAS0H02060 Chr8 (400615..401583) [969 bp, 322 aa] {ON} Anc_5.434
          Length = 322

 Score =  443 bits (1139), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 205/306 (66%), Positives = 251/306 (82%), Gaps = 1/306 (0%)

Query: 7   DSTKTLSLNTGAQIPQVGLGTWQS-KDNDAYKSVLAALKAGYKHIDTAAIYRNEDQVGQA 65
           +ST T  LNTGA I  VGLGTWQS  +N+ Y++V+AALKAGY+HIDTAAIY NE QVG+A
Sbjct: 16  NSTTTFKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQVGKA 75

Query: 66  IKDSGVPREEIFVTTKLWSTQHHEPAKALDESLQRLGLDYVDLYLIHWPARLDTNYIKDG 125
           I DSGVPREEIFVTTKLWSTQHH+PA  L++SL+RLGLDYVDLYL+HWP  L+   IKDG
Sbjct: 76  INDSGVPREEIFVTTKLWSTQHHDPAAGLNDSLKRLGLDYVDLYLMHWPVTLNPRSIKDG 135

Query: 126 DILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDLLASPGN 185
           + LS+P   DG R V++  W+++KTWELMQELPKTGKT+A+GVSNFSINNLK +L+SPGN
Sbjct: 136 NFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKKVLSSPGN 195

Query: 186 KLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKIAKKNNVQ 245
           K+ PA NQVEIHPLLPQ EL+ +C SK I++EAYSPLGST+AP+L EP ++ +AKK+ VQ
Sbjct: 196 KVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTEPVLINLAKKHGVQ 255

Query: 246 PGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFTLSNEDFEAINNISKEKGEKRVVNPNW 305
              +VISWH QRGY+VLPKSV+ +RI+ N K   LS+E+   INNISKEKGE+R+V P+W
Sbjct: 256 TAQIVISWHVQRGYIVLPKSVHAERIQANFKTLKLSDEEMREINNISKEKGERRIVQPHW 315

Query: 306 SPFEAF 311
            PF  F
Sbjct: 316 EPFVPF 321

>SAKL0G02530g Chr7 (208952..209890) [939 bp, 312 aa] {ON} similar to
           uniprot|Q12458 Saccharomyces cerevisiae YDR368W YPR1
           2-methylbutyraldehyde reductase may be involved in
           isoleucine catabolism
          Length = 312

 Score =  439 bits (1128), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 208/312 (66%), Positives = 251/312 (80%)

Query: 1   MSTTLHDSTKTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNED 60
           MS  L +S+ T+ LNTGA IPQ+GLGTW+S D +AY SVL+A+K GY+HID+AAIY NE+
Sbjct: 1   MSIQLKNSSATVKLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEE 60

Query: 61  QVGQAIKDSGVPREEIFVTTKLWSTQHHEPAKALDESLQRLGLDYVDLYLIHWPARLDTN 120
            VG+AI+DSGVPR E+FVTTKLW TQ   P KALD SL+RLGLDYVDLYLIHWP    T+
Sbjct: 61  PVGKAIRDSGVPRNELFVTTKLWGTQQRNPEKALDASLKRLGLDYVDLYLIHWPIAFKTD 120

Query: 121 YIKDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDLL 180
            IKD D L+VPT  DG   VDV +WNF+KTWEL+QELP TGK KA+GVSNFS+NNLK+LL
Sbjct: 121 NIKDDDYLTVPTGKDGKADVDVKDWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKELL 180

Query: 181 ASPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKIAK 240
           ASPGNKL PA NQVE+HPLLPQ+ELI F KSK I+IEAYSPLGS  +PLLKEP I+++AK
Sbjct: 181 ASPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVIIEVAK 240

Query: 241 KNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFTLSNEDFEAINNISKEKGEKRV 300
           K  V+P  V+I+W  QRGYV+LPKSVNP R+E+N K+F LS ED + I+ ISKE+G KR 
Sbjct: 241 KYGVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFDLSKEDVDRIHKISKEQGVKRF 300

Query: 301 VNPNWSPFEAFK 312
           V+P+W  F  F+
Sbjct: 301 VHPDWPSFPIFE 312

>Suva_2.540 Chr2 (964433..965371) [939 bp, 312 aa] {ON} YDR368W
           (REAL)
          Length = 312

 Score =  438 bits (1127), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 205/312 (65%), Positives = 249/312 (79%)

Query: 1   MSTTLHDSTKTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNED 60
           M  TL +S+ TL LNTGA IP +G GTW+S DN  Y SV+AALKAGY+HID AAIY NE+
Sbjct: 1   MPATLKNSSATLKLNTGASIPVLGFGTWRSVDNSGYHSVIAALKAGYRHIDAAAIYLNEE 60

Query: 61  QVGQAIKDSGVPREEIFVTTKLWSTQHHEPAKALDESLQRLGLDYVDLYLIHWPARLDTN 120
           +VG+AIKDSGVPREEIF+TTKLW T+  +P  ALD+SL+RLGLDYVDLYL+HWP  L T+
Sbjct: 61  EVGKAIKDSGVPREEIFITTKLWGTEQRDPEAALDKSLKRLGLDYVDLYLMHWPVPLKTD 120

Query: 121 YIKDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDLL 180
            I DGD L +PT  DG+  VD   WNF+KTW+LMQ+LPKTGKTKA+GVSNFSINN+K+LL
Sbjct: 121 TITDGDFLCIPTLEDGTIDVDTKEWNFVKTWDLMQKLPKTGKTKAVGVSNFSINNIKELL 180

Query: 181 ASPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKIAK 240
            SP NKL PA NQ+EIHPLLPQ+ELI FCK K I++EAYSP GS +APLLKE  I+ +AK
Sbjct: 181 KSPSNKLVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAK 240

Query: 241 KNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFTLSNEDFEAINNISKEKGEKRV 300
           K+ V+P  ++ISW  QRGYVVL KSVNP+R+ +N KIFTL  +DF+ I+N+SK  GEKRV
Sbjct: 241 KHGVEPAQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKTISNLSKVHGEKRV 300

Query: 301 VNPNWSPFEAFK 312
           VN  W+ F  F+
Sbjct: 301 VNMQWNSFPIFE 312

>Smik_4.634 Chr4 (1133924..1134862) [939 bp, 312 aa] {ON} YDR368W
           (REAL)
          Length = 312

 Score =  437 bits (1123), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 206/312 (66%), Positives = 249/312 (79%)

Query: 1   MSTTLHDSTKTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNED 60
           M  TL +S+ +L LNTGA IP +G GTW+S +N+ Y SV+AALKAGY+HID AAIY NE+
Sbjct: 1   MPATLKNSSASLKLNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEE 60

Query: 61  QVGQAIKDSGVPREEIFVTTKLWSTQHHEPAKALDESLQRLGLDYVDLYLIHWPARLDTN 120
           +VG+AIKDSGVPRE+IF+TTKLW T+  +P  AL+ESL+RLGLDYVDLYL+HWP  L T 
Sbjct: 61  EVGRAIKDSGVPREDIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTE 120

Query: 121 YIKDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDLL 180
            I DG++L +PT  DG+  VD   WNFIKTW+LMQELPKTGKTKA+GVSNFSINN+K LL
Sbjct: 121 TITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKALL 180

Query: 181 ASPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKIAK 240
            SP NKL PAANQ+EIHPLLPQNELI FCK K I++EAYSP GS +APLL+E  I+ +AK
Sbjct: 181 ESPSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQAIIDMAK 240

Query: 241 KNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFTLSNEDFEAINNISKEKGEKRV 300
           K+ V P  ++ISW  QRGYVVL KSVNP+RI +N KIFTL  +DF+ I+N+SK  GEKRV
Sbjct: 241 KHGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKIISNLSKVHGEKRV 300

Query: 301 VNPNWSPFEAFK 312
           V+  WS F  FK
Sbjct: 301 VDMKWSSFPIFK 312

>Skud_4.637 Chr4 (1136769..1137707) [939 bp, 312 aa] {ON} YDR368W
           (REAL)
          Length = 312

 Score =  436 bits (1120), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 202/312 (64%), Positives = 249/312 (79%)

Query: 1   MSTTLHDSTKTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNED 60
           M  TL +S+ TL LNTGA IP +G GTW+S DN+ Y SV+AALK GY+HID AAIY NE+
Sbjct: 1   MPATLRNSSATLKLNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEE 60

Query: 61  QVGQAIKDSGVPREEIFVTTKLWSTQHHEPAKALDESLQRLGLDYVDLYLIHWPARLDTN 120
           +VG+AIKDSG+ REEIF+TTKLW T+  +P  AL+ESL+RLGLDYVDLYL+HWP  L T+
Sbjct: 61  EVGRAIKDSGIAREEIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTD 120

Query: 121 YIKDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDLL 180
            + DG++L +PT  DG+  VD   WNFIKTW+LMQELPKTGKT+A+GVSNFSINN+K+LL
Sbjct: 121 TVTDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKELL 180

Query: 181 ASPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKIAK 240
            SP NKL PA NQVEIHPLLPQ+ELI FCK K I++EAYSP GS +APLLKE  I+ +AK
Sbjct: 181 KSPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAK 240

Query: 241 KNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFTLSNEDFEAINNISKEKGEKRV 300
           K+ V+P  ++ISW  QRGYVVL KSVNP+R+ +N KIFTL  +DF+AI ++SK  GEKRV
Sbjct: 241 KHGVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKAIGDLSKVHGEKRV 300

Query: 301 VNPNWSPFEAFK 312
           VN  W+ F  F+
Sbjct: 301 VNMKWASFPIFE 312

>CAGL0A02816g Chr1 (296851..297783) [933 bp, 310 aa] {ON} highly
           similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368w YPR1
          Length = 310

 Score =  434 bits (1115), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 206/309 (66%), Positives = 245/309 (79%)

Query: 4   TLHDSTKTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNEDQVG 63
           +L +ST TL LNTGA+IP VGLGTW+S  ND Y SVLAALK GY+HID AAIY NEDQVG
Sbjct: 2   SLKNSTATLKLNTGAEIPVVGLGTWRSAANDGYDSVLAALKLGYRHIDAAAIYGNEDQVG 61

Query: 64  QAIKDSGVPREEIFVTTKLWSTQHHEPAKALDESLQRLGLDYVDLYLIHWPARLDTNYIK 123
           +AIKDSGVPR+EIF+TTKLW T+H  PAKALD SL+RLGLDYVDLYL+HWP  L  +  +
Sbjct: 62  RAIKDSGVPRQEIFITTKLWGTEHRNPAKALDSSLKRLGLDYVDLYLMHWPVALKAHGSE 121

Query: 124 DGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDLLASP 183
           + D+L++P K DG   +D+ +W+FIKTWELMQELPKTGKTKAIGVSNFSINNLK L  SP
Sbjct: 122 EKDLLNIPKKPDGKTDIDIEDWDFIKTWELMQELPKTGKTKAIGVSNFSINNLKALKNSP 181

Query: 184 GNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKIAKKNN 243
                PAANQVEIHPL PQ ELI +CKS+ I+IEAYSP GS DAP+LKEP + K+A+K N
Sbjct: 182 KFNTVPAANQVEIHPLFPQTELIEYCKSENILIEAYSPFGSADAPVLKEPELHKLAEKYN 241

Query: 244 VQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFTLSNEDFEAINNISKEKGEKRVVNP 303
           +    ++ISW  QRGYVVLPKSV+ +RIE N K+ TL +ED E I N+SK KGEKR+V  
Sbjct: 242 ISTAQLIISWSVQRGYVVLPKSVHAERIEANLKVLTLKDEDMETITNLSKVKGEKRLVQL 301

Query: 304 NWSPFEAFK 312
           +WSPF  F+
Sbjct: 302 DWSPFPTFE 310

>YDR368W Chr4 (1213904..1214842) [939 bp, 312 aa] {ON}
           YPR1NADPH-dependent aldo-keto reductase, reduces
           multiple substrates including 2-methylbutyraldehyde and
           D,L-glyceraldehyde, expression is induced by osmotic and
           oxidative stress; functionally redundant with other
           aldo-keto reductases
          Length = 312

 Score =  434 bits (1115), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 202/312 (64%), Positives = 249/312 (79%)

Query: 1   MSTTLHDSTKTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNED 60
           M  TL +S+ TL LNTGA IP +G GTW+S DN+ Y SV+AALKAGY+HID AAIY NE+
Sbjct: 1   MPATLKNSSATLKLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEE 60

Query: 61  QVGQAIKDSGVPREEIFVTTKLWSTQHHEPAKALDESLQRLGLDYVDLYLIHWPARLDTN 120
           +VG+AIKDSGVPREEIF+TTKLW T+  +P  AL++SL+RLGLDYVDLYL+HWP  L T+
Sbjct: 61  EVGRAIKDSGVPREEIFITTKLWGTEQRDPEAALNKSLKRLGLDYVDLYLMHWPVPLKTD 120

Query: 121 YIKDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDLL 180
            + DG++L +PT  DG+  +D   WNFIKTWELMQELPKTGKTKA+GVSNFSINN+K+LL
Sbjct: 121 RVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKELL 180

Query: 181 ASPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKIAK 240
            SP NK+ PA NQ+EIHPLLPQ+ELI FCK K I++EAYSP GS +APLLKE  I+ +AK
Sbjct: 181 ESPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAK 240

Query: 241 KNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFTLSNEDFEAINNISKEKGEKRV 300
           K+ V+P  ++ISW  QRGYVVL KSVNP+RI +N KIFTL  +DF+ I+N+SK  G KRV
Sbjct: 241 KHGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKTISNLSKVHGTKRV 300

Query: 301 VNPNWSPFEAFK 312
           V+  W  F  F+
Sbjct: 301 VDMKWGSFPIFQ 312

>NCAS0F03380 Chr6 (682072..683013) [942 bp, 313 aa] {ON} Anc_5.434
          Length = 313

 Score =  419 bits (1076), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 207/313 (66%), Positives = 253/313 (80%), Gaps = 1/313 (0%)

Query: 1   MSTTLHDSTKTLSLNTGAQIPQVGLGTWQS-KDNDAYKSVLAALKAGYKHIDTAAIYRNE 59
           M+ TL  ST TL LNTGA IP++ LGTW+S    D Y SV+AALKAGY+HIDTAAIY NE
Sbjct: 1   MTVTLKASTATLKLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNE 60

Query: 60  DQVGQAIKDSGVPREEIFVTTKLWSTQHHEPAKALDESLQRLGLDYVDLYLIHWPARLDT 119
           DQVG+AI+DSG+PREEIFVT+KLW+TQ H PA AL ++L RLGLDY+DLYL+HWP   +T
Sbjct: 61  DQVGKAIRDSGIPREEIFVTSKLWNTQQHNPAGALKDTLSRLGLDYLDLYLMHWPVTFNT 120

Query: 120 NYIKDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDL 179
             +K  D + +P   +G   +++  WNF+KTWELMQELP TG TKA+GVSNFSINNLK+L
Sbjct: 121 RNVKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKEL 180

Query: 180 LASPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKIA 239
           L SPGNKLTPAANQ+EIHPLLP+++LI FC+ K IMIEAYSPLGS +AP+LKEP I++I+
Sbjct: 181 LTSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKIIEIS 240

Query: 240 KKNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFTLSNEDFEAINNISKEKGEKR 299
           KK +V P  ++ISWH QRGYVVL KS + +RI  NRK+FTLS EDFEAI N++KEKG  R
Sbjct: 241 KKLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFTLSKEDFEAIKNLAKEKGTLR 300

Query: 300 VVNPNWSPFEAFK 312
           VV+P+WSPF  FK
Sbjct: 301 VVDPDWSPFPLFK 313

>KAFR0E03840 Chr5 complement(763027..763959) [933 bp, 310 aa] {ON}
           Anc_5.434 YOR120W
          Length = 310

 Score =  418 bits (1074), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 200/312 (64%), Positives = 246/312 (78%), Gaps = 4/312 (1%)

Query: 1   MSTTLHDSTKTLSLNTGAQIPQVGLGTWQSKD-NDAYKSVLAALKAGYKHIDTAAIYRNE 59
           MS  L +STKTL LN G+QIP VGLGTWQ+ D  DAY +V AAL AGY+HIDTAAIY+NE
Sbjct: 1   MSANLKNSTKTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNE 60

Query: 60  DQVGQAIKDSGVPREEIFVTTKLWSTQHHEPAKALDESLQRLGLDYVDLYLIHWPARLDT 119
            QVG+AI+DSGVPREEIFVTTKLW+ QHHEP  ALDESLQRLGLDYVDLYL+HWP  LD 
Sbjct: 61  VQVGEAIRDSGVPREEIFVTTKLWNAQHHEPEVALDESLQRLGLDYVDLYLMHWPVSLDK 120

Query: 120 NYIKDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDL 179
           +Y+K+   L +  + DG+R V+ T+W FI TWELMQ+LPK  K ++IGVSNFS+NNLKDL
Sbjct: 121 SYMKESP-LELMKRPDGTRPVE-TDWTFINTWELMQKLPK-NKVRSIGVSNFSVNNLKDL 177

Query: 180 LASPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKIA 239
           L +P   + P  NQVE+HPLLPQ EL+++C+  KI +EAYSPLGST APLL EP ++ +A
Sbjct: 178 LKAPTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIVIDVA 237

Query: 240 KKNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFTLSNEDFEAINNISKEKGEKR 299
           KKN VQP HVV+SW  QR  +VLPKSV+ +R+  N K FTL  EDF+AI  IS+++GE+R
Sbjct: 238 KKNGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKTFTLPEEDFDAIGKISQQRGERR 297

Query: 300 VVNPNWSPFEAF 311
           + NPN+ PF+ F
Sbjct: 298 INNPNFEPFKTF 309

>TBLA0A02825 Chr1 complement(681691..682626) [936 bp, 311 aa] {ON}
          Length = 311

 Score =  415 bits (1067), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 198/312 (63%), Positives = 239/312 (76%), Gaps = 1/312 (0%)

Query: 1   MSTTLHDSTKTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNED 60
           MS  L + T T+ LNTGA IP +GLGTW+S++ND Y SV+AA K GY+HIDTAAIY NED
Sbjct: 1   MSAALKNCTATVKLNTGANIPAIGLGTWRSENNDGYDSVIAAAKVGYRHIDTAAIYGNED 60

Query: 61  QVGQAIKDSGVPREEIFVTTKLWSTQHHEPAKALDESLQRLGLDYVDLYLIHWPARLDTN 120
           QVG+AI + GV R E+FVTTKLW TQ  +P  AL++SL+RLGLDYVDLYLIHWP    T+
Sbjct: 61  QVGKAINECGVTRSELFVTTKLWGTQQRDPETALNQSLKRLGLDYVDLYLIHWPVAFKTD 120

Query: 121 YIKDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDLL 180
            IKDG++L++P K DG   +D   WNFIKTWELMQ L KTGKTKAIG+SNFSINN+K+LL
Sbjct: 121 TIKDGNLLTIP-KKDGEADIDYPEWNFIKTWELMQNLLKTGKTKAIGISNFSINNIKELL 179

Query: 181 ASPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKIAK 240
           A+P   +TPA NQVE+HPLLPQ+ELI FCK K I+IEAYSPLG  +AP+LK+ TI++IAK
Sbjct: 180 AAPTTTVTPACNQVEVHPLLPQDELIAFCKEKGIVIEAYSPLGGINAPVLKDETIIEIAK 239

Query: 241 KNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFTLSNEDFEAINNISKEKGEKRV 300
           +NNV  G VV SWH QRGYVVLPKSV   RI +N K FTLS++D   INN+ K KGE R 
Sbjct: 240 RNNVDAGQVVTSWHVQRGYVVLPKSVKESRIISNLKTFTLSDDDMTKINNLVKVKGENRT 299

Query: 301 VNPNWSPFEAFK 312
            +     F  F+
Sbjct: 300 CDLGIKGFPMFQ 311

>NDAI0B05670 Chr2 (1383187..1384143) [957 bp, 318 aa] {ON} Anc_5.434
          Length = 318

 Score =  410 bits (1055), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 198/312 (63%), Positives = 247/312 (79%), Gaps = 7/312 (2%)

Query: 8   STKTLSLNTGAQIPQVGLGTWQS-KDNDAYKSVLAALKAGYKHIDTAAIYRNEDQVGQAI 66
           S   L L+TGA IPQ+GLGTW+S   NDAY SV+AALK GY+HIDTAAIY NE QVG+AI
Sbjct: 7   SENILKLSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVGKAI 66

Query: 67  KDSGVPREEIFVTTKLWSTQHHEPAKALDESLQRLGLDYVDLYLIHWPARLDTNYIKDGD 126
           +DSGVPR EIFVT+KLW  Q H+P  AL+++L+RLGLDY+DLYL+HWP   +   IKD D
Sbjct: 67  RDSGVPRNEIFVTSKLWCAQTHDPKLALNQTLKRLGLDYIDLYLMHWPVTFNPRSIKDED 126

Query: 127 -----ILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDLLA 181
                 +++PT ++G+  V++  WNFIKTWELMQ LP++GKTKA+GVSNFSINNL DLLA
Sbjct: 127 GSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNLNDLLA 186

Query: 182 SPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKIAKK 241
           +   K+ PAANQ+E+HPLL QNEL+ +CK K I++EAYSP GS +AP+LK+ TI  IAKK
Sbjct: 187 ASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINAPILKDETINAIAKK 246

Query: 242 NNVQPGHVVISWHAQR-GYVVLPKSVNPDRIETNRKIFTLSNEDFEAINNISKEKGEKRV 300
            ++Q G VV+SWH QR GYVVLPKSV+ +RI  NRK+ TL +EDF+AINN+ KEKGE RV
Sbjct: 247 LDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKVVTLPDEDFQAINNLVKEKGELRV 306

Query: 301 VNPNWSPFEAFK 312
           V+P+WSPF  FK
Sbjct: 307 VDPDWSPFPLFK 318

>ZYRO0F10032g Chr6 (813814..814746) [933 bp, 310 aa] {ON}
           uniprot|Q9HGX9 Zygosaccharomyces rouxii ZGCY2 Glycerol
           dehydrogenase
          Length = 310

 Score =  409 bits (1052), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 196/310 (63%), Positives = 239/310 (77%), Gaps = 1/310 (0%)

Query: 3   TTLHDSTKTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNEDQV 62
            TL +ST TL LNTG  IPQVGLGTW+SK+N+ YK+V+ ALKAGY+HID AA+Y NE +V
Sbjct: 2   VTLQNSTSTLKLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGEV 61

Query: 63  GQAIKDSGVPREEIFVTTKLWSTQHHEPAKALDESLQRLGLDYVDLYLIHWPARLDTNYI 122
           G+AI+DSGVPR EIF+TTKLW TQ   P +ALD+SLQRLGLDYVDLYLIHWP  L T  I
Sbjct: 62  GKAIQDSGVPRNEIFLTTKLWCTQQRNPQEALDQSLQRLGLDYVDLYLIHWPVPLRTENI 121

Query: 123 KDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDLLAS 182
           KDG++     K DGS+ VD+  WNFIKTWELMQ+L ++GKTKAIGVSNFS+NNLKDLLA+
Sbjct: 122 KDGNLFQFAEKPDGSKDVDL-EWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLLAA 180

Query: 183 PGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKIAKKN 242
           P  K+TPA NQVE+HPLLPQ +LI F K   I+IEAYSPLG  +AP+L +PT+ +IAK N
Sbjct: 181 PTTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDPTVQEIAKAN 240

Query: 243 NVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFTLSNEDFEAINNISKEKGEKRVVN 302
            V+ GHVVISW  Q+G V LPKSV P RI  N K+ TLS+ D   ++ + K KGE+R   
Sbjct: 241 GVEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTLSDSDVAKVDGLLKAKGERRTCY 300

Query: 303 PNWSPFEAFK 312
            ++SPF  F+
Sbjct: 301 QDFSPFPIFQ 310

>TDEL0E01910 Chr5 complement(361621..362556) [936 bp, 311 aa] {ON}
           Anc_5.434 YOR120W
          Length = 311

 Score =  408 bits (1049), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 192/312 (61%), Positives = 242/312 (77%), Gaps = 1/312 (0%)

Query: 1   MSTTLHDSTKTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNED 60
           MS TL ++T T+ LNTG  IPQVGLGTW+SK+ D YK+V AALKAGY+HID AAIY NE+
Sbjct: 1   MSATLSNNTSTVKLNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEE 60

Query: 61  QVGQAIKDSGVPREEIFVTTKLWSTQHHEPAKALDESLQRLGLDYVDLYLIHWPARLDTN 120
           +VG+AI+DSG+PREE+F+TTKLW+TQ   P +AL++SL+RLGL+YVDLYL+HWP  L T 
Sbjct: 61  EVGKAIRDSGIPREELFITTKLWNTQQRNPQEALEQSLERLGLEYVDLYLMHWPVPLKTK 120

Query: 121 YIKDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDLL 180
            I DG++LS P K DG   VD T W+F+KTWELMQELPKT K +++GVSNFSINNLK+LL
Sbjct: 121 RITDGNLLSSPAKEDGKPDVD-TEWDFVKTWELMQELPKTKKARSVGVSNFSINNLKELL 179

Query: 181 ASPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKIAK 240
           ASPGNKL PA  QVEIHPLLPQ  L +FCK   I +EAYSPLG   AP+L +P I +IA 
Sbjct: 180 ASPGNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIAD 239

Query: 241 KNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFTLSNEDFEAINNISKEKGEKRV 300
           ++N   G+VV+SW  QRG V LPKS  P+R+ +N + F LS+E+  +INN+SK +G+KR 
Sbjct: 240 RHNADAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRTFKLSDEEMGSINNLSKSRGQKRT 299

Query: 301 VNPNWSPFEAFK 312
             P+ SPF  F+
Sbjct: 300 NAPDMSPFPLFE 311

>Kpol_1062.29 s1062 complement(63895..64830) [936 bp, 311 aa] {ON}
           complement(63895..64830) [936 nt, 312 aa]
          Length = 311

 Score =  407 bits (1047), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 193/309 (62%), Positives = 238/309 (77%), Gaps = 1/309 (0%)

Query: 4   TLHDSTKTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNEDQVG 63
           +L +    + LNTGA++P VGLGTWQS +NDAYK+VL ALK GY+HID AAIY NE +VG
Sbjct: 2   SLKNCETRVKLNTGAELPAVGLGTWQSLENDAYKAVLTALKTGYRHIDGAAIYCNEGEVG 61

Query: 64  QAIKDSGVPREEIFVTTKLWSTQHHEPAKALDESLQRLGLDYVDLYLIHWPARLDTNYIK 123
           +AI+DSGVPR EIFVTTKLW TQ   P  AL++SL+RLGLDYVDLYLIHWP  L+    +
Sbjct: 62  KAIRDSGVPRNEIFVTTKLWGTQQRTPQLALEQSLERLGLDYVDLYLIHWPIPLNPAQCE 121

Query: 124 D-GDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDLLAS 182
           + G+ L+ P   +G R VD+  WNF+KTWELMQELP TGK KA+GVSNFSINN+K+LL+S
Sbjct: 122 ESGNYLTFPGLPNGKRDVDLDTWNFVKTWELMQELPATGKCKAVGVSNFSINNIKELLSS 181

Query: 183 PGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKIAKKN 242
           PGNKL PA NQ+E+HPLLPQ EL+NFCK K I++EAYSPLG T A +LKEP + ++AKK 
Sbjct: 182 PGNKLVPAVNQIELHPLLPQVELVNFCKEKGIVVEAYSPLGGTGAAILKEPLVEELAKKY 241

Query: 243 NVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFTLSNEDFEAINNISKEKGEKRVVN 302
           N+   ++V+SW  QRG VVLPKSV   RI +N +  TL+ ED E I N+SKEKGEKR   
Sbjct: 242 NIPAANLVVSWDVQRGVVVLPKSVTESRIISNLQTLTLAPEDVEKITNLSKEKGEKRTCA 301

Query: 303 PNWSPFEAF 311
           P++SPF  F
Sbjct: 302 PDFSPFNTF 310

>KAFR0E03850 Chr5 complement(764595..765530) [936 bp, 311 aa] {ON} 
          Length = 311

 Score =  406 bits (1044), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 195/313 (62%), Positives = 254/313 (81%), Gaps = 3/313 (0%)

Query: 1   MSTTLHDSTKTLSLNTGAQIPQVGLGTWQSKDN-DAYKSVLAALKAGYKHIDTAAIYRNE 59
           M++TL ++T TL LNTGA +P +GLGTW++ D+ + Y +V +AL+AGY+HIDTAAIY+NE
Sbjct: 1   MASTLQNTTTTLKLNTGASLPILGLGTWRATDDQEGYNAVKSALEAGYRHIDTAAIYQNE 60

Query: 60  DQVGQAIKDSGVPREEIFVTTKLWSTQHHEPAKALDESLQRLGLDYVDLYLIHWPARLDT 119
           + VG+AI++SG+PR+EIFVTTKLW TQH +PA ALD+SL+RLGLDYVDLYL+HWP  ++ 
Sbjct: 61  EVVGRAIRESGIPRDEIFVTTKLWGTQHRDPAAALDQSLERLGLDYVDLYLMHWPVPMEA 120

Query: 120 NYIKDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDL 179
            Y K   +L  P + DGS AV+ ++W+FIKTWELMQELPKT KT+AIGVSNFSINN+ DL
Sbjct: 121 KYSKSSSLLEFPYRPDGSLAVE-SDWDFIKTWELMQELPKT-KTRAIGVSNFSINNINDL 178

Query: 180 LASPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKIA 239
           L SPGNK+ PAANQVE+HPLLPQ EL+ FC+ K I++EAYSP GS  APLL E  I+++A
Sbjct: 179 LKSPGNKIVPAANQVELHPLLPQAELVTFCQEKGIVVEAYSPFGSVSAPLLSEQAIIEVA 238

Query: 240 KKNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFTLSNEDFEAINNISKEKGEKR 299
           KK++V    V++SWH +RG  VLPKSV+ +R+ +N K F+L  +DF  INN+SKEKGEKR
Sbjct: 239 KKHDVSAAQVILSWHIKRGIAVLPKSVHKERVVSNFKTFSLPEDDFATINNVSKEKGEKR 298

Query: 300 VVNPNWSPFEAFK 312
           VVN +WSPF+ F+
Sbjct: 299 VVNFDWSPFKIFE 311

>KLLA0B14707g Chr2 complement(1291951..1292883) [933 bp, 310 aa]
           {ON} similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368W YPR1 2-methylbutyraldehyde reductase may be
           involved in isoleucine catabolism
          Length = 310

 Score =  404 bits (1037), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 194/312 (62%), Positives = 241/312 (77%), Gaps = 2/312 (0%)

Query: 1   MSTTLHDSTKTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNED 60
           MST+  + + +L LNTGA IP VGLGTW+S + DAY +V++AL+ GY+HIDTAAIY NE+
Sbjct: 1   MSTS--NESPSLKLNTGASIPVVGLGTWKSPEEDAYNAVVSALQNGYRHIDTAAIYGNEE 58

Query: 61  QVGQAIKDSGVPREEIFVTTKLWSTQHHEPAKALDESLQRLGLDYVDLYLIHWPARLDTN 120
            VG+ I+DSGVPREEIFVTTKLW TQ  +P  ALD SLQRLGLDYVDLYLIHWP  L+ +
Sbjct: 59  AVGKGIRDSGVPREEIFVTTKLWGTQQRDPEAALDLSLQRLGLDYVDLYLIHWPVPLNAS 118

Query: 121 YIKDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDLL 180
            I DG+ L+ P  ADG   +D+  WNFIKTWE MQ LPK+GKTKAIGVSNFSI N++ LL
Sbjct: 119 SITDGNYLTFPRTADGKIDIDIEEWNFIKTWEKMQHLPKSGKTKAIGVSNFSIKNIEALL 178

Query: 181 ASPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKIAK 240
           A+  + + PAANQ+EIHP LPQ ELI++CKSK I+IEAYSPLGS+ + +L +PTI  IA 
Sbjct: 179 AANPDFIVPAANQIEIHPQLPQTELIDYCKSKGILIEAYSPLGSSSSTILTDPTIEGIAS 238

Query: 241 KNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFTLSNEDFEAINNISKEKGEKRV 300
           K N +P +++ISW A RGYVVLPKSVNP RI+TN K+  LS ED E IN +++  G KR 
Sbjct: 239 KYNAEPANILISWGASRGYVVLPKSVNPQRIKTNLKLLDLSTEDLEKINKLTESVGAKRY 298

Query: 301 VNPNWSPFEAFK 312
           V P++SPF  F+
Sbjct: 299 VAPDFSPFAIFE 310

>TBLA0A06510 Chr1 complement(1597737..1598675) [939 bp, 312 aa] {ON}
           Anc_5.434 YOR120W
          Length = 312

 Score =  403 bits (1036), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 190/312 (60%), Positives = 239/312 (76%)

Query: 1   MSTTLHDSTKTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNED 60
           M   L +S   ++LN G +IP VGLGTW+S++ND Y SV+ ALKAGY+HIDTAAIYRNE 
Sbjct: 1   MPAQLKNSDTYVTLNNGEKIPSVGLGTWKSQENDGYNSVIYALKAGYRHIDTAAIYRNEG 60

Query: 61  QVGQAIKDSGVPREEIFVTTKLWSTQHHEPAKALDESLQRLGLDYVDLYLIHWPARLDTN 120
           +VG+AIKDSGVPR++IF+TTKLW T+   P +AL+ SL+RLGLDYVDLYL+HWP  L+  
Sbjct: 61  EVGRAIKDSGVPRDQIFITTKLWCTEFQNPKRALESSLKRLGLDYVDLYLMHWPVVLNPR 120

Query: 121 YIKDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDLL 180
           YIKD D L VP   DG+R VD+  W++IKTWEL+QELP TG T+++GVSNFSINNL+ +L
Sbjct: 121 YIKDDDYLVVPRLPDGTRDVDMETWDYIKTWELVQELPATGLTRSVGVSNFSINNLEKVL 180

Query: 181 ASPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKIAK 240
           +SPGNKLTPA NQVE+HPLLPQ EL  +C SKKI +EAYSP GS +AP LK+ TI+ IA 
Sbjct: 181 SSPGNKLTPAVNQVELHPLLPQFELQKYCDSKKIKLEAYSPFGSDNAPNLKQKTIVDIAA 240

Query: 241 KNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFTLSNEDFEAINNISKEKGEKRV 300
           KN V P  V+ SW  QR  VVLPKSV+ +R+ +N K+F LS ED   I+ ++K  GEKR+
Sbjct: 241 KNGVSPAQVITSWIVQRDIVVLPKSVHEERVISNFKVFDLSKEDIAEIDALAKVNGEKRI 300

Query: 301 VNPNWSPFEAFK 312
             P+W PF  F+
Sbjct: 301 NKPDWDPFPVFE 312

>TPHA0E01760 Chr5 complement(354862..355794) [933 bp, 310 aa] {ON}
           Anc_5.434 YOR120W
          Length = 310

 Score =  402 bits (1033), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 197/309 (63%), Positives = 239/309 (77%), Gaps = 2/309 (0%)

Query: 4   TLHDSTKTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNEDQVG 63
           TL +ST  ++LN G Q+P VGLGTWQSK+NDAYK+V+AALKAGY+HIDTAAIY NE++VG
Sbjct: 2   TLSNSTAKVTLNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEVG 61

Query: 64  QAIKDSGVPREEIFVTTKLWSTQHHEPAKALDESLQRLGLDYVDLYLIHWPARL-DTNYI 122
           +AIKDSGV R EIFVTTKLW TQH  P  AL++SL+RLGLDYVDLYL+HWP  + D    
Sbjct: 62  RAIKDSGVRRSEIFVTTKLWGTQHRHPDDALNQSLERLGLDYVDLYLMHWPVPINDAQCK 121

Query: 123 KDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDLLAS 182
           KD + L +P   DG+R +D+ +W+FIKTWELMQ LPK+ K K+IGVSNFSINN+KDLLAS
Sbjct: 122 KDNNYLQIPMNEDGTRDLDLASWDFIKTWELMQALPKS-KVKSIGVSNFSINNIKDLLAS 180

Query: 183 PGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKIAKKN 242
           PGNK  P  NQVE+HPLLPQ EL+ FCKSK I++EAYSPLGST AP+L+  TI +++KK 
Sbjct: 181 PGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTINEVSKKL 240

Query: 243 NVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFTLSNEDFEAINNISKEKGEKRVVN 302
            + P +VV SW  QR  VVLPKSV   RI +N +   L  E+F  +NNIS E GEKR V 
Sbjct: 241 AIPPANVVFSWLIQRKIVVLPKSVTESRIISNLQTMELPAEEFSKLNNISSEVGEKRSVK 300

Query: 303 PNWSPFEAF 311
           PNW+PF  F
Sbjct: 301 PNWTPFIPF 309

>KLTH0E00220g Chr5 complement(12415..13335) [921 bp, 306 aa] {ON}
           similar to uniprot|P14065 Saccharomyces cerevisiae
           YOR120W GCY1 Putative NADP( ) coupled glycerol
           dehydrogenase proposed to be involved in an alternative
           pathway for glycerol catabolism
          Length = 306

 Score =  397 bits (1021), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 177/305 (58%), Positives = 243/305 (79%)

Query: 8   STKTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNEDQVGQAIK 67
           +T  L +NTG  IP +GLGTW++ D D Y++VLAAL++GY+HIDTAAIYRNE  VG+AI+
Sbjct: 2   ATLELQMNTGKPIPVLGLGTWKAADGDTYRAVLAALESGYRHIDTAAIYRNEAAVGRAIR 61

Query: 68  DSGVPREEIFVTTKLWSTQHHEPAKALDESLQRLGLDYVDLYLIHWPARLDTNYIKDGDI 127
           DSGVPRE+IFVTTKLW TQ  +P  AL+ SL+RLGLDYVDLYL+H+P  L T+ IKDG++
Sbjct: 62  DSGVPREKIFVTTKLWCTQQRDPQSALNASLERLGLDYVDLYLMHFPVALKTDLIKDGNV 121

Query: 128 LSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDLLASPGNKL 187
           LS+P +ADG+R VD+  W+F+KTW+LMQ+LPK+GKTKAIGVSNFSI N++++L       
Sbjct: 122 LSIPVRADGARDVDIDGWSFVKTWQLMQDLPKSGKTKAIGVSNFSIKNIEEILKPELGLS 181

Query: 188 TPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKIAKKNNVQPG 247
            PAANQ+EIHP LPQ+ELI +CKSK I++EAYSPLGS+++ +L +P ++K+A+K+ V+P 
Sbjct: 182 VPAANQIEIHPQLPQDELIEYCKSKGIIVEAYSPLGSSESSMLTDPDLIKLAEKHQVEPA 241

Query: 248 HVVISWHAQRGYVVLPKSVNPDRIETNRKIFTLSNEDFEAINNISKEKGEKRVVNPNWSP 307
            ++ISW   RGY +LPKSVN  R+++N KI  LS+ D + I+ I ++ G KR V+P+W+P
Sbjct: 242 QILISWGVTRGYCILPKSVNSKRVQSNLKIVKLSSNDVQQISKILEKLGSKRYVSPSWAP 301

Query: 308 FEAFK 312
           F  ++
Sbjct: 302 FPMYE 306

>KLTH0A00528g Chr1 complement(46253..47173) [921 bp, 306 aa] {ON}
           similar to uniprot|P14065 Saccharomyces cerevisiae
           YOR120W GCY1 Putative NADP( ) coupled glycerol
           dehydrogenase proposed to be involved in an alternative
           pathway for glycerol catabolism
          Length = 306

 Score =  397 bits (1021), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 177/305 (58%), Positives = 243/305 (79%)

Query: 8   STKTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNEDQVGQAIK 67
           +T  L +NTG  IP +GLGTW++ D D Y++VLAAL++GY+HIDTAAIYRNE  VG+AI+
Sbjct: 2   ATLELQMNTGKPIPVLGLGTWKAADGDTYRAVLAALESGYRHIDTAAIYRNEAAVGRAIR 61

Query: 68  DSGVPREEIFVTTKLWSTQHHEPAKALDESLQRLGLDYVDLYLIHWPARLDTNYIKDGDI 127
           DSGVPRE+IFVTTKLW TQ  +P  AL+ SL+RLGLDYVDLYL+H+P  L T+ IKDG++
Sbjct: 62  DSGVPREKIFVTTKLWCTQQRDPQSALNASLERLGLDYVDLYLMHFPVALKTDLIKDGNV 121

Query: 128 LSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDLLASPGNKL 187
           LS+P +ADG+R VD+  W+F+KTW+LMQ+LPK+GKTKAIGVSNFSI N++++L       
Sbjct: 122 LSIPVRADGARDVDIDGWSFVKTWQLMQDLPKSGKTKAIGVSNFSIKNIEEILKPELGLS 181

Query: 188 TPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKIAKKNNVQPG 247
            PAANQ+EIHP LPQ+ELI +CKSK I++EAYSPLGS+++ +L +P ++K+A+K+ V+P 
Sbjct: 182 VPAANQIEIHPQLPQDELIEYCKSKGIIVEAYSPLGSSESSMLTDPDLIKLAEKHQVEPA 241

Query: 248 HVVISWHAQRGYVVLPKSVNPDRIETNRKIFTLSNEDFEAINNISKEKGEKRVVNPNWSP 307
            ++ISW   RGY +LPKSVN  R+++N KI  LS+ D + I+ I ++ G KR V+P+W+P
Sbjct: 242 QILISWGVTRGYCILPKSVNSKRVQSNLKIVKLSSNDVQQISKILEKLGSKRYVSPSWAP 301

Query: 308 FEAFK 312
           F  ++
Sbjct: 302 FPMYE 306

>Kwal_47.18084 s47 complement(677816..678745) [930 bp, 309 aa] {ON}
           YOR120W (GCY1) - Similar to mammalian aldo/keto
           reductases [contig 198] FULL
          Length = 309

 Score =  393 bits (1010), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 185/304 (60%), Positives = 233/304 (76%), Gaps = 1/304 (0%)

Query: 5   LHDSTKTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNEDQVGQ 64
           L ++T    LNTGA IP +G GTW+S + + Y +VL+A+K GY+HID+AA+Y NE  VG+
Sbjct: 4   LKNNTDIGKLNTGATIPLLGFGTWRSTEEEGYNAVLSAIKDGYRHIDSAAVYGNEAAVGR 63

Query: 65  AIKDSGVPREEIFVTTKLWSTQHHEPAKALDESLQRLGLDYVDLYLIHWPARLDTNYIKD 124
           AI+DSGVPREE+FVTTKLW+TQ  EPAKALD+SLQRLGLDYVDLYLIHWP  + T+ I D
Sbjct: 64  AIRDSGVPREELFVTTKLWNTQQREPAKALDQSLQRLGLDYVDLYLIHWPLPIKTDRITD 123

Query: 125 GDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDLLASPG 184
           G++ S+PTK DG   VD T W++IKTW+LMQELP TGKT+A+GVSN S++ L+ LLA  G
Sbjct: 124 GNLFSIPTKEDGKPDVD-TEWDYIKTWQLMQELPSTGKTRAVGVSNVSVSQLEKLLADKG 182

Query: 185 NKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKIAKKNNV 244
           NK+ PA  QVE HPLLPQN+L++FC    I++EAYSPLGS  +PL+ EP I +IAKK N 
Sbjct: 183 NKVVPAVCQVETHPLLPQNKLLDFCTKHDILLEAYSPLGSQGSPLIDEPVIKEIAKKYNA 242

Query: 245 QPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFTLSNEDFEAINNISKEKGEKRVVNPN 304
            P  ++ISW  +RGYVVLPKSV P RI++N +   L +EDFE IN +  EKGEKRV +P 
Sbjct: 243 DPAQIIISWDIKRGYVVLPKSVTPSRIKSNLQTLDLEDEDFEKINKLHVEKGEKRVNDPE 302

Query: 305 WSPF 308
           W  F
Sbjct: 303 WFTF 306

>KLTH0A03476g Chr1 complement(298735..299661) [927 bp, 308 aa] {ON}
           similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368W YPR1 2-methylbutyraldehyde reductase may be
           involved in isoleucine catabolism
          Length = 308

 Score =  392 bits (1007), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 187/302 (61%), Positives = 230/302 (76%), Gaps = 2/302 (0%)

Query: 8   STKTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNEDQVGQAIK 67
           ST    LNTGA IP VGLGT+ S+D   YK+VL A+K GY+HID AA+Y+NED VG+AI+
Sbjct: 7   STSVGKLNTGASIPLVGLGTYLSEDETGYKAVLHAIKVGYRHIDCAALYKNEDFVGRAIR 66

Query: 68  DSGVPREEIFVTTKLWSTQHHEPAKALDESLQRLGLDYVDLYLIHWPARLDTNYIKDGDI 127
           DSGVPREE+FVTTK+W+TQH EPAKAL+ESL RLGLDYVDL+L+HWP  L T  I DG++
Sbjct: 67  DSGVPREELFVTTKVWNTQHREPAKALEESLSRLGLDYVDLFLMHWPQALRTERITDGNM 126

Query: 128 LSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDLLASPGNKL 187
           ++VP + D    VD T WN+IKTW LMQ+LP +GKTKA+GVSNFS+  L+ LLA PG+K+
Sbjct: 127 ITVPKREDEKPDVD-TEWNYIKTWHLMQDLPASGKTKAVGVSNFSVKQLEKLLADPGSKV 185

Query: 188 TPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKIAKKNNVQPG 247
            PA NQVE+HPLLPQ  L +FCK K IM+ AYSPLGS  APLL +P IL+IA K+   P 
Sbjct: 186 VPACNQVEVHPLLPQIPLYDFCKKKNIMLAAYSPLGSQKAPLLDDPVILEIAAKHKADPA 245

Query: 248 HVVISWHAQRGYVVLPKSVNPDRIETNRKIFTLSNEDFEAINNISKEKGEKRVVNPNWSP 307
            ++I W  +RGYV LPKSV P RIE+N +I  L++ + E IN I K KGEKRVV+P W  
Sbjct: 246 QIIIGWDVKRGYVALPKSVTPSRIESNLQIVNLTDSELEKINEIHK-KGEKRVVDPEWFD 304

Query: 308 FE 309
           FE
Sbjct: 305 FE 306

>KLTH0E15532g Chr5 complement(1380466..1381395) [930 bp, 309 aa]
           {ON} similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368W YPR1 2-methylbutyraldehyde reductase may be
           involved in isoleucine catabolism
          Length = 309

 Score =  389 bits (999), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 180/303 (59%), Positives = 232/303 (76%), Gaps = 1/303 (0%)

Query: 7   DSTKTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNEDQVGQAI 66
           +S+    L TGA IP +G GTW+S + D Y +VL ALK GY+HIDTAA+Y NE  VG+AI
Sbjct: 6   NSSAVGKLRTGATIPLLGFGTWRSTEEDGYNAVLTALKVGYRHIDTAAVYGNEAAVGRAI 65

Query: 67  KDSGVPREEIFVTTKLWSTQHHEPAKALDESLQRLGLDYVDLYLIHWPARLDTNYIKDGD 126
           +DSGVPR+++FVTTKLW+TQH +P  ALD+SLQRLGLDYVDLYLIHWP  L T  I DG+
Sbjct: 66  RDSGVPRDQLFVTTKLWNTQHRDPRLALDQSLQRLGLDYVDLYLIHWPLPLRTQRITDGN 125

Query: 127 ILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDLLASPGNK 186
           + +VPTK DG   VD   W+++KTWE+MQ+LP T KT+A+GVSNFS+  L++LLA+ G K
Sbjct: 126 LFTVPTKEDGKPDVD-EQWSYVKTWEMMQDLPDTSKTRAVGVSNFSVTQLQNLLAASGTK 184

Query: 187 LTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKIAKKNNVQP 246
           + PA NQVE HPLLPQ++L  FC    I++EAYSPLGS  +PL++EP + +IA K+N  P
Sbjct: 185 VIPAVNQVETHPLLPQDKLYKFCSENNILLEAYSPLGSQGSPLVEEPAVKEIASKHNADP 244

Query: 247 GHVVISWHAQRGYVVLPKSVNPDRIETNRKIFTLSNEDFEAINNISKEKGEKRVVNPNWS 306
             V+ISW  +RGYV+LPKSV P RIE+N KI  L+++DF  INNI KEKGEKR+ +P+W 
Sbjct: 245 AQVLISWGIKRGYVILPKSVTPSRIESNFKIVDLTDDDFAKINNIHKEKGEKRINDPDWF 304

Query: 307 PFE 309
            F+
Sbjct: 305 HFD 307

>TDEL0D00230 Chr4 (37458..38396) [939 bp, 312 aa] {ON}  possible
           pseudogene; NNN added to avoid internal stop codon
          Length = 312

 Score =  381 bits (978), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 180/311 (57%), Positives = 227/311 (72%), Gaps = 1/311 (0%)

Query: 3   TTLHDSTKTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNEDQV 62
           T     T +  LNTGA +P +GLGTW+S + DAY +VL+ALKAGYKHIDTAAIYRNE  V
Sbjct: 2   TVTSTKTPSFKLNTGALLPAIGLGTWKSSEEDAYTAVLSALKAGYKHIDTAAIYRNERAV 61

Query: 63  GQAIKDSGVPREEIFVTTKLWSTQHHEPAKALDESLQRLGLDYVDLYLIHWPARLDTNYI 122
           G+AI+DSG+PR+E+F+TTKLWSTQH +P  ALD SL+RLGLDYVDLYLIH+P    T+ I
Sbjct: 62  GKAIRDSGIPRDELFITTKLWSTQHRDPKAALDGSLERLGLDYVDLYLIHYPVAFKTDRI 121

Query: 123 KDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDLLAS 182
           +DG+    P   +G R VD+ +W+F+KTW L+Q LP++GK KA+GVSNFSINNLK LL S
Sbjct: 122 EDGNPFCFPLLPNGKRDVDIVDWDFVKTWRLVQHLPESGKCKAVGVSNFSINNLKTLLES 181

Query: 183 PGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKIAKK- 241
                 PA NQVEIHP LPQ ELI+FCKSK I++EAYSPLGST + +L + T+ KIA+K 
Sbjct: 182 DEKFAVPAVNQVEIHPQLPQTELIDFCKSKDIVVEAYSPLGSTGSQMLTDDTLQKIAEKX 241

Query: 242 NNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFTLSNEDFEAINNISKEKGEKRVV 301
            + QP  ++I+W   RGY VLPKSV P RIE N +I  +  ED   + N+    G KR +
Sbjct: 242 XDAQPAQILINWGISRGYCVLPKSVTPKRIEANARIIDIKKEDLLKVTNLIDILGPKRYL 301

Query: 302 NPNWSPFEAFK 312
            P+WSPF  F+
Sbjct: 302 EPDWSPFPIFE 312

>TPHA0G00210 Chr7 (31978..32913) [936 bp, 311 aa] {ON} 
          Length = 311

 Score =  381 bits (978), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 180/312 (57%), Positives = 230/312 (73%), Gaps = 1/312 (0%)

Query: 1   MSTTLHDSTKTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNED 60
           MS T  +   T ++    +IP V LGTW++  N+ Y +VL ALKAGY+HID AAIY NE+
Sbjct: 1   MSVTAKNCDITYAIGKDTKIPAVALGTWKAAPNEVYTAVLEALKAGYRHIDGAAIYCNEE 60

Query: 61  QVGQAIKDSGVPREEIFVTTKLWSTQHHEPAKALDESLQRLGLDYVDLYLIHWPARLDTN 120
           +VG+AI+DSG+PR++IFVTTKLW T+   P +ALD SL+RLGLDYVDLYL+HWP  L  +
Sbjct: 61  EVGKAIRDSGIPRKDIFVTTKLWGTEQRNPLRALDSSLKRLGLDYVDLYLMHWPVALKAD 120

Query: 121 YIKDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDLL 180
            I D D+L++P    G   +D+ NWNFIKTWELMQELP T K KAIGVSNFSINNL +LL
Sbjct: 121 SITDNDLLTIPKLPSGKTDIDIENWNFIKTWELMQELP-TSKAKAIGVSNFSINNLNELL 179

Query: 181 ASPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKIAK 240
           A+P  K  PAANQ EIHPLLPQNELI +C+ KKI++EAY PLG ++ PL+  P I +IA 
Sbjct: 180 AAPTTKTIPAANQFEIHPLLPQNELIKYCQDKKIIVEAYCPLGGSNVPLVTNPVITEIAT 239

Query: 241 KNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFTLSNEDFEAINNISKEKGEKRV 300
           K  V  G ++ISW  QRGYVVLPKSV  +RI TN +  T+  E+FE +NN++KE G +R 
Sbjct: 240 KLGVNAGQLLISWGIQRGYVVLPKSVRKERIVTNFQTITIPAEEFEKMNNLTKEFGVQRS 299

Query: 301 VNPNWSPFEAFK 312
           VN ++SPF  ++
Sbjct: 300 VNIDFSPFPTYQ 311

>KLTH0F16060g Chr6 complement(1304479..1305408) [930 bp, 309 aa]
           {ON} similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368W YPR1 2-methylbutyraldehyde reductase may be
           involved in isoleucine catabolism
          Length = 309

 Score =  372 bits (956), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 170/309 (55%), Positives = 224/309 (72%), Gaps = 1/309 (0%)

Query: 1   MSTTLHDSTKTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNED 60
           M+T L   T T  LNTGAQIP +GLGTW+S   + Y + LAA+KAGY+HID AA+  NE 
Sbjct: 1   MTTVLKKCTATAKLNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQ 60

Query: 61  QVGQAIKDSGVPREEIFVTTKLWSTQHHEPAKALDESLQRLGLDYVDLYLIHWPARLDTN 120
            VG+AI+DSGVPREE+FVTTKLW TQH +P  AL +SL+RLGLDYVDLY++HWP    + 
Sbjct: 61  VVGRAIRDSGVPREELFVTTKLWCTQHRDPKTALSQSLKRLGLDYVDLYMMHWPVAFRSE 120

Query: 121 YIKDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDLL 180
            +K  + + +P + DG   VD   W+++KTWELMQELP TGKT A+GV+NFS++ LK L+
Sbjct: 121 QVKHTNYMLIPKRKDGQPDVD-EGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKLI 179

Query: 181 ASPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKIAK 240
            SPGNK+ PAA+Q+E HP LPQN++++FCK   I++EAYSPLGS  APLL EP + +I+K
Sbjct: 180 DSPGNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISK 239

Query: 241 KNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFTLSNEDFEAINNISKEKGEKRV 300
           K +V+P  +++SW  QRG+ VL KS  P RIE N   F +   D   IN +++E+G KR+
Sbjct: 240 KLHVEPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDIPEGDLRRINELAQERGTKRI 299

Query: 301 VNPNWSPFE 309
            NP W  FE
Sbjct: 300 HNPTWFSFE 308

>TBLA0A02835 Chr1 complement(683118..684053) [936 bp, 311 aa] {ON}
          Length = 311

 Score =  372 bits (955), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 175/312 (56%), Positives = 239/312 (76%), Gaps = 1/312 (0%)

Query: 1   MSTTLHDSTKTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNED 60
           M+ TL + T+T++LN G +IP +GLGT+ SK N+ Y++V+ A KAGY+H+DTAA Y+NE+
Sbjct: 1   MAVTLKNCTETITLNNGTKIPVIGLGTYLSKQNEVYEAVVTAAKAGYRHVDTAAFYKNEE 60

Query: 61  QVGQAIKDSGVPREEIFVTTKLWSTQHHEPAKALDESLQRLGLDYVDLYLIHWPARLDTN 120
           QVG+A+KD GVPR E++VTTK+W T+  +P  ALD+SL+RLGL+Y+DLYL+HWP  L T+
Sbjct: 61  QVGKAVKDCGVPRSEMYVTTKVWPTELRDPEAALDKSLKRLGLEYIDLYLMHWPVTLKTD 120

Query: 121 YIKDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDLL 180
            IKDG+++ +P   DG+  VD  +W F++ WE MQ+L K+GK K+IGVSNFSINN+K+LL
Sbjct: 121 TIKDGELMCIPRLPDGNADVD-KDWTFVQAWEAMQKLLKSGKVKSIGVSNFSINNIKELL 179

Query: 181 ASPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKIAK 240
           A+P   + P  NQVE+ PLLP +ELI FC+SK I+ +AY P G ++APL+K+ T+++IAK
Sbjct: 180 AAPTTTVVPVVNQVEVQPLLPNDELIEFCRSKDIITQAYCPFGGSEAPLIKDATVVEIAK 239

Query: 241 KNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFTLSNEDFEAINNISKEKGEKRV 300
            N V  G V+ SWH QRGYVVLPKSV   RI +N K FTLS+ D   +NNISK +GEKR+
Sbjct: 240 GNGVDAGQVITSWHVQRGYVVLPKSVKESRIISNLKTFTLSDADMTKMNNISKTQGEKRL 299

Query: 301 VNPNWSPFEAFK 312
            N N+SPF  F+
Sbjct: 300 NNVNFSPFPIFE 311

>Kwal_55.21426 s55 complement(832981..833907) [927 bp, 308 aa] {ON}
           YOR120W (GCY1) - Similar to mammalian aldo/keto
           reductases [contig 130] FULL
          Length = 308

 Score =  358 bits (919), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 167/309 (54%), Positives = 229/309 (74%), Gaps = 2/309 (0%)

Query: 1   MSTTLHDSTKTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNED 60
           M+  L   T T +LNTGA+IP +GLGTW+      YK++LAALKAGY+HID+AA+  NE 
Sbjct: 1   MTGILKKCTATATLNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQ 60

Query: 61  QVGQAIKDSGVPREEIFVTTKLWSTQHHEPAKALDESLQRLGLDYVDLYLIHWPARLDTN 120
            +G+AI+DSGV R+E+FVTTKLWSTQH +P+ ALD+SL+RLGL+YVDLY++HWP     +
Sbjct: 61  VIGKAIRDSGVRRDELFVTTKLWSTQHRDPSAALDQSLKRLGLEYVDLYMMHWPLAFRVD 120

Query: 121 YIKDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDLL 180
            IK  + + +P  ++G   VD T+W+++KTWELMQ+LP T KT+AIGV+NFS+  L  LL
Sbjct: 121 QIKAKNFMLIPRNSEGKPYVD-TDWDYVKTWELMQKLP-TEKTRAIGVANFSVPQLTSLL 178

Query: 181 ASPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKIAK 240
            SP NK+ PAA+Q+E HP LP +E++ FC+ K I++EAYSPLG    PL+ EP I +I+K
Sbjct: 179 KSPNNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREISK 238

Query: 241 KNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFTLSNEDFEAINNISKEKGEKRV 300
           K +V+P  ++ISW  +RG  VLPKS    RIE+N ++F LS+ED+E I+ I++E+G KR 
Sbjct: 239 KLHVEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFDLSDEDYERIHEIAQERGPKRT 298

Query: 301 VNPNWSPFE 309
            NP W  FE
Sbjct: 299 HNPPWFSFE 307

>KLLA0D10109g Chr4 (854495..855424) [930 bp, 309 aa] {ON} similar to
           uniprot|P14065 Saccharomyces cerevisiae YOR120W GCY1
           Putative NADP( ) coupled glycerol dehydrogenase proposed
           to be involved in an alternative pathway for glycerol
           catabolism
          Length = 309

 Score =  358 bits (919), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 175/302 (57%), Positives = 221/302 (73%), Gaps = 2/302 (0%)

Query: 11  TLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNEDQVGQAIKDSG 70
           +L LNTGA IPQ+G GTW S   DAY +V+ ALK GY+HID AA+Y NE  VG+ I+DSG
Sbjct: 10  SLKLNTGASIPQLGFGTWPSSHADAYTAVITALKTGYRHIDAAAMYGNEAAVGKGIRDSG 69

Query: 71  VPREEIFVTTKLWSTQHHEPAKALDESLQRLGLDYVDLYLIHWPARLDTNYIKDGDILSV 130
           +PREEIFVTTKLW+TQ  +PA ALDESL+RLGLDYVDL+LIHWP  L      + ++L  
Sbjct: 70  IPREEIFVTTKLWNTQQRDPASALDESLERLGLDYVDLFLIHWPVPLKPVGGPE-NLLKY 128

Query: 131 PTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDLLASPGNKLTPA 190
           PT     + +D  +W+FIKTWELMQ LPKTGKT+A+GVSNFSI NL+DLL S  + L PA
Sbjct: 129 PTPGIKPQ-IDTEDWSFIKTWELMQTLPKTGKTRAVGVSNFSIKNLEDLLNSSPDVLVPA 187

Query: 191 ANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKIAKKNNVQPGHVV 250
            NQ EIHP LPQ ELIN+CKSK I++EAY PLGS+ + +L +PTI +IA K +V+P +V+
Sbjct: 188 VNQFEIHPQLPQTELINYCKSKGIVVEAYCPLGSSSSAMLSDPTIAEIADKYHVKPANVL 247

Query: 251 ISWHAQRGYVVLPKSVNPDRIETNRKIFTLSNEDFEAINNISKEKGEKRVVNPNWSPFEA 310
           I+W   RGY VLPKS  P RI +N+    LS ED E I  +S+  G KR V+P++ P+  
Sbjct: 248 INWGISRGYCVLPKSFTPARIASNKTPVHLSREDTERITKLSETLGVKRYVHPDFEPYPL 307

Query: 311 FK 312
           F+
Sbjct: 308 FE 309

>AER401W Chr5 (1406905..1407846) [942 bp, 313 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR368W (YPR1) and
           YOR120W (GCY1)
          Length = 313

 Score =  331 bits (848), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 171/314 (54%), Positives = 227/314 (72%), Gaps = 3/314 (0%)

Query: 1   MST--TLHDSTKTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRN 58
           MST  TL  ST T++LNTGA+IP  GLGTWQS D+DA  +V AALK GYKHIDTA+ Y+N
Sbjct: 1   MSTKATLKASTDTVTLNTGAKIPLFGLGTWQSTDDDASSAVAAALKHGYKHIDTASFYKN 60

Query: 59  EDQVGQAIKDSGVPREEIFVTTKLWSTQHHEPAKALDESLQRLGLDYVDLYLIHWPARLD 118
           E+ VG+A+K+SG+PREE+F+TTK+W+ Q  +PA ALD SL++LG +YVDL L+HWP    
Sbjct: 61  EELVGKAVKESGIPREELFITTKVWNDQQRDPAGALDLSLKKLGTEYVDLLLMHWPVPFK 120

Query: 119 TNYIKDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKD 178
                  D   VP   DG    D   W+F+KTW LMQ+L  TGK KAIGVSNFSINNL++
Sbjct: 121 EPENSTLDAYKVPRGPDGKVTRD-EEWDFVKTWHLMQKLLGTGKVKAIGVSNFSINNLEE 179

Query: 179 LLASPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKI 238
           LL + G  + PA NQVE+H  LPQ EL+ +C+ K I++EAYSPLGS+ APLLK+ T+ K+
Sbjct: 180 LLNAEGTTVVPAVNQVELHIRLPQLELVEYCQKKGIVVEAYSPLGSSSAPLLKDATVNKV 239

Query: 239 AKKNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFTLSNEDFEAINNISKEKGEK 298
           A+K  V P HV++++ A RG VVLPKSV   RI +N + F +  ED + +N+I K++G +
Sbjct: 240 AEKYGVTPAHVLLNYVANRGIVVLPKSVKESRIISNFEYFKMDEEDIKLLNDIHKKEGVQ 299

Query: 299 RVVNPNWSPFEAFK 312
           R V+P++SPF  F+
Sbjct: 300 RFVDPDFSPFPLFQ 313

>NDAI0A07000 Chr1 complement(1596632..1597594) [963 bp, 320 aa] {ON}
           Anc_3.108
          Length = 320

 Score =  225 bits (573), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 120/290 (41%), Positives = 181/290 (62%), Gaps = 14/290 (4%)

Query: 12  LSLNTGAQIPQVGLGTWQSKDN--DAYKSVLAALKAGYKHIDTAAIYRNEDQVGQAIKD- 68
            +LN G +IP +GLGT   KD   +  ++V AA++AGY+HIDTA  Y+ E  +GQA+K+ 
Sbjct: 11  FNLNNGTRIPAIGLGTASPKDRYPETKEAVKAAIRAGYRHIDTAYFYKTEPYIGQALKEL 70

Query: 69  ---SGVPREEIFVTTKLWSTQHHEPAKALDESLQRLGLDYVDLYLIHWPARLDTNYIKDG 125
              + + REE+F+TTK+W T  + P+ ++D+SL+ LG+DYVDL L HWP          G
Sbjct: 71  FESAEIKREELFITTKVWPTFWNNPSDSIDQSLKDLGIDYVDLVLQHWPVCFQKVENSQG 130

Query: 126 DILSVPTKADGSRAVDV-TNWNFIKTWELMQEL---PKTGKTKAIGVSNFSINNLKDLLA 181
           +I+ +P   DG+   +   +W F  T++ ++++   PK  + +AIGVSN+ I  L+ L  
Sbjct: 131 NIIGLPRDKDGNALFEKDADWLF--TYKALEKIYLDPKDNRVRAIGVSNYPIEYLERLFK 188

Query: 182 SPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKIAKK 241
               K+TPA NQVE+HP LPQ EL  FC    I++ AYSPLGS  AP LK  ++  +AKK
Sbjct: 189 E--CKVTPAINQVEVHPHLPQLELNKFCHDHAILLTAYSPLGSDGAPNLKIKSVQDLAKK 246

Query: 242 NNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFTLSNEDFEAINNI 291
             V+P  ++ S+H  +G VVLP+S+NP RI  N     L+++D   ++ +
Sbjct: 247 YKVEPADILTSYHISKGNVVLPRSLNPKRIAANVSFAKLTDDDLSKLDQV 296

>NCAS0I02420 Chr9 complement(454156..455118) [963 bp, 320 aa] {ON}
           Anc_3.108
          Length = 320

 Score =  219 bits (557), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 113/290 (38%), Positives = 182/290 (62%), Gaps = 12/290 (4%)

Query: 12  LSLNTGAQIPQVGLGTWQSKDN--DAYKSVLAALKAGYKHIDTAAIYRNEDQVGQAIK-- 67
            +LN G +IP +GLGT   K    +  K+V AA++AGY+ IDTA  Y+ E  +G+A+K  
Sbjct: 11  FNLNNGGRIPAIGLGTASPKGRYPETKKAVKAAIRAGYRQIDTAWYYKTEPYIGEALKEL 70

Query: 68  --DSGVPREEIFVTTKLWSTQHHEPAKALDESLQRLGLDYVDLYLIHWPARLDTNYIKDG 125
             D  + RE++F+TTK+W     +P+ +++ESL+ LG+DYVD+ L HWP      Y ++G
Sbjct: 71  FRDGEIKREDLFITTKVWPCYWDDPSTSINESLKSLGIDYVDMVLQHWPLCYKKTYDENG 130

Query: 126 DILSVPTKADGSRAVDVTNWNFIKTWELMQEL---PKTGKTKAIGVSNFSINNLKDLLAS 182
            I+  P   DG + +     ++I T++LM+++   PK  + +AIGVSN+ I  L+ ++  
Sbjct: 131 TIIGKPLDKDG-KVIFAEGADWITTYQLMEKIYLDPKDTRVRAIGVSNYPIEYLERVIKE 189

Query: 183 PGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKIAKKN 242
              K+TP  NQVE+HP LPQ EL +FC    I++ AYSPLGS  AP  K P + + AKK+
Sbjct: 190 --CKVTPVINQVELHPHLPQLELNDFCHKNGILLTAYSPLGSGGAPNTKIPLVQEYAKKH 247

Query: 243 NVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFTLSNEDFEAINNIS 292
            V P  ++ S+H ++G VV+P+S+NP+R+ +N     L+  + +++++  
Sbjct: 248 EVAPADILTSYHVRKGNVVIPRSLNPERVASNIYFAPLTKNEMKSLDDFG 297

>Smik_2.289 Chr2 (526189..527223) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score =  213 bits (543), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 132/320 (41%), Positives = 192/320 (60%), Gaps = 22/320 (6%)

Query: 5   LHDSTKTL--SLNTGAQIPQVGLGTW--QSKDNDAYKSVLAALKAGYKHIDTAAIYRNED 60
           LH  T  +  SLN G +IP +GLGT   Q K  +  ++V AA+KAGY+HIDTA  YR E 
Sbjct: 16  LHPKTTEIYFSLNNGVRIPALGLGTANPQEKLAETKQAVKAAIKAGYRHIDTAWAYRTEP 75

Query: 61  QVGQAIKD----SGVPREEIFVTTKLWSTQHHEPAKALDESLQRLGLDYVDLYLIHWPAR 116
            VG+AIK+      + RE++F+TTK+W     E  ++L+ESL+ LGLDYVDL L HWP  
Sbjct: 76  FVGEAIKELLEEGTIQREDLFITTKVWPVLWDEVDRSLNESLKALGLDYVDLLLQHWPLC 135

Query: 117 LDTNYIKDGDILSVPTKA---DGSRAVDVTNWNFIKTWELMQEL---PKTGKTKAIGVSN 170
            +   +KD   +S   K    D  + V  +N ++++T++ ++++       + +AIGVSN
Sbjct: 136 FEK--VKDPKGISGLVKTPVDDSGKTVYASNGDWLETYKQLEKIYLDSNDHRVRAIGVSN 193

Query: 171 FSINNLKDLLASPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLL 230
           FSI  L+ L+     K+ P  NQVE HP LPQ EL  FC    I++ AYSPLGS  AP L
Sbjct: 194 FSIEYLERLIKE--CKVKPTVNQVESHPHLPQVELRKFCFMHDILLTAYSPLGSQGAPNL 251

Query: 231 KEPTILKIAKKNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFTLSNEDFEAINN 290
           K P + K+ +K NV    ++IS+H ++G +V+P+S+NP RI +N +   L+ ++ + +N 
Sbjct: 252 KIPLVKKLCEKYNVTGNDLLISYHIRQGTIVIPRSLNPVRISSNIEFVCLTKDELQELN- 310

Query: 291 ISKEKGEKRVVNPNWSPFEA 310
              E GEK  V     PF A
Sbjct: 311 ---EFGEKYPVRFIDEPFAA 327

>SAKL0C10626g Chr3 (962421..963389) [969 bp, 322 aa] {ON} similar to
           uniprot|P38115 Saccharomyces cerevisiae YBR149W ARA1
           Large subunit of NADP dependent arabinose dehydrogenase
           involved in carbohydrate metabolism small subunit is
           unidentified
          Length = 322

 Score =  211 bits (536), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 113/297 (38%), Positives = 183/297 (61%), Gaps = 20/297 (6%)

Query: 12  LSLNTGAQIPQVGLGTW-------QSKDNDAYKSVLAALKAGYKHIDTAAIYRNEDQVGQ 64
            +LNTGA+IP +GLGT        Q+KD     +V  A+K GY+ IDTA +Y +E  +G+
Sbjct: 11  FNLNTGAKIPSLGLGTVNPPEKMPQTKD-----AVKHAVKNGYRLIDTAWMYGSEPYIGE 65

Query: 65  AIKD----SGVPREEIFVTTKLWSTQHHEPAKALDESLQRLGLDYVDLYLIHWPARLDTN 120
           A+++      V RE++F+TTK+W   ++   ++L ESL++L LDYVDL L HWP      
Sbjct: 66  ALQELFEEGVVKREDLFITTKVWPCHYNTVEQSLQESLKQLKLDYVDLLLQHWPLCFVKQ 125

Query: 121 YIKDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPK--TGKTKAIGVSNFSINNLKD 178
           Y + G + S P        V     +++ TW+ ++++ K  +G+ + IGVSN+ +  L+ 
Sbjct: 126 YDEHGKLKSHPVDPKSGDIVLDEKGDYLTTWKQLEKVYKDGSGRVRNIGVSNYPVEYLER 185

Query: 179 LLASPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKI 238
           LL     ++ P  NQVE+HPLLPQ EL  +C S  I++E++SPLGS+  P L+ P + ++
Sbjct: 186 LLKE--TEVVPVLNQVELHPLLPQEELSEYCNSHGILMESFSPLGSSGTPHLEHPLVKEL 243

Query: 239 AKKNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFTLSNEDFEAINNISKEK 295
           +KK + +PG V++++H ++G VV+P+S+N  RI  N     LS ED + ++ + +EK
Sbjct: 244 SKKYDCEPGSVLLNYHVRKGNVVVPRSLNHGRIIKNADFVALSEEDLDKLSGLGREK 300

>Kwal_56.22611 s56 complement(202750..203715) [966 bp, 321 aa] {ON}
           YBR149W (ARA1) - D-arabinose dehydrogenase [contig 184]
           FULL
          Length = 321

 Score =  209 bits (533), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 118/307 (38%), Positives = 189/307 (61%), Gaps = 18/307 (5%)

Query: 12  LSLNTGAQIPQVGLGTWQSKDN--DAYKSVLAALKAGYKHIDTAAIYRNEDQVGQAIKD- 68
            +LN G ++P +GLGT    +      ++V AA+K+GY+HIDTA  YR ED++G+A+K+ 
Sbjct: 11  FTLNNGVKMPALGLGTANVIEQIPQTKQAVKAAIKSGYRHIDTAWAYRCEDRIGEALKEL 70

Query: 69  ---SGVPREEIFVTTKLWSTQHHEPAKALDESLQRLGLDYVDLYLIHWPARLDTNYIKDG 125
                + RE+IF+TTK+W T      +++  SL+ LG+DYVDL L HWP  L  N ++D 
Sbjct: 71  FEEGVIKREDIFITTKVWPTNWDRADESISRSLENLGVDYVDLVLQHWP--LCFNRLQDP 128

Query: 126 D----ILSVPTKADGSRAVDVTNWNFIKTWELMQE--LPKTGKTKAIGVSNFSINNLKDL 179
           +    I   PT  DGS   +    ++++T++ +++  L K  + ++IGVSN+ +  L+ L
Sbjct: 129 EGIDGICRNPTHEDGSPHYN-EKGDYLQTFKSLEKMYLSKDPRFRSIGVSNYPVEYLERL 187

Query: 180 LASPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKIA 239
           L     K+ PA NQVE+HP LPQ EL +FC    I +EA+SP G+T +P++K   + K+A
Sbjct: 188 LKE--CKVVPAVNQVEMHPHLPQMELRDFCTKHNIRLEAFSPFGATGSPMVKNELVQKVA 245

Query: 240 KKNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFTLSNEDFEAINNISKEKGEKR 299
           +K +  P  V+I++H ++G V +P+SVNP  I +N +   LS ED + +N    E   KR
Sbjct: 246 QKYSCTPNDVLIAYHLRQGVVTVPRSVNPKNIASNVQFVPLSKEDIDELNKFGVE-NPKR 304

Query: 300 VVNPNWS 306
           +V+  ++
Sbjct: 305 LVDEEFA 311

>YBR149W Chr2 (539987..541021) [1035 bp, 344 aa] {ON}  ARA1NADP+
           dependent arabinose dehydrogenase, involved in
           carbohydrate metabolism; purified as homodimer;
           naturally occurs with a N-terminus degradation product
          Length = 344

 Score =  210 bits (535), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 128/321 (39%), Positives = 192/321 (59%), Gaps = 22/321 (6%)

Query: 5   LHDSTKTL--SLNTGAQIPQVGLGTW--QSKDNDAYKSVLAALKAGYKHIDTAAIYRNED 60
           LH  T  +  SLN G +IP +GLGT     K  +  ++V AA+KAGY+HIDTA  Y  E 
Sbjct: 16  LHPKTTEIYFSLNNGVRIPALGLGTANPHEKLAETKQAVKAAIKAGYRHIDTAWAYETEP 75

Query: 61  QVGQAIK----DSGVPREEIFVTTKLWSTQHHEPAKALDESLQRLGLDYVDLYLIHWPAR 116
            VG+AIK    D  + RE++F+TTK+W     E  ++L+ESL+ LGL+YVDL L HWP  
Sbjct: 76  FVGEAIKELLEDGSIKREDLFITTKVWPVLWDEVDRSLNESLKALGLEYVDLLLQHWPLC 135

Query: 117 LDTNYIKDGDILSVPTKA---DGSRAVDVTNWNFIKTWELMQEL---PKTGKTKAIGVSN 170
            +   IKD   +S   K    D  + +   + ++++T++ ++++   P   + +AIGVSN
Sbjct: 136 FEK--IKDPKGISGLVKTPVDDSGKTMYAADGDYLETYKQLEKIYLDPNDHRVRAIGVSN 193

Query: 171 FSINNLKDLLASPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLL 230
           FSI  L+ L+     ++ P  NQVE HP LPQ EL  FC    I++ AYSPLGS  AP L
Sbjct: 194 FSIEYLERLIKE--CRVKPTVNQVETHPHLPQMELRKFCFMHDILLTAYSPLGSHGAPNL 251

Query: 231 KEPTILKIAKKNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFTLSNEDFEAINN 290
           K P + K+A+K NV    ++IS+H ++G +V+P+S+NP RI ++ +  +L+ ++ + +N+
Sbjct: 252 KIPLVKKLAEKYNVTGNDLLISYHIRQGTIVIPRSLNPVRISSSIEFASLTKDELQELND 311

Query: 291 ISKEKGEKRVVNPNWSPFEAF 311
                GEK  V     PF A 
Sbjct: 312 F----GEKYPVRFIDEPFAAI 328

>Skud_2.276 Chr2 (507436..508470) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score =  210 bits (535), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 124/311 (39%), Positives = 187/311 (60%), Gaps = 20/311 (6%)

Query: 12  LSLNTGAQIPQVGLGTW--QSKDNDAYKSVLAALKAGYKHIDTAAIYRNEDQVGQAIK-- 67
            SLN G +IP +GLGT     K  +  ++V AA+KAGY+HIDTA  Y  E  VG+AIK  
Sbjct: 25  FSLNNGVRIPALGLGTANPHEKLAETKQAVKAAIKAGYRHIDTAWAYETEPFVGEAIKEL 84

Query: 68  --DSGVPREEIFVTTKLWSTQHHEPAKALDESLQRLGLDYVDLYLIHWPARLDTNYIKDG 125
             D  + RE++F+TTK+W     E  ++L+ESL+ LGLDYVDL+L HWP   +   +KD 
Sbjct: 85  LEDGSIKREDLFITTKVWPVLWDEVDRSLNESLKALGLDYVDLFLQHWPLCFEK--VKDP 142

Query: 126 DILSVPTKA---DGSRAVDVTNWNFIKTWELMQEL---PKTGKTKAIGVSNFSINNLKDL 179
             LS   K    D  + +  +N ++++T++ ++++   P   + +AIGVSNFSI  L+ L
Sbjct: 143 KGLSGLVKTPVDDSGKTMYASNGDWLETYKQLEKIYLDPNDHRIRAIGVSNFSIEYLERL 202

Query: 180 LASPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKIA 239
           +     ++ P  NQVE HP LPQ  +  FC    I++ AYSPLGS  AP LK P + K+ 
Sbjct: 203 IKE--CRVKPTVNQVETHPHLPQMAMRKFCFMHDILLTAYSPLGSNGAPNLKIPLVKKLT 260

Query: 240 KKNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFTLSNEDFEAINNISKEKGEKR 299
           +K N+    V+IS+H ++G +V+P+S+NP RI ++ +   L+ ++ + +N+     GEK 
Sbjct: 261 EKYNLTGNDVLISYHIRQGTIVIPRSLNPVRISSSIEFSCLTKDELQELNDF----GEKY 316

Query: 300 VVNPNWSPFEA 310
            V     PF A
Sbjct: 317 PVRFIDEPFAA 327

>Suva_4.398 Chr4 (709192..710226) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score =  209 bits (532), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 125/321 (38%), Positives = 191/321 (59%), Gaps = 24/321 (7%)

Query: 5   LHDSTKTL--SLNTGAQIPQVGLGTW--QSKDNDAYKSVLAALKAGYKHIDTAAIYRNED 60
           LH  T  +  +LN G ++P +GLGT     K  +  ++V AA+KAGY+HIDTA  Y  E 
Sbjct: 16  LHPKTTEIYFTLNNGVRVPALGLGTANPHEKLAETKQAVKAAIKAGYRHIDTAWAYETEP 75

Query: 61  QVGQAIKD----SGVPREEIFVTTKLWSTQHHEPAKALDESLQRLGLDYVDLYLIHWPAR 116
            VG+AIK+      + RE++F+TTK+W     E  ++L ESL+ +GLDYVDL+L HWP  
Sbjct: 76  FVGEAIKELLEEGSIKREDLFITTKVWPVLWDEVERSLSESLKAMGLDYVDLFLQHWPLC 135

Query: 117 LDTNYIKD----GDILSVPTKADGSRAVDVTNWNFIKTWELMQEL---PKTGKTKAIGVS 169
            +   +KD      ++  P    G  A+  +N ++++T++ ++++   P   + +AIGVS
Sbjct: 136 FEK--VKDPKGISGLVKTPVHKSG-EAMLASNGDWMETYKQLEKIYLDPNDHRVRAIGVS 192

Query: 170 NFSINNLKDLLASPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPL 229
           NFSI  L+ L+     ++ P  NQVE HP LPQ EL  FC    I++ AYSPLGS  AP 
Sbjct: 193 NFSIEYLERLVKE--CRVKPTVNQVETHPHLPQMELRKFCFMHDILLTAYSPLGSNGAPN 250

Query: 230 LKEPTILKIAKKNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFTLSNEDFEAIN 289
           LK P + K+ +K NV    V+IS+H ++G +V+P+S+NP RI ++ +   L+ ++ + +N
Sbjct: 251 LKIPLVKKLVEKYNVTGNDVLISYHIRQGTIVIPRSLNPVRISSSIEFACLTKDELQELN 310

Query: 290 NISKEKGEKRVVNPNWSPFEA 310
           +     GEK  V     PF A
Sbjct: 311 DF----GEKYPVRFIDEPFAA 327

>Smik_2.288 Chr2 (524564..525598) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score =  209 bits (531), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 127/308 (41%), Positives = 187/308 (60%), Gaps = 22/308 (7%)

Query: 5   LHDSTKTL--SLNTGAQIPQVGLGTW--QSKDNDAYKSVLAALKAGYKHIDTAAIYRNED 60
           LH  T  +  SLN G +IP +GLGT   Q K  +  ++V AA+KAGY+HIDTA  Y  E 
Sbjct: 16  LHPKTTEIYFSLNNGVRIPALGLGTANPQEKLAETKQAVKAAIKAGYRHIDTAWAYETEP 75

Query: 61  QVGQAIKD----SGVPREEIFVTTKLWSTQHHEPAKALDESLQRLGLDYVDLYLIHWPAR 116
            VG+AIK+      + RE++F+TTK+W     E  ++L+ESL+ LGLDYVDL L HWP  
Sbjct: 76  FVGEAIKELLEEGTIQREDLFITTKVWPVLWDEVDRSLNESLKALGLDYVDLLLQHWPIC 135

Query: 117 LDTNYIKDGDILSVPTKA---DGSRAVDVTNWNFIKTWELMQEL---PKTGKTKAIGVSN 170
                +KD + +S   K    D  + V  +N ++++T++ ++++       + +AIGVSN
Sbjct: 136 FGK--VKDPEGISGYMKLPVDDSGKTVYASNGDWLETYKQLEKIYLDSNDHRVRAIGVSN 193

Query: 171 FSINNLKDLLASPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLL 230
           FSI  L+ L+     K+ P  NQVE HP LPQ EL  FC    I++ AYSPLGS  AP L
Sbjct: 194 FSIEYLERLIKE--CKVKPTVNQVESHPHLPQVELRKFCFMHDILLTAYSPLGSQGAPNL 251

Query: 231 KEPTILKIAKKNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFTLSNEDFEAINN 290
           K P + K+ +K NV    ++IS+H ++G +V+P+S+NP RI +N +   L+ ++ + +N 
Sbjct: 252 KIPLVKKLCEKYNVTGNDLLISYHIRQGTIVIPRSLNPVRISSNIEFVCLTKDELQELN- 310

Query: 291 ISKEKGEK 298
              E GEK
Sbjct: 311 ---EFGEK 315

>KLTH0C10010g Chr3 (829145..830110) [966 bp, 321 aa] {ON} similar to
           uniprot|P38115 Saccharomyces cerevisiae YBR149W ARA1
           Large subunit of NADP dependent arabinose dehydrogenase
           involved in carbohydrate metabolism small subunit is
           unidentified
          Length = 321

 Score =  207 bits (527), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 122/313 (38%), Positives = 186/313 (59%), Gaps = 17/313 (5%)

Query: 12  LSLNTGAQIPQVGLGTWQSKDN--DAYKSVLAALKAGYKHIDTAAIYRNEDQVGQAIKD- 68
            +LN G ++P +GLGT    +      ++V AA+K+GY+HIDTA  Y+ ED+VG+A+K+ 
Sbjct: 11  FTLNNGVRMPAIGLGTANVVEQIPQTKQAVKAAIKSGYRHIDTAWAYQCEDRVGEALKEL 70

Query: 69  ---SGVPREEIFVTTKLWSTQHHEPAKALDESLQRLGLDYVDLYLIHWPARLDTNYIKDG 125
                V RE+IFVTTK+W T      +++  SL+ LGLD+VDL L HWP  L  N ++D 
Sbjct: 71  FEEGVVKREDIFVTTKVWPTNWDRVDESISRSLENLGLDHVDLVLQHWP--LCFNRLEDP 128

Query: 126 D----ILSVPTKADGSRAVDVTNWNFIKTWELMQEL--PKTGKTKAIGVSNFSINNLKDL 179
           D    +   P   DGS   +    ++++T++ +++L   K  + +AIGVSN+ +  L+ L
Sbjct: 129 DGIDGVRRNPYHEDGSPHYN-EKGDYLETFKTLEKLYLAKDPRFRAIGVSNYPVEYLERL 187

Query: 180 LASPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKIA 239
           L     ++ PA NQVE HP LPQ EL +FC    I +EAYSPLG+T+APL+    + KIA
Sbjct: 188 LKE--CQVVPAINQVECHPHLPQMELRDFCTKHNIRLEAYSPLGATNAPLIDNELVKKIA 245

Query: 240 KKNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFTLSNEDFEAINNISKEKGEKR 299
            K      +V+I++H ++G V +P+SVNP  I +N +   LS ED + +N    E  ++ 
Sbjct: 246 GKYACSTQNVLIAYHMRQGVVSVPRSVNPKHIASNVQFVALSKEDIDTLNKFGVENTKRI 305

Query: 300 VVNPNWSPFEAFK 312
           V  P  +    F+
Sbjct: 306 VDEPFAAAIPGFR 318

>KLLA0F02728g Chr6 (249240..250232) [993 bp, 330 aa] {ON} similar to
           uniprot|P38115 Saccharomyces cerevisiae YBR149W ARA1
           Large subunit of NADP dependent arabinose dehydrogenase
           involved in carbohydrate metabolism small subunit is
           unidentified
          Length = 330

 Score =  202 bits (513), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 117/304 (38%), Positives = 179/304 (58%), Gaps = 19/304 (6%)

Query: 12  LSLNTGAQIPQVGLGTWQSKDN--DAYKSVLAALKAGYKHIDTAAIYRNEDQVGQAIKD- 68
            + N G ++P  GLGT    +   +  ++V AA+KAGY+HIDTA  Y  E+ VG+A+++ 
Sbjct: 11  FTFNNGNKVPAFGLGTAAQHERVAETKQAVKAAIKAGYRHIDTAWAYGVEEYVGEALQEL 70

Query: 69  ---SGVPREEIFVTTKLWSTQHHEPAKALDESLQRLGLDYVDLYLIHWPARLDTNYIKD- 124
                V RE++ +T+K+W T  ++  K+L+ESL RL +DYVDL+L HWP  L T  + D 
Sbjct: 71  FEERVVKREDLHITSKVWHTMWNDVDKSLNESLARLKVDYVDLFLQHWP--LCTQKVPDP 128

Query: 125 ---GDILSVPTKADGSRAVDVTNWNFIKTWELMQEL---PKTGKTKAIGVSNFSINNLKD 178
                I   P    G+   D    ++I+T++ ++++       + +AIGVSNF I  LK 
Sbjct: 129 HGVDKIAKEPVDDQGNPLYD-EKGDWIETYKQIEKIYLDKNDKRVRAIGVSNFPIEYLKR 187

Query: 179 LLASPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKI 238
           +L     +  PA NQVE+HP LPQ EL  FC   KI++ AYSPLG   APLL+ P +  +
Sbjct: 188 VLKE--CRTVPACNQVELHPHLPQRELCEFCSEHKILVTAYSPLGGNGAPLLELPILKGL 245

Query: 239 AKKNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFTLSNEDFEAINNISKEKGEK 298
            +K N  P  ++ S+H ++G +V+P+S+N  RI +N +   LS ED   +N    +K +K
Sbjct: 246 CEKYNASPNDILTSYHLRQGTIVIPRSLNSTRIASNLEFVPLSEEDVNKLNEFG-QKNKK 304

Query: 299 RVVN 302
           R +N
Sbjct: 305 RYIN 308

>KAFR0G01350 Chr7 (304389..305363) [975 bp, 324 aa] {ON} Anc_3.108
           YBR149W
          Length = 324

 Score =  199 bits (507), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 113/301 (37%), Positives = 181/301 (60%), Gaps = 15/301 (4%)

Query: 12  LSLNTGAQIPQVGLGTWQSKDN--DAYKSVLAALKAGYKHIDTAAIYRNEDQVGQAIKD- 68
             LN G  IP +G GT+  ++   +  ++V AA+KAGY+HIDTA +Y +E  VG+AIK+ 
Sbjct: 11  FKLNNGTTIPALGFGTYAPRERIPETKQAVKAAIKAGYRHIDTAWVYESEPYVGEAIKEM 70

Query: 69  ---SGVPREEIFVTTKLWSTQHHEPAKALDESLQRLGLDYVDLYLIHWP---ARLDTNYI 122
                V R ++FVTTK+W        K+L+ESL+ LGLDYVDL L HWP    R++    
Sbjct: 71  IEEGEVSRSDLFVTTKVWPVYWDNVEKSLNESLEALGLDYVDLLLQHWPLCFPRVEDEKN 130

Query: 123 KDGDILSVPTKADGSRAVDVTNWNFIKTWELMQEL---PKTGKTKAIGVSNFSINNLKDL 179
               +++ P   +G   ++    +F++T+  ++++   P   + +AIGVSN++I  L+ L
Sbjct: 131 GVNGLVAYPEDDEGKPLLN-EKGDFLETYRQIEKIYLNPDDHRVRAIGVSNYAIEYLEAL 189

Query: 180 LASPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKIA 239
                 K+ P  NQVEIHP LPQ EL  FC +  I++ AYSPLGS  AP LK P + ++A
Sbjct: 190 FKE--CKVKPVVNQVEIHPHLPQLELNKFCHNHGILLTAYSPLGSDGAPNLKIPLVHQLA 247

Query: 240 KKNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFTLSNEDFEAINNISKEKGEKR 299
           +K ++    ++IS+H ++G  V+P+S+NP RI +  +    + E+ + ++N+  E+  + 
Sbjct: 248 EKYDMSLNDILISYHIRKGNTVIPRSLNPVRIASTIEFAPFTQEELKQLDNVGIEEPARF 307

Query: 300 V 300
           V
Sbjct: 308 V 308

>KNAG0K02070 Chr11 complement(419556..420527) [972 bp, 323 aa] {ON}
           Anc_3.108 YBR149W
          Length = 323

 Score =  198 bits (503), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 116/295 (39%), Positives = 177/295 (60%), Gaps = 15/295 (5%)

Query: 12  LSLNTGAQIPQVGLGTWQSKDNDAY--KSVLAALKAGYKHIDTAAIYRNEDQVGQAIKD- 68
             LN G  +P +GLGT   +++ A   ++V AA+KAGY+HIDTA  Y  E  +G A+K+ 
Sbjct: 11  FKLNNGVNMPALGLGTASPREHMAETKQAVKAAIKAGYRHIDTAWFYGTEGYIGDALKEL 70

Query: 69  ---SGVPREEIFVTTKLWSTQHHEPAKALDESLQRLGLDYVDLYLIHWPARLD-TNYIKD 124
                V R ++F+T+K+W     +   +L+ESL+ LGLDYVDLYL HWP         KD
Sbjct: 71  LENGDVKRSDLFITSKVWPVYWDDVDLSLNESLKSLGLDYVDLYLQHWPLCFQKIEDSKD 130

Query: 125 G--DILSVPTKADGSRAVDVTNWNFIKTWELMQEL---PKTGKTKAIGVSNFSINNLKDL 179
           G   +   P   DG+ A+ V   +++ T++ M+++   PK  + +AIGVSN+ +  L  L
Sbjct: 131 GVNGLKGKPIDKDGN-ALIVEGADYLSTYKQMEKIYLDPKDNRVRAIGVSNYPVEYLDRL 189

Query: 180 LASPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKIA 239
           L     K  PA NQVE+HP LPQ EL  FC+   I + AYSPLGS+ APLLK P + +++
Sbjct: 190 LKVCTVK--PAVNQVEMHPHLPQFELREFCELHDIKLTAYSPLGSSGAPLLKLPLVKELS 247

Query: 240 KKNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFTLSNEDFEAINNISKE 294
           +K  V    V+IS+H ++G  V+P+S+NP R+       TL+  + + +++I ++
Sbjct: 248 EKYQVTLNDVLISYHIRKGSFVIPRSLNPVRLAGCVNFVTLTEGELDQLDDIGRK 302

>SAKL0C09922g Chr3 (897779..898747) [969 bp, 322 aa] {ON} similar to
           uniprot|P38115 Saccharomyces cerevisiae YBR149W ARA1
           Large subunit of NADP dependent arabinose dehydrogenase
           involved in carbohydrate metabolism small subunit is
           unidentified
          Length = 322

 Score =  193 bits (491), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 114/306 (37%), Positives = 179/306 (58%), Gaps = 23/306 (7%)

Query: 12  LSLNTGAQIPQVGLGTWQSKDN--DAYKSVLAALKAGYKHIDTAAIYRNEDQVGQAIKD- 68
            +LN G +IP VGLGT   KD      ++V AA+KAG++ IDTA  Y  E+ +G+A+++ 
Sbjct: 11  FNLNNGTRIPAVGLGTANPKDKWPQTKEAVKAAVKAGFRQIDTAWAYGTEEYIGEALQEL 70

Query: 69  ---SGVPREEIFVTTKLWSTQHHEPAKALDESLQRLGLDYVDLYLIHWPARLDTNYIK-- 123
                V RE++F+TTK+W     +  K+L+ESL+RL LDYVDL L HWP      ++K  
Sbjct: 71  FAEGVVKREDLFITTKVWPNYWDQAEKSLNESLKRLQLDYVDLLLQHWP----FCFVKKQ 126

Query: 124 ----DGDILSVPTKADGSRAVDVTNWNFIKTWELMQEL---PKTGKTKAIGVSNFSINNL 176
                G +++ P   DGS   D T  ++++T++ ++ +       + +AIGVSN+ I  L
Sbjct: 127 DPEGSGQLVNHPQHEDGSPFYD-TAGDWLETYKQIEAIYLAENDTRVRAIGVSNYPIEYL 185

Query: 177 KDLLASPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTIL 236
           + L      K  PA NQVE+HP LPQ EL ++C    I++ +YSPLGS  AP L+ P + 
Sbjct: 186 ERLFKE--CKTVPAINQVELHPRLPQRELCDYCNKHGILMTSYSPLGSNGAPNLRIPLVQ 243

Query: 237 KIAKKNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFTLSNEDFEAINNISKEKG 296
           ++A K N     V++S+H ++G +V+P+S+N +RI        L+ E+ + +N    E  
Sbjct: 244 ELASKYNANGNDVLVSYHIRQGTIVIPRSLNLERISKGLGFVPLTKEELDKLNQYGVEH- 302

Query: 297 EKRVVN 302
           E R ++
Sbjct: 303 EYRYID 308

>ZYRO0B06138g Chr2 complement(491830..492816) [987 bp, 328 aa] {ON}
           similar to uniprot|P38115 Saccharomyces cerevisiae
           YBR149W ARA1 Large subunit of NADP dependent arabinose
           dehydrogenase involved in carbohydrate metabolism small
           subunit is unidentified
          Length = 328

 Score =  190 bits (482), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 116/323 (35%), Positives = 189/323 (58%), Gaps = 25/323 (7%)

Query: 1   MSTTLH--DSTKTLSLNTGAQIPQVGLGTW--QSKDNDAYKSVLAALKAGYKHIDTAAIY 56
           M+  LH   +  + +LN G ++P +GLGT     +     ++V AA+KAGY+HIDTA  Y
Sbjct: 1   MARLLHPKGTEISFTLNNGVRMPALGLGTANPHPEIGRTKQAVKAAVKAGYRHIDTAWAY 60

Query: 57  RNEDQVGQAIKD----SGVPREEIFVTTKLWSTQHHEPAKALDESLQRLGLDYVDLYLIH 112
            +E  VG+AIK+      + RE+IF+T+K+W     +  ++L+ESL+ LG+DY+DL+L H
Sbjct: 61  GSEPFVGEAIKELMEEGVIRREDIFITSKVWPVLWDDVERSLNESLESLGVDYIDLWLQH 120

Query: 113 WPARLDTNYIKDGDILSV------PTKADGSRAVDVTNWNFIKTWELMQEL---PKTGKT 163
           WP      Y+K  D   +      P   +G    +V   ++++T+  M+++   P   + 
Sbjct: 121 WP----LCYVKQEDTHGINGLARNPETPNGEPYYEVDG-DWLETYVQMEKIYLDPSDNRV 175

Query: 164 KAIGVSNFSINNLKDLLASPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLG 223
           ++IGVSNF +  L+  L     K  PA NQVE+HP LPQ EL  FC++  I++EAYSPLG
Sbjct: 176 RSIGVSNFPVQYLERTLFECAVK--PAVNQVEMHPRLPQFELNKFCRAHNILLEAYSPLG 233

Query: 224 STDAPLLKEPTILKIAKKNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFTLSNE 283
           S +AP +    +  +A+K ++ P  ++ S+H ++G  V+ +SVN  RI +N +   L+ E
Sbjct: 234 SHNAPNVHLQLVQDLAEKYSMSPSGILNSYHIRQGNAVVSRSVNTMRIASNVEFAALTEE 293

Query: 284 DFEAINNISKEKGEKRVVNPNWS 306
           + + ++ +   K  KR VN  W+
Sbjct: 294 ELDNLDQLGITK-PKRFVNEKWN 315

>TDEL0D05160 Chr4 complement(935981..936958) [978 bp, 325 aa] {ON}
           Anc_3.108 YBR149W
          Length = 325

 Score =  187 bits (476), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 115/315 (36%), Positives = 185/315 (58%), Gaps = 17/315 (5%)

Query: 5   LHDSTKTLS--LNTGAQIPQVGLGTWQSKDN--DAYKSVLAALKAGYKHIDTAAIYRNED 60
           LH  +  +S  LN G ++P +GLGT    +   +  ++V AA+KAGY++IDTA  Y +E 
Sbjct: 2   LHPKSTEISFLLNNGVRMPAIGLGTANPPEKLAETKQAVKAAVKAGYRNIDTAWAYGSEP 61

Query: 61  QVGQAIKD----SGVPREEIFVTTKLWSTQHHEPAKALDESLQRLGLDYVDLYLIHWPAR 116
            VG+AIK+      + RE++F+T+K+W     +  ++L ESL+ LG+DY+DL+L HWP  
Sbjct: 62  FVGEAIKELIEEGAIKREDLFITSKVWPVLWDDAERSLQESLKSLGVDYIDLWLQHWPLC 121

Query: 117 LDTNYIKDG--DILSVPTKADGSRAVDVTNWNFIKTWELMQEL---PKTGKTKAIGVSNF 171
            +      G   +   P KADGS   +    +++ T++ M+ +   PK  + +AIGVSNF
Sbjct: 122 YNRREDPHGINGLARNPEKADGSPDFN-EKADWLDTYKQMERIYSNPKDNRVRAIGVSNF 180

Query: 172 SINNLKDLLASPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLK 231
            +  LK +L      + P  NQVE+HP LPQ EL  FC    I + AYSPLGS  AP++K
Sbjct: 181 PVEYLKRVLKE--CPVKPVLNQVEMHPRLPQFELNEFCHDNDIKLTAYSPLGSHGAPMVK 238

Query: 232 EPTILKIAKKNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFTLSNEDFEAINNI 291
            P I ++++K       ++ S+H ++G  V+P+S+N  RI +N +   LS +D + + ++
Sbjct: 239 HPLIKEMSQKYKASENDILTSFHIRQGNTVVPRSINSVRIASNIEFVPLSKDDLDKLKDL 298

Query: 292 SKEKGEKRVVNPNWS 306
            + +  KR +N  W+
Sbjct: 299 GRTE-PKRFINEKWN 312

>Ecym_5508 Chr5 (1035144..1036124) [981 bp, 326 aa] {ON} similar to
           Ashbya gossypii ACL107C
          Length = 326

 Score =  181 bits (459), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 114/327 (34%), Positives = 172/327 (52%), Gaps = 29/327 (8%)

Query: 9   TKTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNEDQVG----Q 64
           T+T +LN G ++P VGLG W+   + A   V  A+K GY+  D A  Y NE ++G    Q
Sbjct: 4   TRTYTLNNGMKMPVVGLGCWKLSADVAATQVYEAIKLGYRLFDGALCYGNEKEIGVGIKQ 63

Query: 65  AIKDSGVPREEIFVTTKLWSTQHH--EPAKALDESLQRLGLDYVDLYLIHWPARLDTNYI 122
           AI +  V RE++F+ +KLW   HH      AL  +L  LGLDYVDLY IH+P  +    +
Sbjct: 64  AINEGLVKREDLFIVSKLWCNFHHPDHVKLALQRTLNDLGLDYVDLYYIHFPLPIKYVPL 123

Query: 123 KDGDILSVPTKADGSRAVDVTNWN--FIKTWELMQELPKTGKTKAIGVSNFSINNLKDLL 180
           ++     + T  +  R   V+      + T+  M++L   G  K++G+SNF    ++DLL
Sbjct: 124 EEKYPPEMYTGEEDRRNNIVSEQQVPILDTYRAMEKLVDEGLVKSLGLSNFQACLIQDLL 183

Query: 181 ASPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTD------------AP 228
              G ++ P A QVE+HP L Q  L+ + +SK I + AYS  G                P
Sbjct: 184 R--GARIKPVALQVELHPYLSQERLVTYAQSKDIQVVAYSTFGPLSFLELGNSAAKDVTP 241

Query: 229 LLKEPTILKIAKKNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNR---KIFTLSNEDF 285
           LL+   +L IAKK++V P  V++ W  QRG  V+PKS   +R+  N    K  TLS+ + 
Sbjct: 242 LLEHEIVLNIAKKHDVTPSQVILRWATQRGIAVIPKSSKKERLLNNLNSDKALTLSDSEM 301

Query: 286 EAINNISKEKGEKRVVNP-NWSPFEAF 311
             I +++K     R ++P +W+    F
Sbjct: 302 SDIFSLNK---NLRFLDPWDWARLPGF 325

>ACL107C Chr3 complement(152564..153628) [1065 bp, 354 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR104W
           (GRE3)
          Length = 354

 Score =  179 bits (453), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 105/308 (34%), Positives = 171/308 (55%), Gaps = 25/308 (8%)

Query: 8   STKTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNEDQVGQAIK 67
           + +T+ LN GA +P VGLG W+  +  A + V  A+K GY+ +D A  Y NE +VGQ I+
Sbjct: 29  NVRTIKLNNGADMPLVGLGCWKIPNEVAAEQVYEAIKLGYRLLDGAEDYANEREVGQGIR 88

Query: 68  ---DSG-VPREEIFVTTKLWSTQHH--EPAKALDESLQRLGLDYVDLYLIHWPARLDTNY 121
              D G V REE+FV +KLW+  H   +  KAL  +L  LGLDY+DL+ IH+P       
Sbjct: 89  RAIDEGLVRREELFVVSKLWNNYHRPEDVGKALQRTLSDLGLDYLDLFYIHFPLAFKFVP 148

Query: 122 IKDGDILSVPTKADGSRAVDVTN--WNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDL 179
           +++     + T A   +A  +       I+T+  +++L   G+ +AIG+SNF    ++DL
Sbjct: 149 LEERYPAGLYTGAADEQAGRLAQEPVPLIETYRALEQLVDEGRIRAIGLSNFQGCLVQDL 208

Query: 180 LASPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLG------------STDA 227
           L   G ++ PAA Q+E HP L Q  L+ + KS+ + +  YS LG               A
Sbjct: 209 LR--GCRIRPAALQIEHHPYLTQERLVQYAKSEGLAVVGYSSLGPQSFLELGNTAAQNAA 266

Query: 228 PLLKEPTILKIAKKNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKI---FTLSNED 284
           PLL+   + +IA+++   P  V++ W  QR   V+PKS   +R+ TN ++    TL++++
Sbjct: 267 PLLQHEVVCRIAERHTATPAEVLLRWATQRDIAVIPKSSRKERLATNLRVDEALTLADDE 326

Query: 285 FEAINNIS 292
              +++++
Sbjct: 327 LRELSSLN 334

>Ecym_7160 Chr7 (334780..335595) [816 bp, 271 aa] {ON} similar to
           Ashbya gossypii ABL209C
          Length = 271

 Score =  176 bits (445), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 103/293 (35%), Positives = 155/293 (52%), Gaps = 38/293 (12%)

Query: 10  KTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNEDQVGQAIKD- 68
           KT +L  G  +P +GLG +    N   + V  ALK GY+H DTA  Y NE +VG+ I   
Sbjct: 4   KTYTLTNGCLMPSLGLGCYSIPKNTTAQVVHQALKCGYRHFDTAVFYGNETEVGEGIAAW 63

Query: 69  -----SGVPREEIFVTTKLWSTQ--HHEPAKALDESLQRLG-LDYVDLYLIHWPARLDTN 120
                S   R+++F  TKLW++Q  + E   A+ + LQ++  L Y+DL LIH PA     
Sbjct: 64  LAEDPSSNRRQDVFYVTKLWNSQNGYTEAKTAIQQCLQKVAPLGYIDLLLIHSPA----- 118

Query: 121 YIKDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDLL 180
                                  +   + T+E MQE    G  K+IGVSN+  ++L++L 
Sbjct: 119 ---------------------CGSAKRLATYEAMQESVDAGIVKSIGVSNYERHHLQELY 157

Query: 181 ASPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKIAK 240
           A P  K  P  NQ+E+ P LP+N+L+++CKS  + I+AYSPLG  D   + +P I  +A 
Sbjct: 158 AMPNLKHNPVVNQIEVTPWLPRNDLVDYCKSIGLAIQAYSPLGCGDR--VNDPYIASLAT 215

Query: 241 KNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFTLSNEDFEAINNISK 293
           + N  P  ++I+W   +GY  LPK+ N  R+++N   + +S    E + NI K
Sbjct: 216 QKNCTPAQILIAWSLAKGYAPLPKTQNIQRLQSNLDSYNVS-LTAEELTNIEK 267

>NCAS0A06660 Chr1 (1316398..1317378) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  174 bits (440), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 106/307 (34%), Positives = 167/307 (54%), Gaps = 25/307 (8%)

Query: 10  KTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNEDQVGQAIK-- 67
           K L+LN G ++PQVGLG W+  ++     V  A+KAGY+  D A  Y NE +VG+ +K  
Sbjct: 3   KLLTLNNGMKMPQVGLGCWKIPNDICADQVYEAIKAGYRLFDGATDYANEVEVGKGLKRA 62

Query: 68  --DSGVPREEIFVTTKLWSTQHHEPAKALD--ESLQRLGLDYVDLYLIHWPARLDTNYIK 123
             D  V R+++FV +KLW+  HH     L+   +L+ LGLDY+DLY IH+P       ++
Sbjct: 63  MDDGIVKRQDLFVVSKLWNNFHHPDHVKLNLKRNLKDLGLDYLDLYYIHFPIAFKFVPME 122

Query: 124 DGDILSVPT-KADGSRAVDV-TNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDLLA 181
           +     + T KAD ++ +    N   + T+  ++E  + G  K+IG+SNF+   + D+L 
Sbjct: 123 ERYPPQMYTGKADEAKGILTEENVPLLDTYRALEECQREGLIKSIGISNFNGGLVADILR 182

Query: 182 SPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLG------------STDAPL 229
             G  + P A Q+E HP L Q +L+ +CK   + +  YS  G                PL
Sbjct: 183 --GCSIKPVALQIEHHPYLTQEKLLEYCKIHDVQVVGYSSFGPQSFADCGMDLAKNTPPL 240

Query: 230 LKEPTILKIAKKNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKI---FTLSNEDFE 286
              P I KIA+K+NV    V++ W  QRG  ++PKS +  R+ +N  I    TL+ ED +
Sbjct: 241 FDHPVIKKIAEKHNVSTAEVLLRWATQRGVAIIPKSSHKKRLLSNLNIDDNVTLTEEDLK 300

Query: 287 AINNISK 293
           +I+ +++
Sbjct: 301 SISGLNQ 307

>KLLA0F03256g Chr6 (306731..307588) [858 bp, 285 aa] {ON} highly
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 285

 Score =  172 bits (437), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 104/280 (37%), Positives = 153/280 (54%), Gaps = 37/280 (13%)

Query: 10  KTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNEDQVGQAIKD- 68
           K+  L++G  IP VGLGT++   N     V  AL+ GY+H DTA +Y NE +VGQ IK  
Sbjct: 7   KSYKLSSGYTIPSVGLGTYELPPNKTAYLVHQALEVGYRHFDTAVLYGNEYEVGQGIKKW 66

Query: 69  -----SGVPREEIFVTTKLWSTQH-HEPAK-ALDESLQRL-GLDYVDLYLIHWPARLDTN 120
                +   R ++F TTKLW +QH +E AK A+D  LQ +  L Y+DL LIH P      
Sbjct: 67  LNENPAENKRGDVFYTTKLWDSQHGYEKAKKAIDHCLQEVEDLGYIDLLLIHSPL----- 121

Query: 121 YIKDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDLL 180
                          G + +       ++T+E MQE    GK ++IGVSN+   ++++LL
Sbjct: 122 ---------------GGKKLR------LETYEAMQEAVDAGKVRSIGVSNYGFQHIEELL 160

Query: 181 ASPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKIAK 240
                K  P  NQ+EI P   + EL +FCK K I++EAY+PL  T    LK+P ++K+A 
Sbjct: 161 NWEKLKYKPVVNQIEISPWCMRQELADFCKKKGILVEAYAPL--THGTKLKDPDLVKVAN 218

Query: 241 KNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFTL 280
           +     G  +I W  Q+GY+ LPK+ +  R+ +N  +F+ 
Sbjct: 219 EVGCDVGQALIRWSLQKGYIPLPKTQSVSRLASNLDVFSF 258

>TBLA0F01720 Chr6 complement(430289..431269) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  173 bits (438), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 109/304 (35%), Positives = 163/304 (53%), Gaps = 25/304 (8%)

Query: 13  SLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNEDQVGQ----AIKD 68
           +LN G ++P VGLG W+  +    + V  A+K GY+  D A  Y NE +VGQ    AI +
Sbjct: 6   ALNNGLKMPMVGLGCWKIPNTVCAEQVYQAIKLGYRLFDGAEDYGNEKEVGQGIRRAIDE 65

Query: 69  SGVPREEIFVTTKLWSTQHH--EPAKALDESLQRLGLDYVDLYLIHWPARLDTNYIKDGD 126
             V R ++F+ +KLW+T HH      A+ ++L  LGLDY+DLY IH+P       I++  
Sbjct: 66  KIVKRSDLFIVSKLWNTYHHPDHVKLAVKKTLSDLGLDYLDLYYIHFPLAFKFVPIEEKY 125

Query: 127 ILSVPT-KADGSRA-VDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDLLASPG 184
                T K D ++  + +    ++ T+  M+ L + G  K+IGVSN     L+D+L   G
Sbjct: 126 PPGFYTGKEDAAQGKISLQKVPYLDTYHAMEALVEEGLIKSIGVSNLQGGLLQDVLM--G 183

Query: 185 NKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGST-----------DAP-LLKE 232
            K+ P   Q+E HP L Q+ L+++CK ++I++ AYS  G             D P L   
Sbjct: 184 CKIKPVTLQIEHHPYLTQSRLVDYCKREQIIVVAYSSFGQQSYLELGSELKEDTPNLFDH 243

Query: 233 PTILKIAKKNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKI---FTLSNEDFEAIN 289
           P I +IA K NV    V++ W  Q G  V+PKS   +R+  N  I    TLSNE+   I+
Sbjct: 244 PVIKRIASKYNVTTSEVLLRWANQNGVAVIPKSSKKERLLMNLNIESTLTLSNEELVEIS 303

Query: 290 NISK 293
           NI++
Sbjct: 304 NINR 307

>KLTH0F16610g Chr6 complement(1346319..1347308) [990 bp, 329 aa]
           {ON} highly similar to uniprot|P38715 Saccharomyces
           cerevisiae YHR104W GRE3 Aldose reductase involved in
           methylglyoxal d-xylose and arabinose metabolism stress
           induced (osmotic ionic oxidative heat shock starvation
           and heavy metals) regulated by the HOG pathway
          Length = 329

 Score =  170 bits (431), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 109/310 (35%), Positives = 169/310 (54%), Gaps = 27/310 (8%)

Query: 9   TKTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNEDQVGQAIK- 67
           ++T+ LN G ++P VGLG W+  +      V  A+K GY+  D A  Y NE +VGQ I+ 
Sbjct: 5   SETVKLNNGLEMPLVGLGCWKIPNEVCASQVYEAIKLGYRLFDGAQDYGNEKEVGQGIRK 64

Query: 68  --DSG-VPREEIFVTTKLWSTQHHEP---AKALDESLQRLGLDYVDLYLIHWPARLDTNY 121
             D G V RE++FV +KLW++ +H+P    KAL  +LQ LGL+Y+DL+ IH+P       
Sbjct: 65  AIDEGIVKREDLFVVSKLWNS-YHDPKNVKKALKRTLQDLGLEYLDLFYIHFPLAFKFVP 123

Query: 122 IKDGDILSVPTKADGSR--AVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDL 179
            ++       T A+  +   + +     + T+  +++    G  KAIGVSNF    L DL
Sbjct: 124 FEERYPPGFYTGAEDEKKGVISLEKVTVLDTYRALEQCVDEGLIKAIGVSNFRGILLHDL 183

Query: 180 LASPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLG-----STDAPLLKE-P 233
           LA  G K+ PA  Q+E HP L Q +L+ +CK + I + AYS  G       D+ L K  P
Sbjct: 184 LA--GAKIPPACLQIEHHPYLTQEKLVEYCKQQGIQVVAYSSFGPQSFLEMDSQLAKSTP 241

Query: 234 TIL------KIAKKNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKI---FTLSNED 284
           T+       K+A  + V    V++ W  QR   ++PKS   +R+  N +I    TLS+E+
Sbjct: 242 TLFEHDVVKKVANNHGVSTSEVLLRWATQRRVAIIPKSSKKERLLNNLQINEKLTLSDEE 301

Query: 285 FEAINNISKE 294
            + I++++K+
Sbjct: 302 LQEISSLNKD 311

>CAGL0I01122g Chr9 (93934..94914) [981 bp, 326 aa] {ON} highly
           similar to uniprot|P38715 Saccharomyces cerevisiae
           YHR104w GRE3 aldose reductase
          Length = 326

 Score =  169 bits (428), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 105/308 (34%), Positives = 164/308 (53%), Gaps = 25/308 (8%)

Query: 9   TKTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNEDQVGQAIK- 67
           +  ++LN G ++P VGLG W+  ++   + V  A+K GY+  D A  Y NE +VGQ I+ 
Sbjct: 2   SSVVTLNNGLKMPLVGLGCWKIPNDVCAQQVYDAIKIGYRLFDGAEDYGNEKEVGQGIRK 61

Query: 68  --DSG-VPREEIFVTTKLWSTQHH--EPAKALDESLQRLGLDYVDLYLIHWPARLDTNYI 122
             D G V RE++FV +KLW++ HH      AL  +L  +GLDY+DL+ IH+P        
Sbjct: 62  AIDEGVVKREDVFVVSKLWNSFHHPDHVKMALKRTLSDMGLDYLDLFYIHFPIAFKYVPF 121

Query: 123 KDGDILSVPTKADGSRAVDVTNWN--FIKTWELMQELPKTGKTKAIGVSNFSINNLKDLL 180
           ++       T  +  +   +T  +   I T+  +++  + G  K+IG+SNFS + ++DLL
Sbjct: 122 EEKYPPGFYTGKEDEKNGHITEAHVPIIDTYRALEQCVEEGLIKSIGISNFSGSLVQDLL 181

Query: 181 ASPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYS------------PLGSTDAP 228
                K+ P A QVE HP L Q  L+ +CK   I + AYS            PL      
Sbjct: 182 RQ--CKIKPVALQVEHHPYLTQEHLVEYCKDNGIQVVAYSSFGPQSYIELNHPLAKNTPN 239

Query: 229 LLKEPTILKIAKKNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKI---FTLSNEDF 285
           L    TI +IA  +NV    V++ W  QRG  ++PKS   +R++ N  I    TL++++ 
Sbjct: 240 LFHHDTIKQIANNHNVATSQVLLRWATQRGIAIIPKSSKKERLQDNLMIDEKLTLTHKEL 299

Query: 286 EAINNISK 293
           EAI+ ++K
Sbjct: 300 EAISKLNK 307

>KNAG0B03780 Chr2 (725307..726287) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  168 bits (426), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 107/309 (34%), Positives = 165/309 (53%), Gaps = 27/309 (8%)

Query: 9   TKTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNEDQVGQAIK- 67
           ++T++LN G  +P VGLG W+   +   + V  A+K GY+  D A  Y NE QVG  I+ 
Sbjct: 2   SETVTLNNGLTMPLVGLGCWKISPDICAEQVYEAIKLGYRLFDGACDYGNEKQVGDGIRR 61

Query: 68  --DSG-VPREEIFVTTKLWSTQHHEPAK---ALDESLQRLGLDYVDLYLIHWPARLDTNY 121
             D G V RE++FV +KLW+T +H+P     AL  +L  + L+Y+DLY IH+P       
Sbjct: 62  AIDEGIVKREDLFVVSKLWNT-YHDPKHVKLALQRTLDDMKLEYLDLYYIHFPLAFKFVP 120

Query: 122 IKDGDILSVPTKADGSRAVDVTNWN--FIKTWELMQELPKTGKTKAIGVSNFSINNLKDL 179
            ++       T A+ ++   +T      I T+  M+EL   G TK+IG+SN++   ++D 
Sbjct: 121 FEERYPPGFYTGAEDAKKGILTEEKVALIDTYRAMEELVDEGLTKSIGISNYAGALVQDT 180

Query: 180 LASPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTD------------A 227
           L   G ++ P   Q+E HP L Q +L+ +CK   I + AYS  G                
Sbjct: 181 LR--GCRIKPVCLQIEHHPYLTQEKLVEYCKLNGIQVVAYSSFGPQSFVDIDQKLAKHTP 238

Query: 228 PLLKEPTILKIAKKNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKI---FTLSNED 284
           PL   P I KIA+++ V    V++ W  QRG  V+PKS +  R+  N +I    TL+ +D
Sbjct: 239 PLFDHPVIKKIAQEHKVTTSQVILRWATQRGIAVIPKSAHKGRLLGNLQIDQAVTLTPKD 298

Query: 285 FEAINNISK 293
            E I++++K
Sbjct: 299 LEEISSLNK 307

>KLTH0G02420g Chr7 complement(188767..189636) [870 bp, 289 aa] {ON}
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 289

 Score =  167 bits (423), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 110/321 (34%), Positives = 176/321 (54%), Gaps = 47/321 (14%)

Query: 1   MSTTLHDSTKTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNED 60
           MS T   ++ T +L  G +IP +G GT+++    A   V AA K GY+H+DTA +Y NE 
Sbjct: 1   MSIT---ASTTKTLTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENER 57

Query: 61  QVGQAI----KDS-GVPREEIFVTTKLWSTQH-HEPA-KALDESLQRLG-LDYVDLYLIH 112
           +   A+    K+S  V R+++F TTK+    H +E A K++ ESL+    L+YVDL+LIH
Sbjct: 58  ECATAVAKFLKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIH 117

Query: 113 WPARLDTNYIKDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFS 172
            P                   A+  +         + T++ +QE  K GK KAIGVS++S
Sbjct: 118 NPC------------------AETEKR--------LGTYKALQEFYKAGKIKAIGVSSYS 151

Query: 173 INNLKDLLASPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKE 232
           I +L++L +  G ++ P  NQ E++P L + +L+ +CK + ++IEA+SP+  T +    +
Sbjct: 152 IKHLEELYSWEGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPI--TRSKRFSD 209

Query: 233 PTILKIAKKN--NVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKI--FTLSNEDFEAI 288
           P + K+ K++     P  ++I W  Q G+V LPKSV+ DR E+N     F +S ED + +
Sbjct: 210 PVVQKLLKESYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKTL 269

Query: 289 NNISKEKGEKRVVNPNWSPFE 309
            +     GE  +  P + P E
Sbjct: 270 TH----DGEHFLAQPGFDPIE 286

>SAKL0F14278g Chr6 (1143922..1144782) [861 bp, 286 aa] {ON} highly
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 286

 Score =  167 bits (422), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 96/280 (34%), Positives = 153/280 (54%), Gaps = 37/280 (13%)

Query: 10  KTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNEDQVGQAI--- 66
           K   L++G  +P +GLGT+    N   + V  ALK GY+H+DTA +Y NE +VG+ I   
Sbjct: 8   KAYKLSSGYTLPSIGLGTYDLPSNATSEIVYEALKCGYRHLDTAVLYGNEREVGEGILKW 67

Query: 67  ---KDSGVPREEIFVTTKLWSTQ--HHEPAKALDESLQRL-GLDYVDLYLIHWPARLDTN 120
                S   RE++F  TKLW++Q  ++   +A+ E  +++ GL Y+DL LIH P      
Sbjct: 68  LKENPSSNKREDVFYATKLWNSQNGYNNAKRAIQECFEKVEGLGYIDLLLIHSPL----- 122

Query: 121 YIKDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDLL 180
                          GSR         ++T++ MQE    G  ++IGVSN+ ++++ +LL
Sbjct: 123 --------------SGSR-------KRLETYKAMQEAVDKGIVRSIGVSNYGVHHIDELL 161

Query: 181 ASPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKIAK 240
                K  P  NQ+EI P L + EL ++CKS+ +++EAY+PL  T    +  P +L++AK
Sbjct: 162 NWNELKYKPFVNQIEISPWLMRQELADYCKSRGLIVEAYAPL--THGYKINHPNVLRVAK 219

Query: 241 KNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFTL 280
           +     G V+I W  Q GYV LPK+ +  R+ +N  ++ +
Sbjct: 220 EAGCNSGQVLIRWSLQHGYVPLPKTKSVKRLPSNLDVYNI 259

>KNAG0D01370 Chr4 complement(230193..231041) [849 bp, 282 aa] {ON}
           Anc_7.468 YJR096W
          Length = 282

 Score =  167 bits (422), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 102/291 (35%), Positives = 159/291 (54%), Gaps = 38/291 (13%)

Query: 10  KTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNEDQVGQAI--- 66
           K+  L +G  IP +GLGT+    ++    V AAL+ GY+H+DTA +Y NE +V Q     
Sbjct: 5   KSYKLASGFNIPTIGLGTYDLPPSNTTAIVEAALEVGYRHLDTAVLYGNEAEVAQGAMNF 64

Query: 67  --KDSGVPREEIFVTTKLWSTQ--HHEPAKALDESLQRLG-LDYVDLYLIHWPARLDTNY 121
             +   V RE+IF TTKLW++Q  + +  +A+ E ++ +G L Y+DL L+H P  +    
Sbjct: 65  LGRHPDVSREDIFYTTKLWNSQFGYEKAKRAIRECVECIGGLGYIDLLLMHSP--IGGKQ 122

Query: 122 IKDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDLLA 181
           ++ G                        TW+ MQE    G  ++IGVS++   +L+DL  
Sbjct: 123 VRRG------------------------TWKAMQEAVDDGLVRSIGVSSYGQRHLEDLFE 158

Query: 182 SPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKIAKK 241
               K  PA NQ+EI P + + +L ++CKSK I++EAYSPL  T    L +P +LK+A++
Sbjct: 159 WSELKHAPAVNQIEISPWIMRQQLADYCKSKGIVVEAYSPL--THGYKLDDPDLLKVAEE 216

Query: 242 NNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIF--TLSNEDFEAINN 290
               PG V++ W  Q GYV LPK+    R++ N  +F   LS E  + +++
Sbjct: 217 TGKNPGQVLLRWSLQHGYVPLPKTKTVSRLQLNLDVFDWELSPEHMKLLDH 267

>KAFR0C05320 Chr3 complement(1065934..1066917) [984 bp, 327 aa] {ON}
           
          Length = 327

 Score =  166 bits (421), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 107/306 (34%), Positives = 163/306 (53%), Gaps = 26/306 (8%)

Query: 12  LSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNEDQVGQAIK---D 68
           ++LN G ++P VGLG W+  ++   + V  A+K GY+  D A  Y NE +VGQ IK   D
Sbjct: 5   VTLNNGQKMPLVGLGCWKISNDICAEQVYQAIKLGYRLFDGATDYGNEVEVGQGIKKAID 64

Query: 69  SG-VPREEIFVTTKLWSTQHH--EPAKALDESLQRLGLDYVDLYLIHWPARLDTNYIKDG 125
            G V R ++FV +KLW++ HH      AL  +LQ LGLDY+DLY IH+P        ++ 
Sbjct: 65  EGLVKRSDLFVVSKLWNSYHHPDHVKLALKRNLQDLGLDYIDLYYIHFPIAFKFVPFEEK 124

Query: 126 DILSVPTKADGSRAVDVTNWN--FIKTWELMQELPKTGKTKAIGVSNFSINNLKDLLASP 183
                 T  D +R   ++      + T+  ++E    G  K+IG+SNF+   ++DLL   
Sbjct: 125 YPPGFYTGVDDAREGILSEAKVPILDTYRALEECVDNGLIKSIGISNFNGVLVQDLLN-- 182

Query: 184 GNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLG------------STDAPLLK 231
           G ++ P A Q+E HP L Q +L+ +CK K I + AYS  G             +   LL+
Sbjct: 183 GCRIKPVALQIEHHPYLTQEKLVEYCKLKGIQVVAYSSFGPQSFIELDSQLAKSTPSLLE 242

Query: 232 EPTILKIAKKN-NVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKI---FTLSNEDFEA 287
            P I KIA  + +  P  V++ W  QRG  V+PKS   +R+  N  +    TL+ E+   
Sbjct: 243 HPIIKKIAAAHRSSTPSEVLLRWATQRGIAVIPKSTKKERLLQNLNVEDSITLTEEELNE 302

Query: 288 INNISK 293
           I++++K
Sbjct: 303 ISSLNK 308

>CAGL0C04543g Chr3 (434137..435000) [864 bp, 287 aa] {ON} highly
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096w
          Length = 287

 Score =  165 bits (418), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 98/287 (34%), Positives = 157/287 (54%), Gaps = 38/287 (13%)

Query: 1   MSTTLHDSTKTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNED 60
           MS T+ D  K   L  G +IP + LGT+   ++   K V  ALK GY+H DTA +Y NE 
Sbjct: 1   MSVTV-DVPKYYELQDGRKIPSLALGTYDIPNSVTAKVVTEALKCGYRHFDTAVLYGNER 59

Query: 61  QVGQAIKD------SGVPREEIFVTTKLWSTQ--HHEPAKALDESLQRL-GLDYVDLYLI 111
           +VGQ I +      +   RE++F TTKLW++Q  ++E  +A+ E +Q++ GL Y+D+ LI
Sbjct: 60  EVGQGIVNWINEDKAHNKREDVFYTTKLWNSQNGYNEAKRAIKECMQKVSGLGYIDMLLI 119

Query: 112 HWPARLDTNYIKDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNF 171
           H P                     G R         ++TW+ MQE    G  K+IGVSN+
Sbjct: 120 HSPL-------------------SGQR-------RRLETWKAMQEAVDEGIVKSIGVSNY 153

Query: 172 SINNLKDLLASPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLK 231
             +++++LL     K  P  NQ+EI P + + EL ++CKS  +++EAY+P+       + 
Sbjct: 154 GKHHIEELLGWDELKYKPVVNQIEISPWVMRQELADYCKSVNLVVEAYAPMAH--GYKMN 211

Query: 232 EPTILKIAKKNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIF 278
           +P + +I+K+  + PG ++I W  Q GY+ LPK+    R+ +N  ++
Sbjct: 212 DPGLREISKETGMNPGQLLIRWSLQHGYLPLPKTKTVARLASNLDVY 258

>TDEL0C03320 Chr3 (591171..592022) [852 bp, 283 aa] {ON} Anc_7.468
           YJR096W
          Length = 283

 Score =  164 bits (416), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 105/292 (35%), Positives = 159/292 (54%), Gaps = 39/292 (13%)

Query: 10  KTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNEDQVGQAIKD- 68
           K  +L+ G +IP + LGT+    +     V  ALK GY+H DTA +Y NE +VG+ I   
Sbjct: 5   KFYTLSNGVKIPSLALGTYDLPKSTTANIVYEALKCGYRHFDTAVLYNNERKVGEGIYQW 64

Query: 69  -----SGVPREEIFVTTKLWSTQH-HEPAK-ALDESLQRL-GLDYVDLYLIHWPARLDTN 120
                    RE++F TTKLW++Q+ ++PAK A+ E LQ++  L Y+DL LIH P      
Sbjct: 65  LQEDPKNNKREDVFYTTKLWNSQNGYQPAKQAIKECLQKVEKLGYIDLLLIHSPL----- 119

Query: 121 YIKDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDLL 180
                          GSR         ++T++ MQE    G  K+IGVSN+  ++L++LL
Sbjct: 120 --------------SGSR-------KRLETYKAMQEAVDEGIVKSIGVSNYGQHHLEELL 158

Query: 181 ASPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKIAK 240
           +  G K  P  NQ+EI P   + EL  +C+S+ I++E Y+PL  T    LK+P ++K+A+
Sbjct: 159 SWEGLKYKPVVNQIEISPWCMRQELAQWCQSQGIVVEDYAPL--THGYKLKDPQLVKVAE 216

Query: 241 KNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKI--FTLSNEDFEAINN 290
           +     G V+I W  Q GY+ LPK+ N DR+  N  +  F L+    +A  +
Sbjct: 217 EVGKNTGQVLIRWSLQHGYLPLPKTSNVDRLPGNLDVYDFKLTESQIKAFEH 268

>Kpol_1013.82 s1013 complement(200564..201421) [858 bp, 285 aa] {ON}
           complement(200564..201421) [858 nt, 286 aa]
          Length = 285

 Score =  164 bits (414), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 100/281 (35%), Positives = 147/281 (52%), Gaps = 37/281 (13%)

Query: 10  KTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNEDQVGQAIKD- 68
           K   L+ G  IP VGLGT+   +N     V  ALKAGY+H DTA +Y NE++VGQ I   
Sbjct: 7   KFYKLSNGYSIPSVGLGTYDIPNNVTANVVYEALKAGYRHFDTAVLYGNEEEVGQGIHRW 66

Query: 69  -----SGVPREEIFVTTKLWSTQ--HHEPAKALDESLQRL-GLDYVDLYLIHWPARLDTN 120
                    RE +F TTKLW++Q  + +  KA+   L ++  L+Y+DL LIH P      
Sbjct: 67  LLEDPENNRREAVFYTTKLWNSQNGYEKATKAIKNCLDKVKALEYIDLLLIHSPL----- 121

Query: 121 YIKDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDLL 180
                          G++         ++TW+ MQE    G  K+IGVSN+ ++++ +LL
Sbjct: 122 --------------GGTKLR-------LETWKAMQEAVDHGMVKSIGVSNYGMHHIDELL 160

Query: 181 ASPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKIAK 240
                K  P  NQ+EI P L + EL ++CKS  I +E YSPL  T    L +  + K+A 
Sbjct: 161 TWQYLKYKPVVNQIEISPWLMRQELADYCKSNSIFVECYSPL--THGYKLNDQDLKKVAN 218

Query: 241 KNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFTLS 281
           +     G V+I W  Q GY+ LPK+   +R++TN  ++  +
Sbjct: 219 ETGKNVGQVLIRWSLQHGYIPLPKTRTINRLKTNLDVYDFN 259

>TBLA0A00630 Chr1 complement(126399..127385) [987 bp, 328 aa] {ON} 
          Length = 328

 Score =  165 bits (417), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 105/310 (33%), Positives = 164/310 (52%), Gaps = 27/310 (8%)

Query: 9   TKTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNEDQVGQ---- 64
           T  ++LN G ++P VGLG W+  ++     V  A+K GY+  D AA Y NE +VGQ    
Sbjct: 2   TAMITLNNGLKMPLVGLGCWKIPNDVCASQVYEAIKLGYRLFDGAADYGNEKEVGQGINK 61

Query: 65  AIKDSGVPREEIFVTTKLWSTQHH--EPAKALDESLQRLGLDYVDLYLIHWPARLDTNYI 122
           A+ +  V R ++F+ +KLW+T HH      AL  +L  LGLDY+DLY IH+P        
Sbjct: 62  ALSEGIVKRSDLFIISKLWNTFHHPDHVKLALQRTLSDLGLDYLDLYYIHFPLAFKYVPF 121

Query: 123 KDGDILSVPTKADGSRA--VDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDLL 180
           ++       T A+ ++   + + N  ++ T+  M++L   G TK+IGVSN   + L+D+L
Sbjct: 122 EEKYPPCFYTGAEDAKIGKISLQNVPYLDTYRAMEKLVDEGLTKSIGVSNLQGSILQDVL 181

Query: 181 ASPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLG-----------STDAP- 228
              G ++ PAA Q+E HP L Q  L+ FCK++ I + +YS  G           + D P 
Sbjct: 182 M--GCRIRPAALQIEHHPYLTQEHLVQFCKNENIAVVSYSSFGPQSFLELGSKRAEDTPA 239

Query: 229 LLKEPTILKIAKKN--NVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKI---FTLSNE 283
           L   P I KIA  +  +V    V++ W  QR   ++PKS   +R+  N  +    TL+  
Sbjct: 240 LFDHPVIKKIAAAHGKDVTTSEVLLRWATQRDIAIIPKSSRKERLLLNLNVNEKLTLTEA 299

Query: 284 DFEAINNISK 293
           +   I+ ++K
Sbjct: 300 ELLEISALNK 309

>SAKL0G01914g Chr7 (162612..163601) [990 bp, 329 aa] {ON} highly
           similar to uniprot|P38715 Saccharomyces cerevisiae
           YHR104W GRE3 Aldose reductase involved in methylglyoxal
           d-xylose and arabinose metabolism stress induced
           (osmotic ionic oxidative heat shock starvation and heavy
           metals) regulated by the HOG pathway
          Length = 329

 Score =  164 bits (416), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 102/309 (33%), Positives = 165/309 (53%), Gaps = 25/309 (8%)

Query: 9   TKTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNEDQVGQAIK- 67
           +KT++LN G ++P +GLG W+  ++     V  A+K GY+  D A  Y NE +VGQ IK 
Sbjct: 5   SKTVTLNNGLEMPLIGLGCWKIPNDVCASQVYEAIKLGYRLFDGAQDYGNEKEVGQGIKK 64

Query: 68  ---DSGVPREEIFVTTKLWSTQHH--EPAKALDESLQRLGLDYVDLYLIHWPARLDTNYI 122
              +  V RE++FV +KLW++ HH      AL ++L  +GLDY+DL+ IH+P        
Sbjct: 65  AIAEGIVKREDLFVVSKLWNSFHHPDNVKLALKKTLDDIGLDYLDLFYIHFPLAFKFVPF 124

Query: 123 KDGDILSVPTKADGSR--AVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDLL 180
           ++       T A+  +   +   +   I T+  +++    G  K+IG+SNF+ + ++DLL
Sbjct: 125 EEKYPPGFYTGAEDEKNGVISQEDVPLIDTYRALEKCVDEGLIKSIGISNFNGSLVQDLL 184

Query: 181 ASPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLG------------STDAP 228
              G ++ P A Q+E HP L Q  L+ +CK+  I + AYS  G             T   
Sbjct: 185 R--GARIKPVALQIEHHPYLTQENLVKYCKNVGIQVVAYSSFGPQSFIELDSELAKTTPT 242

Query: 229 LLKEPTILKIAKKNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKI---FTLSNEDF 285
           L +  T+  IA  + V    V++ W  QRG  V+PKS   +R+  N  I    TLS+++ 
Sbjct: 243 LFRNDTVKLIANNHKVSTSQVLLRWATQRGVAVIPKSSKKERLLENLTINDSLTLSDKEL 302

Query: 286 EAINNISKE 294
           +AI+ ++K+
Sbjct: 303 KAISALNKD 311

>TPHA0E01860 Chr5 complement(373074..374054) [981 bp, 326 aa] {ON}
           Anc_5.409 YHR104W
          Length = 326

 Score =  164 bits (415), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 108/310 (34%), Positives = 166/310 (53%), Gaps = 31/310 (10%)

Query: 9   TKTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNEDQVG----Q 64
           +K ++LN G ++P VGLG W+  ++     V  A+K GY+  D A  Y NE +VG    Q
Sbjct: 2   SKLITLNNGLKMPIVGLGCWKIPNDTCAAQVYEAIKLGYRAFDGAQDYGNEKEVGEGINQ 61

Query: 65  AIKDSGVPREEIFVTTKLWSTQHHEPAK---ALDESLQRLGLDYVDLYLIHWPARLDTNY 121
           AI +  V REE+FV +KLW++ +H+P     AL  +L  + LDY+DLY IH+P       
Sbjct: 62  AISEGIVKREELFVISKLWNS-YHDPKHVKMALQRTLSDMKLDYLDLYYIHFPIAFKFVP 120

Query: 122 IKDGDILSVPT-KADGSRAV---DVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLK 177
            ++       T K D  + +   +V     I T+  M++L   G  K+IG+SNF+   ++
Sbjct: 121 FEEKYPAGFYTGKEDAEKGIISEEVV--PLIDTYRAMEQLATDGLIKSIGISNFNGALIQ 178

Query: 178 DLLASPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLG-----------STD 226
           DLL S   K+ P   Q+E HP L Q  LI +CK   I + AYS  G           + D
Sbjct: 179 DLLRS--CKIKPTCLQIEHHPYLTQPHLIEYCKLNDIQVVAYSSFGPQSFLELNVQKALD 236

Query: 227 APLLKEPTILK-IAKKNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKI---FTLSN 282
           A +L E  ++K IA  ++V+P  V++ W  QRG  ++PKS   +R+  N  I    TLS 
Sbjct: 237 AKVLFEHEVIKSIATNHSVEPSQVLLRWATQRGIAIIPKSSKKERLLENLLIDEKLTLSE 296

Query: 283 EDFEAINNIS 292
           ++   I++++
Sbjct: 297 QELSTISDLN 306

>Kwal_47.18219 s47 (737925..738806) [882 bp, 293 aa] {ON} YJR096W -
           Hypothetical ORF [contig 197] FULL
          Length = 293

 Score =  161 bits (408), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 99/286 (34%), Positives = 156/286 (54%), Gaps = 42/286 (14%)

Query: 10  KTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNEDQVGQAIKD- 68
           K   L++G  +P +GLGT+     +  + V  ALK+GY+H+DTA +Y NE +VGQ I+  
Sbjct: 15  KAYKLSSGYILPSIGLGTYDIPRAETSEVVYQALKSGYRHLDTAVLYGNEHEVGQGIQKW 74

Query: 69  -----SGVPREEIFVTTKLWSTQ--HHEPAKALDESLQRLG-LDYVDLYLIHWPARLDTN 120
                    R+++F TTKLW++Q  +    +A+ E ++++  L Y+DL LIH P      
Sbjct: 75  LEEDPEHNKRQDVFYTTKLWNSQNGYSNAKRAIKECMEKVSPLGYIDLLLIHSPL----- 129

Query: 121 YIKDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDLL 180
                          G+R         ++T++ MQE    G  ++IGVSN+  +++ +LL
Sbjct: 130 --------------SGTR-------RRLETYKAMQEAVDEGIVRSIGVSNYGKHHIDELL 168

Query: 181 ASPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKIAK 240
                K  P  NQ+EI P + + +L ++CKSK +++EA+SPL  T    LK P +L +AK
Sbjct: 169 TWKELKHKPVVNQIEISPWIMRQDLADYCKSKGLVVEAFSPL--THGYKLKHPDVLLVAK 226

Query: 241 KNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFTLSNEDFE 286
           +     G V+I W  Q GYV LPKS + +R++ N K +     DFE
Sbjct: 227 ETGTDAGRVLIRWSLQHGYVPLPKSRSVERLKGNVKAY-----DFE 267

>YJR096W Chr10 (611195..612043) [849 bp, 282 aa] {ON} Putative
           xylose and arabinose reductase; member of the aldo-keto
           reductase (AKR) family; GFP-fusion protein is induced in
           response to the DNA-damaging agent MMS
          Length = 282

 Score =  161 bits (407), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 102/292 (34%), Positives = 153/292 (52%), Gaps = 39/292 (13%)

Query: 10  KTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNEDQVGQAI--- 66
           K   L+ G +IP + LGT+    +   + V   +K GY+H DTA +Y NE +VG  I   
Sbjct: 4   KFYKLSNGFKIPSIALGTYDIPRSQTAEIVYEGVKCGYRHFDTAVLYGNEKEVGDGIIKW 63

Query: 67  --KDSG-VPREEIFVTTKLWSTQ--HHEPAKALDESLQRL-GLDYVDLYLIHWPARLDTN 120
             +D G   REEIF TTKLW++Q  +     A+ + L  + GL Y+DL LIH P      
Sbjct: 64  LNEDPGNHKREEIFYTTKLWNSQNGYKRAKAAIRQCLNEVSGLQYIDLLLIHSPL----- 118

Query: 121 YIKDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDLL 180
                         +GS+         ++TW  MQE    G  K+IGVSN+   ++ +LL
Sbjct: 119 --------------EGSKLR-------LETWRAMQEAVDEGLVKSIGVSNYGKKHIDELL 157

Query: 181 ASPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKIAK 240
             P  K  P  NQ+EI P + + EL ++CKSK +++EA++PL       +  P +LK+ K
Sbjct: 158 NWPELKHKPVVNQIEISPWIMRQELADYCKSKGLVVEAFAPL--CHGYKMTNPDLLKVCK 215

Query: 241 KNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKI--FTLSNEDFEAINN 290
           + +  PG V+I W  Q GY+ LPK+    R+E N     F LS+E  + +++
Sbjct: 216 EVDRNPGQVLIRWSLQHGYLPLPKTKTVKRLEGNLAAYNFELSDEQMKFLDH 267

>KLLA0E21627g Chr5 complement(1929294..1930283) [990 bp, 329 aa]
           {ON} highly similar to uniprot|P38715 Saccharomyces
           cerevisiae YHR104W GRE3 Aldose reductase involved in
           methylglyoxal d-xylose and arabinose metabolism stress
           induced (osmotic ionic oxidative heat shock starvation
           and heavy metals) regulated by the HOG pathway
          Length = 329

 Score =  162 bits (409), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 104/311 (33%), Positives = 166/311 (53%), Gaps = 31/311 (9%)

Query: 9   TKTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNEDQVGQ---- 64
            +T++LN G ++P VGLG W+  ++     +  A+K GY+  D A  Y NE +VGQ    
Sbjct: 5   AETVTLNNGEKMPLVGLGCWKMPNDVCADQIYEAIKIGYRLFDGAQDYANEKEVGQGVNR 64

Query: 65  AIKDSGVPREEIFVTTKLWSTQHH--EPAKALDESLQRLGLDYVDLYLIHW-----PARL 117
           AIK+  V RE++ V +KLW++ HH     +AL+ +L  L LDYVD++ IH+     P   
Sbjct: 65  AIKEGLVKREDLVVVSKLWNSFHHPDNVPRALERTLSDLQLDYVDIFYIHFPLAFKPVPF 124

Query: 118 DTNYIKDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLK 177
           D  Y   G       +A G   ++      + TW  +++L   GK K++G+SNFS   ++
Sbjct: 125 DEKY-PPGFYTGKEDEAKGH--IEEEQVPLLDTWRALEKLVDQGKIKSLGISNFSGALIQ 181

Query: 178 DLLASPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLG-----------STD 226
           DLL   G ++ P A Q+E HP L Q  LI + K+  I + AYS  G           + +
Sbjct: 182 DLLR--GARIKPVALQIEHHPYLTQERLIKYVKNAGIQVVAYSSFGPVSFLELENKKALN 239

Query: 227 AP-LLKEPTILKIAKKNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKI---FTLSN 282
            P L +  TI  IA K+ V P  V++ W  Q G  ++PKS   +R+  N +I    TL++
Sbjct: 240 TPTLFEHDTIKSIASKHKVTPQQVLLRWATQNGIAIIPKSSKKERLLDNLRINDALTLTD 299

Query: 283 EDFEAINNISK 293
           ++ + I+ +++
Sbjct: 300 DELKQISGLNQ 310

>ZYRO0A06336g Chr1 complement(505818..506801) [984 bp, 327 aa] {ON}
           highly similar to uniprot|P38715 Saccharomyces
           cerevisiae YHR104W GRE3 Aldose reductase involved in
           methylglyoxal d-xylose and arabinose metabolism stress
           induced (osmotic ionic oxidative heat shock starvation
           and heavy metals) regulated by the HOG pathway
          Length = 327

 Score =  160 bits (406), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 101/306 (33%), Positives = 162/306 (52%), Gaps = 25/306 (8%)

Query: 11  TLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNEDQVGQ----AI 66
            ++LN G ++P VGLG W+  +    + +  A+  GY+  D A  Y NE +VG+    AI
Sbjct: 4   VVALNNGNKMPLVGLGCWKIPNETCSQQIYDAISVGYRVFDGAQDYGNEKEVGEGVRRAI 63

Query: 67  KDSGVPREEIFVTTKLWSTQHHEP--AKALDESLQRLGLDYVDLYLIHWPARLDTNYIKD 124
           KD  V REE+FV +KLW++ HH      AL  +L  +GLDY+DL+ IH+P  L     ++
Sbjct: 64  KDGLVKREELFVVSKLWNSFHHPKNVKLALKRTLSDMGLDYLDLFYIHFPIALKPVSFEE 123

Query: 125 GDILSVPTKADGSRAVDVTN--WNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDLLAS 182
                + T    ++A  ++      + T+  ++E  + G  K+IGVSNFS + + DLL  
Sbjct: 124 KYPPGLYTGEADAKAGVLSEEPVPILDTYRALEECVEEGLIKSIGVSNFSGSIMLDLLR- 182

Query: 183 PGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLG------------STDAPLL 230
            G ++ PAA Q+E+HP L Q   + + +SK I + AYS  G                PL 
Sbjct: 183 -GARIPPAALQIELHPYLTQERYVKWVQSKGIQVVAYSSFGPQSFVDIGSEVAKATPPLF 241

Query: 231 KEPTILKIAKKNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKI---FTLSNEDFEA 287
           +   + KIA K+NV    V++ W  Q+   V+PKS   +R+  N  +    TL+ ++ + 
Sbjct: 242 EHDVVKKIAAKHNVSTSQVLLRWATQQKVAVIPKSSKKERLRQNLLVDQEVTLTGDEIKE 301

Query: 288 INNISK 293
           I+ ++K
Sbjct: 302 ISGLNK 307

>TDEL0E02150 Chr5 complement(403001..403990) [990 bp, 329 aa] {ON}
           Anc_5.409 YHR104W
          Length = 329

 Score =  160 bits (406), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 103/311 (33%), Positives = 166/311 (53%), Gaps = 29/311 (9%)

Query: 9   TKTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNEDQVGQAIK- 67
           ++ ++LN G ++P VGLG W+  +      V  A+K GY+  D A  Y NE +VGQ I+ 
Sbjct: 2   SRVVTLNNGMKMPLVGLGCWKIPNEVCASQVYEAIKIGYRLFDGAQDYGNEKEVGQGIRK 61

Query: 68  --DSG-VPREEIFVTTKLWSTQHHEPAK---ALDESLQRLGLDYVDLYLIHWPARLDTNY 121
             D G V REE+FV +KLW++  H+P     AL  +L  + LDY+DL+ IH+P  L    
Sbjct: 62  AIDEGIVKREELFVVSKLWNS-FHDPKNVKAALQRTLDDMKLDYLDLFYIHFPIALKFVP 120

Query: 122 IKDGDILSVPTKADGSRAVDVTNWN--FIKTWELMQELPKTGKTKAIGVSNFSINNLKDL 179
            K+     + T +   +   ++  N   I T+  +++L   G  K+IG+SNFS + + DL
Sbjct: 121 FKEKYPPGLYTGSQDEKQGTMSEENVPIIDTYRALEQLVDEGLIKSIGISNFSGSIIMDL 180

Query: 180 LASPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLG------------STDA 227
           L   G ++ P A Q+E HP L Q  L+++ K + + + AYS  G             T  
Sbjct: 181 LR--GCRIKPVALQIEHHPYLTQERLVHYVKLQGLQVVAYSSFGPQSFIEMGSDLAKTTP 238

Query: 228 PLLKEPTILKIAKKNN--VQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKI---FTLSN 282
           PL + P I++IAK +   + P  V++ W  Q    V+PKS   +R+  N  I    TL++
Sbjct: 239 PLFENPKIIEIAKNHGKEISPSQVLLRWATQNNVAVIPKSSKKERLHDNLHIDDKLTLTD 298

Query: 283 EDFEAINNISK 293
           ++ + I+ ++K
Sbjct: 299 QELKEISALNK 309

>YHR104W Chr8 (323409..324392) [984 bp, 327 aa] {ON}  GRE3Aldose
           reductase involved in methylglyoxal, d-xylose,
           arabinose, and galactose metabolism; stress induced
           (osmotic, ionic, oxidative, heat shock, starvation and
           heavy metals); regulated by the HOG pathway
          Length = 327

 Score =  160 bits (405), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 104/307 (33%), Positives = 159/307 (51%), Gaps = 30/307 (9%)

Query: 12  LSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNEDQVGQ----AIK 67
           ++LN G ++P VGLG W+         +  A+K GY+  D A  Y NE +VG+    AI 
Sbjct: 5   VTLNNGLKMPLVGLGCWKIDKKVCANQIYEAIKLGYRLFDGACDYGNEKEVGEGIRKAIS 64

Query: 68  DSGVPREEIFVTTKLWSTQHH--EPAKALDESLQRLGLDYVDLYLIHWPARLDTNYIKDG 125
           +  V R++IFV +KLW+  HH      AL ++L  +GLDY+DLY IH+P        ++ 
Sbjct: 65  EGLVSRKDIFVVSKLWNNFHHPDHVKLALKKTLSDMGLDYLDLYYIHFPIAFKYVPFEEK 124

Query: 126 DILSVPTKADGSRAVDVTNWN--FIKTWELMQELPKTGKTKAIGVSNFSINNLKDLLASP 183
                 T AD  +   +T  +   I T+  ++E    G  K+IGVSNF  + ++DLL   
Sbjct: 125 YPPGFYTGADDEKKGHITEAHVPIIDTYRALEECVDEGLIKSIGVSNFQGSLIQDLLR-- 182

Query: 184 GNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLG-----------STDAPLLKE 232
           G ++ P A Q+E HP L Q  L+ FCK   I + AYS  G           +   P L E
Sbjct: 183 GCRIKPVALQIEHHPYLTQEHLVEFCKLHDIQVVAYSSFGPQSFIEMDLQLAKTTPTLFE 242

Query: 233 PTILKIAKKNNVQPG----HVVISWHAQRGYVVLPKSVNPDRIETNRKI---FTLSNEDF 285
             ++K   +N+  PG     V++ W  QRG  V+PKS   +R+  N +I   FTL+ ++ 
Sbjct: 243 NDVIKKVSQNH--PGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIEKKFTLTEQEL 300

Query: 286 EAINNIS 292
           + I+ ++
Sbjct: 301 KDISALN 307

>Skud_10.318 Chr10 (568560..569408) [849 bp, 282 aa] {ON} YJR096W
           (REAL)
          Length = 282

 Score =  159 bits (401), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 98/289 (33%), Positives = 149/289 (51%), Gaps = 42/289 (14%)

Query: 10  KTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNEDQVGQAI--- 66
           K  +L+ G +IP + LGT+    +   + V   +K GY+H DTA +Y NE +VG  I   
Sbjct: 4   KFYNLSNGYRIPSIALGTYDIPRSQTAEIVYEGIKCGYRHFDTAVLYGNEKEVGDGIIKW 63

Query: 67  ---KDSGVPREEIFVTTKLWSTQ--HHEPAKALDESLQRL-GLDYVDLYLIHWPARLDTN 120
                    RE+IF TTKLW++Q  +     A+ + L  + GL Y+DL LIH P      
Sbjct: 64  LNENPESNKREKIFYTTKLWNSQNGYKRAKAAIQQCLNEVSGLKYIDLLLIHSPL----- 118

Query: 121 YIKDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDLL 180
                         +GS+         ++TW+ MQE    G  K+IGVSN+   ++ +LL
Sbjct: 119 --------------EGSKLR-------LETWQAMQEAVDEGVVKSIGVSNYGKKHIDELL 157

Query: 181 ASPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKIAK 240
             P     P  NQ+EI P + + EL ++CKSK +++EA++PL       +  P +LK+ K
Sbjct: 158 TWPDLTYKPVVNQIEISPWVMRQELADYCKSKGLIVEAFAPL--CHGYKMTNPDLLKVCK 215

Query: 241 KNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFTLSNEDFEAIN 289
           + +  PG V+I W  Q GY+ LPK+    R+E N     L+  DFE ++
Sbjct: 216 EVDRNPGQVLIRWSLQHGYLPLPKTKTVKRLEGN-----LAAYDFELLD 259

>Kwal_33.13276 s33 (153537..154445) [909 bp, 302 aa] {ON} YDL124W -
           Hypothetical ORF [contig 119] FULL
          Length = 302

 Score =  159 bits (401), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 97/280 (34%), Positives = 148/280 (52%), Gaps = 33/280 (11%)

Query: 14  LNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNEDQVGQAIK----DS 69
           LN G QIP +G G ++    D    V +ALK GY+HIDTA +Y+N+ +  Q ++    ++
Sbjct: 15  LNNGQQIPVIGFGVYEIPKEDTADLVYSALKDGYRHIDTAVLYKNQKEAAQGVRKYLDET 74

Query: 70  GVPREEIFVTTKLWSTQ--HHEPAKALDESLQRLG--LDYVDLYLIHWPARLDTNYIKDG 125
           G  RE I+ TTKLW +Q    E  KAL E    +   + YVDL L+H P       ++  
Sbjct: 75  GEARENIWFTTKLWDSQFGREETEKALQEVAADVKEYIGYVDLLLLHSPRGGAKRRLETW 134

Query: 126 DILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDLLASPGN 185
            IL    +  GS+A+++                     K+IGVSNF +++L++LL     
Sbjct: 135 AILEQAVQEPGSKALEI---------------------KSIGVSNFGVDHLEELLKVA-- 171

Query: 186 KLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKIAKKNNVQ 245
           K+ P  +Q+E+HP LP+ EL  + K K I  EAYSPL  T    L++P +L +  K  + 
Sbjct: 172 KVKPVLDQLELHPWLPRVELRKYLKEKDIFAEAYSPL--TQGYRLQDPELLALEAKTGIN 229

Query: 246 PGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFTLSNEDF 285
              +++ W   +G+VVL KS NP+RI  N  +    N+ +
Sbjct: 230 KAVILLRWSFLQGFVVLVKSSNPERIRQNLAVLPSENDSW 269

>KAFR0G00920 Chr7 complement(215664..216524) [861 bp, 286 aa] {ON}
           Anc_7.468 YJR096W
          Length = 286

 Score =  158 bits (400), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 101/287 (35%), Positives = 149/287 (51%), Gaps = 43/287 (14%)

Query: 10  KTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNEDQVGQAI--- 66
           KT  L++   IP V LGT+    ++  + V  AL  GY+H DTA +Y NE++V Q I   
Sbjct: 7   KTYKLSSNYYIPTVALGTYDLPSSETTEIVENALDVGYRHFDTAVLYDNEEEVAQGISNW 66

Query: 67  --KDSGVPREEIFVTTKLWSTQ--HHEPAKALDESLQRL-GLDYVDLYLIHWPARLDTNY 121
             +     R+EIF TTKLW++Q  +    +A+ E + ++  L Y+DL L+H P       
Sbjct: 67  LIRHPETKRDEIFYTTKLWNSQFGYQNAKRAIRECVDKVQDLKYIDLLLMHSP------- 119

Query: 122 IKDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDLLA 181
                 +  P   +             +TW  MQE    G  K+IGVSNF I +LK+L  
Sbjct: 120 ------IGGPQIRE-------------ETWRAMQEAVDEGIVKSIGVSNFGIKHLKELFQ 160

Query: 182 SPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKIAKK 241
             G K  P  NQ+EI P L + EL +FCK + +++EAY+PL  T    +  P ++KI+ +
Sbjct: 161 WDGLKYRPVVNQIEISPWLMRQELADFCKMEGLVVEAYAPL--THGYKINHPDLIKISNE 218

Query: 242 --NNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFTLSNEDFE 286
             N    G ++I W  Q GYV LPK+    R+E+N  ++     DFE
Sbjct: 219 LNNTKNTGQILIRWSLQHGYVPLPKTKTIGRLESNLDVY-----DFE 260

>NDAI0D01600 Chr4 (382637..383620) [984 bp, 327 aa] {ON} 
          Length = 327

 Score =  159 bits (403), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 108/309 (34%), Positives = 157/309 (50%), Gaps = 32/309 (10%)

Query: 12  LSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNEDQVGQAIK---D 68
           ++LN G ++P VGLG W+   +   + +  A+K GY+  D A  Y NE +VGQ IK   D
Sbjct: 5   VTLNNGLKMPLVGLGCWKIPTSTCAQQIYDAIKVGYRLFDGATDYGNEKEVGQGIKRAID 64

Query: 69  SG-VPREEIFVTTKLWSTQHHEPAKALD--ESLQRLGLDYVDLYLIHWPARL-----DTN 120
            G V RE++F+ +KLW+  HH     L+   +L+ LGLDYVDLY IH+P        D  
Sbjct: 65  EGLVKREDLFIVSKLWNNFHHPDHVKLNLQRNLKDLGLDYVDLYYIHFPIAFKFVSPDER 124

Query: 121 YIKDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDLL 180
           Y   G       +A G   +   N   I T+  M++L   G  K+IG+SN++   + D L
Sbjct: 125 Y-PPGMYTGKEDEAKG--ILTEENVPLIDTYRAMEKLVDEGLIKSIGISNYNGGLVADTL 181

Query: 181 ASPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLG------------STDAP 228
              G ++ P A Q+E HP L Q +L+ +CK   + + AYS  G                P
Sbjct: 182 R--GCRIKPVALQIEHHPYLTQEKLLEYCKIHDVQVVAYSSFGPQSFVDCGQEMAKNTPP 239

Query: 229 LLKEPTILKIAKK-NNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKI---FTLSNED 284
           L   PTI KIA K   V    V++ W  QRG  ++PKS   +R+  N  I    TL+ ED
Sbjct: 240 LFDHPTIKKIADKYEAVTTSQVLLRWATQRGVAIIPKSSKKERLLENLTIDQKVTLAEED 299

Query: 285 FEAINNISK 293
              I+ +++
Sbjct: 300 LREISALNQ 308

>Kwal_55.21536 s55 complement(877191..878180) [990 bp, 329 aa] {ON}
           YHR104W (GRE3) - a keto-aldose reductase [contig 128]
           FULL
          Length = 329

 Score =  159 bits (402), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 103/311 (33%), Positives = 165/311 (53%), Gaps = 27/311 (8%)

Query: 8   STKTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNEDQVGQ--- 64
           +++T+ LN G Q+P VGLG W+  +      V  A+K GY+  D A  Y NE +VGQ   
Sbjct: 4   TSETVKLNNGLQMPLVGLGCWKIPNEVCASQVYEAIKLGYRLFDGAQDYGNEKEVGQGIH 63

Query: 65  -AIKDSGVPREEIFVTTKLWSTQHHEP---AKALDESLQRLGLDYVDLYLIHWPARLDTN 120
            AI +  V RE++FV +KLW++ +H+P    KAL  +L+ + L+Y+DL+ IH+P      
Sbjct: 64  KAIDEGIVKREDLFVVSKLWNS-YHDPKNVKKALKRTLEDMELEYLDLFYIHFPLAFKYV 122

Query: 121 YIKDGDILSVPTKADGSR--AVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKD 178
             ++       T A+ ++   + +     I T+  ++E  K G  K+IG+SNF    + D
Sbjct: 123 PFEEKYPPGFYTGAEDAKKGVISLEQVPIIDTYRALEECVKEGLIKSIGISNFRGILIHD 182

Query: 179 LLASPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLG-----STDAPLLKE- 232
           LLA  G  + P   Q+E HP L Q +LI +C  ++I + AYS  G       D+ L K  
Sbjct: 183 LLA--GATIKPVCLQIEHHPYLTQEKLIEYCAQEQIQVVAYSSFGPQSFLELDSELAKST 240

Query: 233 PTIL------KIAKKNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKI---FTLSNE 283
           PT+       KIA  + V    V++ W  QR   ++PKS   +R+  N +I    TL+  
Sbjct: 241 PTLFEHEGIQKIATNHGVSSSQVLLRWATQRRIAIIPKSSKKERLLDNLQINEKLTLTEA 300

Query: 284 DFEAINNISKE 294
           + + I+ ++K+
Sbjct: 301 ELQEISALNKD 311

>ZYRO0G17600g Chr7 (1455426..1456277) [852 bp, 283 aa] {ON} highly
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 283

 Score =  157 bits (397), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 101/292 (34%), Positives = 159/292 (54%), Gaps = 39/292 (13%)

Query: 10  KTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNEDQVGQAIKD- 68
           K  ++  G +IP + LG +    +     V  ALK GY+H DTA +Y NE +VG+ I   
Sbjct: 5   KYYTMVNGIKIPSLALGCYDIPRSQTANVVYEALKRGYRHFDTAVLYGNEKEVGEGIYKW 64

Query: 69  -----SGVPREEIFVTTKLWSTQH-HEPAK-ALDESLQRLG-LDYVDLYLIHWPARLDTN 120
                +   RE++F TTKLW++Q+ + PAK  + E + ++  L Y+DL LIH P      
Sbjct: 65  LKEDPANNKREDVFYTTKLWNSQNGYSPAKRGISECMNKVKELGYIDLLLIHSP------ 118

Query: 121 YIKDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDLL 180
                  LS P +              ++T++ MQE    G  K+IGVSN+   ++++L 
Sbjct: 119 -------LSGPRRR-------------LETYQAMQEAVDDGIVKSIGVSNYGKQHIEELY 158

Query: 181 ASPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKIAK 240
                K  P ANQ+EI P   + +L ++C+SK +++EA+SPL  T    LKEP ++ +AK
Sbjct: 159 KWDKLKHKPVANQIEISPWCMREDLTSWCQSKGLIVEAFSPL--THGYKLKEPGLVSLAK 216

Query: 241 KNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKI--FTLSNEDFEAINN 290
           K     G V+I W  QRG + LPK+ NP R+ +N ++  F L+ ED + +++
Sbjct: 217 KLGRDTGQVLIRWSLQRGLLPLPKTQNPARLSSNLEVYDFELTPEDVKELDH 268

>NCAS0H00560 Chr8 complement(96020..96874) [855 bp, 284 aa] {ON}
           Anc_7.468
          Length = 284

 Score =  157 bits (396), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 99/292 (33%), Positives = 154/292 (52%), Gaps = 39/292 (13%)

Query: 10  KTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNEDQVGQAIKD- 68
           K  + N G QIP + LGT+    +   K V  ALKAGY+H DTA +Y NE QVG+ I   
Sbjct: 6   KYYTFNNGNQIPSIALGTYDIPQSITAKIVYEALKAGYRHFDTAVLYGNEHQVGEGILQW 65

Query: 69  -----SGVPREEIFVTTKLWSTQ--HHEPAKALDESLQRL-GLDYVDLYLIHWPARLDTN 120
                    R ++F TTKLW++Q  +H+   A+ E L ++ GL Y+D+ LIH P      
Sbjct: 66  IQEDPQQNKRSDVFYTTKLWNSQNGYHQAQTAIKECLAKVHGLQYIDMLLIHSP------ 119

Query: 121 YIKDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDLL 180
                  L   TK              ++TW  MQE  ++G  K IGVSN+   ++++LL
Sbjct: 120 -------LEGRTKR-------------LETWRAMQEAVESGLVKNIGVSNYGRQHVEELL 159

Query: 181 ASPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKIAK 240
                 + P  NQ+EI P + ++EL ++CKS  +++EA++PL  T    L +  +++++K
Sbjct: 160 QWERLTIKPVVNQIEISPWVMRSELADYCKSVGLVVEAFAPL--THGYKLHDADLVRVSK 217

Query: 241 KNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKI--FTLSNEDFEAINN 290
           +       V+I W  Q GY+ LPK+    R+E N +   F L+ E  + I++
Sbjct: 218 EVGRSTVQVLIRWSLQHGYLPLPKTKTVKRLEENLEAYNFQLTTEQMQLIDH 269

>KLTH0G05786g Chr7 complement(460135..460995) [861 bp, 286 aa] {ON}
           highly similar to uniprot|P47137 Saccharomyces
           cerevisiae YJR096W
          Length = 286

 Score =  156 bits (395), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 94/286 (32%), Positives = 157/286 (54%), Gaps = 42/286 (14%)

Query: 10  KTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNEDQVGQAIKD- 68
           +   L++G  +P +GLGT+     +  + V  ALKAGY+H+DTA +Y NE +VG+ ++  
Sbjct: 8   RAYKLSSGYVLPSLGLGTYDIPRAETAEVVYQALKAGYRHLDTAVLYGNEREVGEGVEKW 67

Query: 69  -----SGVPREEIFVTTKLWSTQ--HHEPAKALDESLQRLG-LDYVDLYLIHWPARLDTN 120
                    R ++F TTKLW++Q  +    +A+ E L ++  L Y+D+ LIH P      
Sbjct: 68  LKEDPKNHRRHDVFYTTKLWNSQNGYSNAKRAIQECLDKVRPLGYIDMLLIHSPL----- 122

Query: 121 YIKDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDLL 180
                          G+R         ++T++ MQE    G  ++IGVSN+  +++ +LL
Sbjct: 123 --------------SGTR-------RRLETYKAMQEAVDAGIVRSIGVSNYGKHHIDELL 161

Query: 181 ASPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKIAK 240
           A    K  P  NQ+EI P + + +L ++CKSK +++EA+SPL  T    +K P ++++A+
Sbjct: 162 AWEELKHKPVVNQIEISPWVMRQDLADYCKSKGLVVEAFSPL--THGYKIKHPNVVRVAE 219

Query: 241 KNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFTLSNEDFE 286
           +     G V+I W  Q GYV LPKS + +R++ N +++     DFE
Sbjct: 220 EVGRNTGQVLIRWSLQHGYVPLPKSRSVERLKGNLEVY-----DFE 260

>Suva_15.300 Chr15 (525715..526698) [984 bp, 327 aa] {ON} YHR104W
           (REAL)
          Length = 327

 Score =  156 bits (395), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 100/307 (32%), Positives = 162/307 (52%), Gaps = 30/307 (9%)

Query: 12  LSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNEDQVGQ----AIK 67
           ++LN G ++P VGLG W+  +      +  A+K GY+  D A  Y NE +VG+    AI 
Sbjct: 5   VTLNNGCKMPLVGLGCWKIDNKVCANQIYEAIKLGYRLFDGACDYGNEKEVGEGIRKAIS 64

Query: 68  DSGVPREEIFVTTKLWSTQHH--EPAKALDESLQRLGLDYVDLYLIHWPARLDTNYIKDG 125
           +  V R++IFVT+KLW+  HH      AL ++L  +GLDY+DLY IH+P        ++ 
Sbjct: 65  EGLVTRKDIFVTSKLWNNFHHPDHVKLALKKTLDDMGLDYLDLYYIHFPIAFKYVPFEEK 124

Query: 126 DILSVPTKADGSRAVDVTNWN--FIKTWELMQELPKTGKTKAIGVSNFSINNLKDLLASP 183
                 T A+  +   +T  +   I T+  ++     G  K+IG+SNF  + ++DLL   
Sbjct: 125 YPPGFYTGAEDDKRGHITEAHVPIIDTYRALEACVDEGLIKSIGISNFQGSLVQDLLR-- 182

Query: 184 GNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLG-----------STDAPLLKE 232
           G ++ P A Q+E HP L Q  L+++CK   I + AYS  G           +   P L E
Sbjct: 183 GCRIKPVALQIEHHPYLTQEHLVDYCKLHDIQVVAYSSFGPQSFIEMDLGLAKSTPTLFE 242

Query: 233 PTILKIAKKNNVQPG----HVVISWHAQRGYVVLPKSVNPDRIETNRKI---FTLSNEDF 285
             ++K   +N+  PG     V++ W  QRG  V+PKS   +R+  N +I    TL++++ 
Sbjct: 243 NDVVKKVSENH--PGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIEKKLTLTDQEL 300

Query: 286 EAINNIS 292
           + I++++
Sbjct: 301 KEISSLN 307

>Suva_12.184 Chr12 (289608..290456) [849 bp, 282 aa] {ON} YJR096W
           (REAL)
          Length = 282

 Score =  154 bits (390), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 96/292 (32%), Positives = 155/292 (53%), Gaps = 39/292 (13%)

Query: 10  KTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNEDQVGQAIKD- 68
           K    + G ++P + LGT+    +   + V   +K GY+H DTA +Y NE +VG  I   
Sbjct: 4   KFYKFSNGYKVPSIALGTYDIPRSQTAEIVYEGIKCGYRHFDTAVLYGNEKEVGDGITKW 63

Query: 69  -----SGVPREEIFVTTKLWSTQH-HEPAK-ALDESLQRL-GLDYVDLYLIHWPARLDTN 120
                    RE++F TTKLW++Q+ ++ AK A+ + L  + GL Y+DL LIH P      
Sbjct: 64  LHEDPENNKREDVFYTTKLWNSQNGYKRAKVAIQQCLNEVSGLKYIDLLLIHSPL----- 118

Query: 121 YIKDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDLL 180
                         +GS+         ++TW+ MQE    G  K+IGVSN+   ++ +LL
Sbjct: 119 --------------EGSKLR-------LETWQAMQEAVDEGMVKSIGVSNYGKKHVDELL 157

Query: 181 ASPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKIAK 240
                K  P  NQ+EI P + + EL ++CKSK +++EA++PL       + +P +LK+ K
Sbjct: 158 NWSQLKHKPVVNQIEISPWIMRQELADYCKSKNLVVEAFAPL--CHGYKMTDPDLLKVCK 215

Query: 241 KNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKI--FTLSNEDFEAINN 290
           + +  PG V+I W  Q GY+ LPK+    R+E+N     F LS++  + +++
Sbjct: 216 EVDRNPGQVLIRWSLQHGYLPLPKTKTVKRLESNLAAYNFELSDDQMKILDH 267

>SAKL0F02574g Chr6 complement(220827..221696) [870 bp, 289 aa] {ON}
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 289

 Score =  154 bits (389), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 105/311 (33%), Positives = 168/311 (54%), Gaps = 44/311 (14%)

Query: 11  TLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNEDQVGQAI---- 66
           T +L  G ++P +GLG +Q+   +    V  ALK GY+ +D+A +Y NE +    I    
Sbjct: 8   THALKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFL 67

Query: 67  -KDSGVPREEIFVTTKLWST-QHHEPAK-ALDESLQRLG-LDYVDLYLIHWPARLDTNYI 122
            +   V R +IF TTK+ +  Q +E AK +++ESL R+  LDY+DL+LIH P        
Sbjct: 68  EESPKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAP-------- 119

Query: 123 KDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDLLAS 182
                L+   K  G             TW+  QE  +TGK KAIGVSN+ I +L+++   
Sbjct: 120 -----LTNKEKRLG-------------TWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQW 161

Query: 183 PGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKIAKKN 242
            G K+ P  NQ E++P L + EL N+C  K ++I+AYSPL  T A  L++P ++K+ + +
Sbjct: 162 DGLKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPL--TRARRLQDPELVKLVEDS 219

Query: 243 NVQ--PGHVVISWHAQRGYVVLPKSVNPDRIETNRKI--FTLSNEDFEAINNISKEKGEK 298
             +     ++++W  Q G+V L K+V+ DR++ N K   F LS+ D + + +      + 
Sbjct: 220 YPEQTSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKLTH----DDQY 275

Query: 299 RVVNPNWSPFE 309
            +  P W P +
Sbjct: 276 YLSQPKWDPIK 286

>KLTH0F01892g Chr6 (149177..150085) [909 bp, 302 aa] {ON} similar to
           uniprot|P47137 Saccharomyces cerevisiae YJR096W
          Length = 302

 Score =  154 bits (388), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 91/273 (33%), Positives = 143/273 (52%), Gaps = 33/273 (12%)

Query: 14  LNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNEDQVGQAI----KDS 69
           LN G ++P +G G +     +  + V  AL+ GY+HIDTA +Y N+ Q  Q +    +++
Sbjct: 15  LNNGTEVPVIGFGVYDIPVEETAQRVYTALQEGYRHIDTAVVYENQKQAAQGVHRFLEET 74

Query: 70  GVPREEIFVTTKLWSTQHHEPA--KALDESLQRLG--LDYVDLYLIHWPARLDTNYIKDG 125
           G PREE++ TTKLW+TQ    A  +AL+E    +   + YVDL L+H P       ++  
Sbjct: 75  GTPREEVWFTTKLWNTQQGRDATPRALEEIAADVKEFIGYVDLLLLHSPLTDAQRRLETW 134

Query: 126 DILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDLLASPGN 185
            +L    +   S A+++                     +AIGVSNF + +L++LL     
Sbjct: 135 AVLERAVQEPASSALEI---------------------RAIGVSNFGVRHLQELLEVATV 173

Query: 186 KLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKIAKKNNVQ 245
           K  P  +Q+E+HP LP+ EL  F +   I+ EAYSPL  T    L++P +L +  K+ + 
Sbjct: 174 K--PVVDQLELHPWLPRAELRAFLRENGILAEAYSPL--TQGVRLQDPELLALEAKSGLS 229

Query: 246 PGHVVISWHAQRGYVVLPKSVNPDRIETNRKIF 278
            G +++ W   +G+ VL KS NP RI  N  + 
Sbjct: 230 KGEILLRWSFLQGFAVLVKSNNPQRIRDNLAVL 262

>Smik_8.182 Chr8 (299804..300787) [984 bp, 327 aa] {ON} YHR104W
           (REAL)
          Length = 327

 Score =  154 bits (389), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 101/305 (33%), Positives = 158/305 (51%), Gaps = 26/305 (8%)

Query: 12  LSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNEDQVGQ----AIK 67
           ++LN G ++P VGLG W+         +  A+K GY+  D A  Y NE +VG+    AI 
Sbjct: 5   VTLNNGLKMPLVGLGCWKIDKKVCANQIYEAIKLGYRLFDGACDYGNEKEVGEGIRRAIS 64

Query: 68  DSGVPREEIFVTTKLWSTQHH--EPAKALDESLQRLGLDYVDLYLIHWPARLDTNYIKDG 125
           +  V R+++FV +KLW+  HH      AL ++L  +GLDY+DLY IH+P        ++ 
Sbjct: 65  EGLVARKDVFVVSKLWNNFHHPDHVKLALKKTLNDMGLDYLDLYYIHFPIAFKYVPFEEK 124

Query: 126 DILSVPTKADGSRAVDVTNWN--FIKTWELMQELPKTGKTKAIGVSNFSINNLKDLLASP 183
                 T  D  +   +T  +   + T+  ++E    G  K+IG+SNF  + ++DLL   
Sbjct: 125 YPPGFYTGVDDEKKGHITEAHVPILDTYRALEECVDEGLIKSIGISNFQGSLVQDLLR-- 182

Query: 184 GNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLG-----STDAPLLK-EPTILK 237
           G ++ P A Q+E HP L Q  L+ FC+   I + AYS  G       D  L K  PT+ +
Sbjct: 183 GCRIKPVALQIEHHPYLTQEHLVEFCRLHNIQVVAYSSFGPQSFIEMDLQLAKTTPTLFE 242

Query: 238 ---IAKKNNVQPG----HVVISWHAQRGYVVLPKSVNPDRIETNRKI---FTLSNEDFEA 287
              I K +   PG     V++ W  QRG  V+PKS   +R+  N +I   FTL+ ++ + 
Sbjct: 243 NDVIKKISLNHPGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIEKKFTLTEQELKE 302

Query: 288 INNIS 292
           I+ ++
Sbjct: 303 ISALN 307

>Smik_10.384 Chr10 (600097..600945) [849 bp, 282 aa] {ON} YJR096W
           (REAL)
          Length = 282

 Score =  153 bits (386), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 95/292 (32%), Positives = 150/292 (51%), Gaps = 39/292 (13%)

Query: 10  KTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNEDQVGQAIKD- 68
           K   L+ G +IP + LGT++   +   + V   +K GY+H DTA +Y NE +VG  I   
Sbjct: 4   KFYKLSNGIKIPSIALGTYEIPRSQTAEIVYEGIKCGYRHFDTAVLYGNEKEVGDGITRW 63

Query: 69  -----SGVPREEIFVTTKLWSTQ--HHEPAKALDESLQRL-GLDYVDLYLIHWPARLDTN 120
                    R +IF TTKLW++Q  + +   A+ + L  + GL+Y+DL LIH P      
Sbjct: 64  LNEDPKNNKRTDIFYTTKLWNSQNGYRKAKAAIQQCLNEVSGLEYIDLLLIHSPL----- 118

Query: 121 YIKDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDLL 180
                         +GS+         ++TW  MQE    G  K+IGVSN+   ++ +LL
Sbjct: 119 --------------EGSKLR-------LETWRAMQEAVDAGVVKSIGVSNYGRKHIDELL 157

Query: 181 ASPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKIAK 240
                +  P  NQ+EI P + + EL ++CKSK +++EA++PL       +  P +L + K
Sbjct: 158 NWSELRHYPVVNQIEISPWIMRQELADYCKSKGLIVEAFAPL--CHGYKMTNPDLLIVCK 215

Query: 241 KNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKI--FTLSNEDFEAINN 290
           + +  PG V+I W  Q GY+ LPK+    R+E N     F LS+E  + +++
Sbjct: 216 EVDRNPGQVLIRWSLQHGYLPLPKTRTVKRLEGNLAAYSFELSDEQMKTLDH 267

>Kwal_47.18893 s47 (1017098..1017967) [870 bp, 289 aa] {ON} YJR096W
           - Hypothetical ORF [contig 189] FULL
          Length = 289

 Score =  150 bits (379), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 100/295 (33%), Positives = 160/295 (54%), Gaps = 42/295 (14%)

Query: 8   STKTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNEDQVGQAI- 66
           +TKTL+   G +IP + LG +++   +   +V  ALK+GY+H+D A +Y NE +VG  I 
Sbjct: 7   TTKTLT--NGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIA 64

Query: 67  ----KDSGVPREEIFVTTKLWSTQH-HEPAK-ALDESLQRLG-LDYVDLYLIHWPARLDT 119
               +   V R EIF TTK+    H +E AK ++ +SL+ +  ++Y+DL LIH       
Sbjct: 65  KFLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIH------- 117

Query: 120 NYIKDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDL 179
                      P  A   R         + TW+ +QE    GK +AIGVSN+SI +L++L
Sbjct: 118 ----------NPIAATEER---------LGTWKALQEAYAEGKVRAIGVSNYSIKHLEEL 158

Query: 180 LASPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKIA 239
               G K+ P  NQ E++P L + EL  +C+ K +++EA+SPL  T      +P + ++ 
Sbjct: 159 YNWEGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPL--TRGQKFSDPQLQELI 216

Query: 240 KKN--NVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKI--FTLSNEDFEAINN 290
           K +  N  P  ++I W  Q G++ LPKS N  R  +N +   F +S++D +A+ +
Sbjct: 217 KTSYPNQTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQALDFEISDKDMKALTH 271

>ABL209C Chr2 complement(11410..12342) [933 bp, 310 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR096W
          Length = 310

 Score =  150 bits (379), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 93/287 (32%), Positives = 146/287 (50%), Gaps = 38/287 (13%)

Query: 14  LNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNEDQVGQAI-----KD 68
           L+ G QIP VGLG +Q  +      V  AL+ GY+  D+A  Y NED V + I       
Sbjct: 15  LSDGTQIPSVGLGVYQVSEQTVQDLVYEALEVGYRLFDSAQAYHNEDGVARGIAAWLKHA 74

Query: 69  SGVPREEIFVTTKLWSTQHHEPA--KALDESLQRLG-LDYVDLYLIHWPARLDTNYIKDG 125
            G  RE+++ TTK+ +  H   A  K+L++SL   G L Y+DL L+H P           
Sbjct: 75  PGRRREDVYFTTKINTQNHGYEATKKSLEKSLHAAGPLGYIDLVLVHAPM---------- 124

Query: 126 DILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDLLASPGN 185
                   +D +R         + TW+ ++E    G+ ++IGVSN+   +L +LL   G 
Sbjct: 125 --------SDRTRR--------LGTWQALEEAVVEGQVRSIGVSNYGQQHLSELLGWEGL 168

Query: 186 KLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKIAKKNNVQ 245
           K+ P  NQVEI+P L + EL+ +C+   I ++A+SPL       L +P + K+A + +  
Sbjct: 169 KIRPVVNQVEINPWLCRQELVQYCRENNIAVQAFSPL--MRGKRLDDPILQKVAHQYDKG 226

Query: 246 PGHVVISWHAQRGYVVLPKSVNPDRIETNRKI--FTLSNEDFEAINN 290
              +++ W  Q G++VLPK+   +R+  N  I  F LS E    + +
Sbjct: 227 VAQILVRWSIQMGFIVLPKAAKKERLAPNFDIWDFELSAETMSELTH 273

>Skud_8.165 Chr8 (297201..298184) [984 bp, 327 aa] {ON} YHR104W
           (REAL)
          Length = 327

 Score =  150 bits (380), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 97/305 (31%), Positives = 156/305 (51%), Gaps = 26/305 (8%)

Query: 12  LSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNEDQVGQAIK---- 67
           ++LN G ++P VGLG W+   N     +  A+K GY+  D A  Y NE +VG+ I+    
Sbjct: 5   VTLNNGLKMPLVGLGCWKIDKNACANQIYEAIKLGYRLFDGACDYGNEKEVGEGIRKAIY 64

Query: 68  DSGVPREEIFVTTKLWSTQHH--EPAKALDESLQRLGLDYVDLYLIHWPARLDTNYIKDG 125
           +  V R+++FV +KLW+  HH      AL ++L  +GLDY+DLY IH+P        ++ 
Sbjct: 65  EGLVTRKDVFVVSKLWNNFHHPDHVKLALKKTLSDMGLDYLDLYYIHFPIAFKYIPFEEK 124

Query: 126 DILSVPTKADGSRAVDVTNWN--FIKTWELMQELPKTGKTKAIGVSNFSINNLKDLLASP 183
                 T  +      +T  +   I T+  +++    G  K+IG+SNF  + ++DLL   
Sbjct: 125 YPPGFYTGTEDEEKGHITEAHVPIIDTYRALEKCVDEGLIKSIGISNFQGSLVQDLLR-- 182

Query: 184 GNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLG-----STDAPLLK------E 232
           G ++ P A Q+E HP L Q  L+ FCK   I + AYS  G       D  L K      E
Sbjct: 183 GCRIKPVALQIEHHPYLTQEHLVEFCKLHDIQVVAYSSFGPQSFIEMDLQLAKATQTLFE 242

Query: 233 PTILKIAKKNNV--QPGHVVISWHAQRGYVVLPKSVNPDRIETNRKI---FTLSNEDFEA 287
             ++K   +N+       V++ W  QRG  V+PKS   +R+  N +I   F+L+ ++ + 
Sbjct: 243 NDVIKKVSENHTGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIEKKFSLTEQELKK 302

Query: 288 INNIS 292
           I+ ++
Sbjct: 303 ISALN 307

>KLLA0F05775g Chr6 (560270..561199) [930 bp, 309 aa] {ON} highly
           similar to uniprot|Q07551 Saccharomyces cerevisiae
           YDL124W NADPH-dependent alpha-keto amide reductase
           reduces aromatic alpha-keto amides aliphatic alpha-keto
           esters and aromatic alpha-keto esters
          Length = 309

 Score =  144 bits (364), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 107/314 (34%), Positives = 168/314 (53%), Gaps = 61/314 (19%)

Query: 8   STKTLSLNTGAQIPQV---GLGT--WQSKDNDAYKS--VLAALKA------GYKHIDTAA 54
           + K  +L+ G +IP V   G GT  ++S++ DA  S  ++  +K       G  HID A 
Sbjct: 3   TQKFFTLSNGNKIPAVAIVGTGTAWYKSEETDATFSQPLVDIVKKTLDTVPGVVHIDAAE 62

Query: 55  IYRNEDQVGQAIKDSGVPREEIFVTTKLWSTQH--HEPAKALDESLQRLGLDYVDLYLIH 112
           IYR   ++G A+KD+  PR+EIF+T K  + +     P  AL+ SL++LG+DYVDLYL+H
Sbjct: 63  IYRTYPELGAALKDTKKPRDEIFITDKYSTLKQLSENPKVALETSLKKLGVDYVDLYLLH 122

Query: 113 WPARLDTNYIKDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFS 172
            P       IK+  +             DV        W+ ++EL K+GK K IGVSNF+
Sbjct: 123 SPI------IKESKL-------------DVE-----ANWKYLEELYKSGKAKNIGVSNFA 158

Query: 173 INNLKDLLASPGNKLTPAANQVEIHPLLPQNE---LINFCKSKKIMIEAYSPLGSTDAPL 229
           + +L+ LLA    ++ P  NQ+E  P L QN+   ++ F +   I++EAYSPLG    PL
Sbjct: 159 VKDLEKLLAVA--EVKPQVNQIEFSPFL-QNQTPGIVEFSQKNGILLEAYSPLG----PL 211

Query: 230 LKEPT----------ILKIAKKNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKI-- 277
            + P           I +++KK N     +++SW  +RG + +  S   +RI+  + I  
Sbjct: 212 QRRPEDADKLPFYQYIAELSKKYNKSEAQILLSWVYERGILPVTTSSKIERIQQAQDIFS 271

Query: 278 FTLSNEDFEAINNI 291
           F+L+NE+ + I  +
Sbjct: 272 FSLANEEVQKITQL 285

>CAGL0J09394g Chr10 (925839..926774) [936 bp, 311 aa] {ON} similar
           to uniprot|Q07551 Saccharomyces cerevisiae YDL124w
          Length = 311

 Score =  139 bits (351), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 102/309 (33%), Positives = 155/309 (50%), Gaps = 57/309 (18%)

Query: 12  LSLNTGAQIPQV---GLGT-WQ---SKDNDAYKSVLAALKA-----GYKHIDTAAIYRNE 59
             LN G ++P V   G GT W      D +  ++++  LK      G  H+D A  Y   
Sbjct: 7   FKLNNGHEMPGVAIVGTGTKWHKVNETDENFSQTLVDQLKYALSLPGVVHLDAAEFYMTY 66

Query: 60  DQVGQAIKDSGVPREEIFVTTKLWSTQH--HEPAKALDESLQRLGLDYVDLYLIHWPARL 117
            +VG+A+ ++  PR+EIF+T K W+       P   L+  L+RLGL+YVDLYL+H P   
Sbjct: 67  REVGRALAETSKPRDEIFITDKYWTLSKVTENPIVGLETGLKRLGLEYVDLYLLHSPF-- 124

Query: 118 DTNYIKDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLK 177
                       +  + +G        ++  + W +M+EL  +GK K IGVSNF+  +L+
Sbjct: 125 ------------ISKETNG--------FSLEEAWGMMEELYHSGKAKNIGVSNFAKEDLE 164

Query: 178 DLLASPGNKLTPAANQVEIHPLLPQNE---LINFCKSKKIMIEAYSPLGSTDAPLLKEPT 234
            +L     K+ P  NQ+E +  L QN+   + NFCK   I + AYSPLG    PL K+P 
Sbjct: 165 RVLKVC--KVKPQVNQIEFNAFL-QNQTPGIYNFCKQNDIQLAAYSPLG----PLQKKPA 217

Query: 235 ----------ILKIAKKNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFTLSNED 284
                     I K+A+  N  PG V++ W  +RG V +  S   +RI+  ++IF    +D
Sbjct: 218 DGNSQPFYSYINKLAQHYNKTPGQVLLRWVTKRGVVAVTTSEKKERIKQAQEIFEFDLKD 277

Query: 285 FEAINNISK 293
            E +  I+K
Sbjct: 278 DE-VTEITK 285

>NCAS0A13740 Chr1 complement(2699208..2700137) [930 bp, 309 aa] {ON}
           Anc_7.285
          Length = 309

 Score =  138 bits (348), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 103/300 (34%), Positives = 155/300 (51%), Gaps = 53/300 (17%)

Query: 12  LSLNTGAQIPQV---GLGT--WQSKDNDAYKS--VLAALKA-----GYKHIDTAAIYRNE 59
            +LN G +IP +   G GT  +++++ DA  S  ++  LK      G  HID A IYR  
Sbjct: 8   FTLNNGNKIPAIAVIGTGTRWFKTEETDATFSQQLVDELKVALTLPGIVHIDAAEIYRTY 67

Query: 60  DQVGQAIKDSGVPREEIFVTTKLWSTQ---HHEPAKALDESLQRLGLDYVDLYLIHWPAR 116
            +V  A+++S  PR+EIF+T K +STQ     +P   L+ SL+ LGLDYVDLYL+H P  
Sbjct: 68  PEVAAALRESNRPRDEIFITDK-YSTQLKLSDDPIAGLNISLKTLGLDYVDLYLLHSP-- 124

Query: 117 LDTNYIKDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNL 176
               +IK+G  L                    + W+ M++L K+GK K IGVSNF + +L
Sbjct: 125 ----FIKNGSTLE-------------------ECWKQMEKLYKSGKAKNIGVSNFRVEDL 161

Query: 177 KDLLASPGNKLTPAANQVEIHPLLPQNE---LINFCKSKKIMIEAYSPLGS----TDAPL 229
           + +L     K  P  NQ+E +  L QN+   ++ FCK   I +EAY+PLG      D P 
Sbjct: 162 EKILKIATIK--PQINQIEFNAAL-QNQSPGIVKFCKENNIQLEAYTPLGPFQRIQDTPE 218

Query: 230 LK--EPTILKIAKKNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFTLSNEDFEA 287
            K     I +++KK N     +++ W  +RG + +  S  P R+   + +F+   E  E 
Sbjct: 219 AKPFYDYIAELSKKYNKTEAQILLRWVTKRGILPVTTSSKPQRLHDAQNLFSFDLESSEV 278

>Smik_4.113 Chr4 (216885..217823) [939 bp, 312 aa] {ON} YDL124W
           (REAL)
          Length = 312

 Score =  134 bits (337), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 101/310 (32%), Positives = 160/310 (51%), Gaps = 59/310 (19%)

Query: 12  LSLNTGAQIPQV---GLGT--WQSKDNDAYKS------VLAALKA-GYKHIDTAAIYRNE 59
           ++LN G +IP +   G GT  ++ ++ DA  S      ++ ALK  G  HID A IYR  
Sbjct: 8   ITLNNGNKIPAIAIIGTGTRWYKEEETDATFSNSLVEQIVYALKLPGIIHIDAAEIYRTY 67

Query: 60  DQVGQAIKDSGVPREEIFVTTKLWSTQ---HHEPAKALDESLQRLGLDYVDLYLIHWPAR 116
            +VG+A+  +  PR EIF+T K +STQ      PA  LD +L+++G DYVDLYL+H P  
Sbjct: 68  PEVGKALSLTEKPRNEIFLTDK-YSTQIKVSESPAVGLDIALKKMGTDYVDLYLLHSPF- 125

Query: 117 LDTNYIKDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNL 176
                        V  + +G        +   + W+ M++L ++GK K IGVSNF++ +L
Sbjct: 126 -------------VSKETNG--------FTLEEAWKDMEQLYRSGKAKNIGVSNFAMKDL 164

Query: 177 KDLLASPGNKLTPAANQVEIHPLLPQNE---LINFCKSKKIMIEAYSPLGSTDAPLLKEP 233
           + +L     ++ P  NQ+E  P L QN+   +  FC+   I++EAYSPLG    PL K  
Sbjct: 165 ERILKVA--EIRPQVNQIEFSPFL-QNQTPGIYKFCQENDILLEAYSPLG----PLQKRT 217

Query: 234 T----------ILKIAKKNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFTLSNE 283
           T          + ++++K       + + W  +RG + +  S  P RI   + +F+    
Sbjct: 218 TKDESLPFFEYVKELSEKYIKSEAQITLRWVTRRGVLPVTTSSKPQRISDAQNLFSFDLT 277

Query: 284 DFEAINNISK 293
           D E +N I++
Sbjct: 278 D-EEVNQITE 286

>Kpol_1020.13 s1020 (27790..28731) [942 bp, 313 aa] {ON}
           (27790..28731) [942 nt, 314 aa]
          Length = 313

 Score =  133 bits (335), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 104/331 (31%), Positives = 163/331 (49%), Gaps = 62/331 (18%)

Query: 8   STKTLSLNTGAQIPQVGL-----------GTWQSKDNDAYKSVLAALKA-GYKHIDTAAI 55
           + K   LN G QIP + +           G+  +  ++  + +  AL   G  HID A  
Sbjct: 4   TQKFFDLNNGNQIPSISIIGTGTRWFKRPGSEHTFSDELVEQIKYALSLPGIIHIDAAEC 63

Query: 56  YRNEDQVGQAIKDSGVPREEIFVTTKLWSTQH---HEPAKALDESLQRLGLDYVDLYLIH 112
           Y    ++ +A+K+S  PR EIF+T K +STQ    ++P + L+  L+ LGLDYVDLYLIH
Sbjct: 64  YGTYPELAKALKESSKPRSEIFITDK-YSTQTKFTNDPIEGLNTGLKTLGLDYVDLYLIH 122

Query: 113 WPARLDTNYIKDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFS 172
            P   D  +              GS  ++       K W+ M+ L K GK K+IGVSNFS
Sbjct: 123 SPF-FDPEF-------------KGSLTLE-------KVWKDMETLYKEGKAKSIGVSNFS 161

Query: 173 INNLKDLLASPGNKLTPAANQVEIHPLLPQNE---LINFCKSKKIMIEAYSPLGSTDAPL 229
           + N++++L   G K  P  NQ+E +  L QN+   ++N+C+   I +EAYSPLG    PL
Sbjct: 162 VKNIEEILKIAGIK--PQVNQIEFNAFL-QNQTPGIVNYCQKNNIQLEAYSPLG----PL 214

Query: 230 LKEPT----------ILKIAKKNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFT 279
            K P           I ++A K       ++++W   RG + +  S    RI   + IF+
Sbjct: 215 QKRPENSNELPFYNYIDELASKYGKTDSQILLNWVYNRGILPITTSSKTQRIIDAQNIFS 274

Query: 280 --LSNEDFEAINNISKEKGEKRVVNPNWSPF 308
             L+ ++ + +  +  E+   R+    W+ F
Sbjct: 275 FNLTKDEVDTLTKLGLEQPALRIY---WTNF 302

>Skud_4.131 Chr4 (235946..236884) [939 bp, 312 aa] {ON} YDL124W
           (REAL)
          Length = 312

 Score =  133 bits (334), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 100/312 (32%), Positives = 161/312 (51%), Gaps = 60/312 (19%)

Query: 10  KTLSLNTGAQIPQV---GLGTWQSKD--------NDAYKSVLAALKA-GYKHIDTAAIYR 57
           K + LN G +IP +   G GT   K+        N   + ++ AL+  G  HID A IYR
Sbjct: 6   KFIVLNNGNKIPAIAIIGTGTRWFKNVETDATFSNSLVEQIMYALELPGIVHIDAAEIYR 65

Query: 58  NEDQVGQAIKDSGVPREEIFVTTKLWSTQ---HHEPAKALDESLQRLGLDYVDLYLIHWP 114
              +VG+A+  +  PR+EIF+T K +STQ      PA  L+ SL+++G DYVDLYL+H P
Sbjct: 66  TYPEVGKALSLTKKPRDEIFLTDK-YSTQIKVSDSPAAGLEVSLKKMGTDYVDLYLLHSP 124

Query: 115 ARLDTNYIKDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSIN 174
                          V  +A+G        +   + W+ M++L K GK K IGVSNF++ 
Sbjct: 125 F--------------VSKEANG--------FTLEEAWKDMEQLYKAGKAKNIGVSNFAVK 162

Query: 175 NLKDLLASPGNKLTPAANQVEIHPLLPQNE---LINFCKSKKIMIEAYSPLGSTDAPLLK 231
           +L+ +L     ++ P  NQ+E  P L QN+   +  FC+   I++EAYSPL    APL K
Sbjct: 163 DLEKILKIA--EVKPQVNQIEFSPFL-QNQTPGIYKFCQDNNILLEAYSPL----APLQK 215

Query: 232 EPT----------ILKIAKKNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFT-- 279
           +            + ++++K       +++ W ++RG + +  S  P RI   + +F+  
Sbjct: 216 KTAQDDSKPFFEYVKELSEKYFKSEAQIILRWVSKRGVLPVTTSSKPQRISDAQNLFSFD 275

Query: 280 LSNEDFEAINNI 291
           L++E+ + I  +
Sbjct: 276 LTDEEVDEITEL 287

>Kwal_47.19278 s47 complement(1169418..1170362) [945 bp, 314 aa]
           {ON} YDL124W - Hypothetical ORF [contig 344] FULL
          Length = 314

 Score =  131 bits (330), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 98/328 (29%), Positives = 165/328 (50%), Gaps = 57/328 (17%)

Query: 11  TLSL-NTGAQIPQVGLGT---WQ-----SKDNDAYKSVLA-----ALKAGYKHIDTAAIY 56
           TL L  +G +IP +G G+   W+      +  D + + LA     A+ AG+ HID A  Y
Sbjct: 7   TLRLKGSGDEIPIIGFGSGTKWRIAKASGEKKDQFITELADQVTSAINAGFNHIDAAEAY 66

Query: 57  RNEDQVGQAIKDSGVPREEIFVTTKL--WS---TQHHEPAKALDESLQRLGLDYVDLYLI 111
           +   +VG+ +K+SGVPR+++++T K   WS    +   P ++L  SL+++ + YVDLYL+
Sbjct: 67  KTHPEVGRGVKNSGVPRDKLWITDKYTPWSWDWRKGTGPLESLSLSLEKMQMSYVDLYLL 126

Query: 112 HWPARLDTNYIKDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNF 171
           H P             ++V T       +D+      + W  M+E+   G  K IGVSNF
Sbjct: 127 HVP------------FITVQTA-----GIDLK-----EAWRQMEEIYDRGLAKNIGVSNF 164

Query: 172 SINNLKDLLASPGNKLTPAANQVEIHPLLPQNE--LINFCKSKKIMIEAYSPLGSTDAPL 229
            + +L+ +  +   K  P  NQ+E +  L Q    +I +CK   I++E YSPL     PL
Sbjct: 165 DVESLEYI--TKIGKYLPVVNQIEFNAYLQQQSPGIIAYCKDHDIVVEGYSPL----VPL 218

Query: 230 LK------EPTILKIAKKNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKI--FTLS 281
            K      +  +  +A+K +     +++ W  Q G VV+  S    R++ +  I  F L+
Sbjct: 219 TKGRPGPLDKLLPALAEKYHKSELQILLRWVTQNGVVVITTSAQQARVKESVNIFDFELT 278

Query: 282 NEDFEAINNISKEKGEKRVVNPNWSPFE 309
            EDF++I  I +EK  +  +   +S ++
Sbjct: 279 AEDFDSITKIGREKIFRGFMGEQYSKYD 306

>YDL124W Chr4 (240259..241197) [939 bp, 312 aa] {ON} NADPH-dependent
           alpha-keto amide reductase; reduces aromatic alpha-keto
           amides, aliphatic alpha-keto esters, and aromatic
           alpha-keto esters; member of the aldo-keto reductase
           (AKR) family
          Length = 312

 Score =  128 bits (322), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 97/313 (30%), Positives = 159/313 (50%), Gaps = 60/313 (19%)

Query: 12  LSLNTGAQIPQV---GLGT--WQSKDNDA------YKSVLAALKA-GYKHIDTAAIYRNE 59
            +LN G +IP +   G GT  +++++ DA       + ++ ALK  G  HID A IYR  
Sbjct: 8   FTLNNGNKIPAIAIIGTGTRWYKNEETDATFSNSLVEQIVYALKLPGIIHIDAAEIYRTY 67

Query: 60  DQVGQAIKDSGVPREEIFVTTKLWSTQ---HHEPAKALDESLQRLGLDYVDLYLIHWPAR 116
            +VG+A+  +  PR  IF+T K +S Q      PA  LD +L+++G DYVDLYL+H P  
Sbjct: 68  PEVGKALSLTEKPRNAIFLTDK-YSPQIKMSDSPADGLDLALKKMGTDYVDLYLLHSPFV 126

Query: 117 LDTNYIKDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNL 176
                                 + +V   +  + W+ M++L K+GK K IGVSNF++ +L
Sbjct: 127 ----------------------SKEVNGLSLEEAWKDMEQLYKSGKAKNIGVSNFAVEDL 164

Query: 177 KDLLASPGNKLTPAANQVEIHPLLPQNE---LINFCKSKKIMIEAYSPLGSTDAPLLKEP 233
           + +L     ++ P  NQ+E  P L QN+   +  FC+   I++EAYSPLG    PL K+ 
Sbjct: 165 QRILKVA--EVKPQVNQIEFSPFL-QNQTPGIYKFCQEHDILVEAYSPLG----PLQKKT 217

Query: 234 T----------ILKIAKKNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFT--LS 281
                      + ++++K       +++ W  +RG + +  S  P RI   + +F+  L+
Sbjct: 218 AQDDSQPFFEYVKELSEKYIKSEAQIILRWVTKRGVLPVTTSSKPQRISDAQNLFSFDLT 277

Query: 282 NEDFEAINNISKE 294
            E+ + I  +  E
Sbjct: 278 AEEVDKITELGLE 290

>NDAI0A02300 Chr1 (516594..517535) [942 bp, 313 aa] {ON} Anc_7.285
          Length = 313

 Score =  127 bits (319), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 106/334 (31%), Positives = 163/334 (48%), Gaps = 60/334 (17%)

Query: 8   STKTLSLNTGAQIPQV---GLGT-WQ------SKDNDAYKSVL--AALKAGYKHIDTAAI 55
           S +  +LN G +IP +   G GT W        K +D     L  A    G  HID A +
Sbjct: 4   SQEFFTLNNGNKIPAISIIGTGTKWHHGKLESGKFSDELVDQLQYALTLPGIIHIDAAEM 63

Query: 56  YRNEDQVGQAIKDSGVPREEIFVTTKLWSTQ---HHEPAKALDESLQRLGLDYVDLYLIH 112
           Y    +V +A+K +   R+EIF+T K +S        P   L +SL+ L LDYVDLYL+H
Sbjct: 64  YNTYPEVNKALKSTSKVRDEIFITDKYYSGSPKLTENPIAGLTKSLKELELDYVDLYLLH 123

Query: 113 WPARLDTNYIKDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFS 172
            P                 TK       +   +   + W+ M++L K GK K IGVSNFS
Sbjct: 124 SP---------------FITK-------ESCGYTMEEAWKQMEKLYKDGKAKNIGVSNFS 161

Query: 173 INNLKDLLASPGNKLTPAANQVEIHPLLPQNE---LINFCKSKKIMIEAYSPLGSTDAPL 229
           +++LK +L     ++ P  NQ+E +  L QN+   ++ FC+   I++EAYSPLG    PL
Sbjct: 162 VDDLKRILKI--CEIKPQINQIEFNAFL-QNQTPGIVKFCQDHDILVEAYSPLG----PL 214

Query: 230 LKEPT----------ILKIAKKNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFT 279
            K+PT          I ++AKK     G V++ W  +R  + +  S   +RI+  + +F+
Sbjct: 215 RKKPTDRDPGPFYQYIEELAKKYGKSEGQVLLRWVTKRKILPITTSGKEERIKDAQDLFS 274

Query: 280 --LSNEDFEAINNISKEKGEKRVV-NPNWSPFEA 310
             L++E+ E I  +       R+    N+S F++
Sbjct: 275 FDLTSEEVEKITKLGLAHEPSRLYWKNNYSQFDS 308

>KLTH0G00638g Chr7 (43280..44221) [942 bp, 313 aa] {ON} similar to
           uniprot|Q07551 Saccharomyces cerevisiae YDL124W
           NADPH-dependent alpha-keto amide reductase reduces
           aromatic alpha-keto amides aliphatic alpha-keto esters
           and aromatic alpha-keto esters
          Length = 313

 Score =  127 bits (318), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 97/309 (31%), Positives = 148/309 (47%), Gaps = 56/309 (18%)

Query: 15  NTGAQIPQVGLGT---W-----QSKDNDAYKSVLA-----ALKAGYKHIDTAAIYRNEDQ 61
            +G ++P +G G+   W     + +  D +   LA     A+KAG+ HID A  Y+   +
Sbjct: 12  GSGDKLPVIGFGSGTKWRIAKAEGEKKDQFIQELADQVSNAIKAGFNHIDAAEAYKTHPE 71

Query: 62  VGQAIKDSGVPREEIFVTTKL--WS---TQHHEPAKALDESLQRLGLDYVDLYLIHWPAR 116
           VG  I +SGVPRE+++VT K   WS    +   P ++L+ SL ++ + YVDLYL+H    
Sbjct: 72  VGAGIANSGVPREKLWVTDKYTPWSWTWRKGKGPLESLELSLGKMQMQYVDLYLVH---- 127

Query: 117 LDTNYIKDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNL 176
                        VP     +  +D+      + W  M+E+   G  K IGVSNF + +L
Sbjct: 128 -------------VPFINPETAGIDLK-----EAWRQMEEIYDRGWAKNIGVSNFDVESL 169

Query: 177 KDLLASPGNKLTPAANQVEIHPLLPQNE--LINFCKSKKIMIEAYSPLGSTDAPLLK-EP 233
           + +      K  P  NQ+E    + Q    +I++CK   I IE YSPL     PL K +P
Sbjct: 170 EYIRTI--GKYQPVVNQIEFSAYMQQQSPGIISYCKKHGIAIEGYSPL----VPLTKGKP 223

Query: 234 TILK-----IAKKNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKI--FTLSNEDFE 286
             L      +AKK       +++ W  Q G + +  S    RI+ +  I  F LS+EDF 
Sbjct: 224 GPLDDILPLMAKKYGKSELQILLRWVVQNGVIAITTSAQQKRIDESLDIFDFELSSEDFT 283

Query: 287 AINNISKEK 295
           +I  + K K
Sbjct: 284 SITEVGKTK 292

>SAKL0F09746g Chr6 complement(746292..747230) [939 bp, 312 aa] {ON}
           highly similar to uniprot|Q07551 Saccharomyces
           cerevisiae YDL124W NADPH-dependent alpha-keto amide
           reductase reduces aromatic alpha-keto amides aliphatic
           alpha-keto esters and aromatic alpha-keto esters
          Length = 312

 Score =  124 bits (312), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 99/310 (31%), Positives = 153/310 (49%), Gaps = 60/310 (19%)

Query: 12  LSLNTGAQIPQV---GLGT-WQSKDNDAYK-------SVLAALKA-GYKHIDTAAIYRNE 59
            +LN G +IP V   G GT W   + +A K        V  AL   G  HID A IYR  
Sbjct: 8   FTLNNGNKIPAVAVIGTGTKWFKTEENASKFSDELVDQVKYALTLPGVVHIDAAEIYRTY 67

Query: 60  DQVGQAIKDSGVPREEIFVTTKLWSTQ---HHEPAKALDESLQRLGLDYVDLYLIHWPAR 116
            ++G+A++++  PR EI++T K +ST       P    +  L+ LG+DY+DLYL+H P  
Sbjct: 68  PELGKALRETKKPRNEIWITDK-YSTSLKLSDNPIVGFENGLKELGVDYIDLYLLHSP-- 124

Query: 117 LDTNYIKDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNL 176
               +I +G                   +   + W+ ++EL K+GK K IGVSNF+  +L
Sbjct: 125 ----FITEGR----------------NGFTLEQAWKYLEELYKSGKAKNIGVSNFAKEDL 164

Query: 177 KDLLASPGNKLTPAANQVEIHPLLPQNE---LINFCKSKKIMIEAYSPLGSTDAPLLKEP 233
           + +L     ++ P  NQ+E    L QN+   + NF K   I++EAYSPLG    PL + P
Sbjct: 165 ERILKIA--EIKPQVNQIEYSAFL-QNQTPGIYNFAKENDILLEAYSPLG----PLQRRP 217

Query: 234 T----------ILKIAKKNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFT--LS 281
                      I ++A+K       V++ W ++RG + +  S  P R+   + IFT  L+
Sbjct: 218 EEADSLPFYKYINELAEKYGKSEAQVLLRWVSKRGVLPVTTSSKPHRVHDAQHIFTFDLT 277

Query: 282 NEDFEAINNI 291
           + + E I  +
Sbjct: 278 STEVEKITEL 287

>SAKL0F00704g Chr6 (60941..61888) [948 bp, 315 aa] {ON} similar to
           uniprot|Q07551 Saccharomyces cerevisiae YDL124W
           NADPH-dependent alpha-keto amide reductase reduces
           aromatic alpha-keto amides aliphatic alpha-keto esters
           and aromatic alpha-keto esters
          Length = 315

 Score =  124 bits (311), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 93/308 (30%), Positives = 148/308 (48%), Gaps = 56/308 (18%)

Query: 16  TGAQIPQVGLGT---WQ-----SKDNDAYKSVLA-----ALKAGYKHIDTAAIYRNEDQV 62
           +G  +P +G G+   W+      K    Y   LA     A++ G+ HIDTA  Y+   +V
Sbjct: 14  SGDLLPSIGFGSGTKWRIAKSSGKTKGVYIDALADQVTNAIQCGFNHIDTAEAYKTYKEV 73

Query: 63  GQAIKDSGVPREEIFVTTKL--WSTQHHE---PAKALDESLQRLGLDYVDLYLIHWPARL 117
           G  I ++ VPRE +++T K   WS +  +   P ++L  SL+ + LDYVDLY+IH P   
Sbjct: 74  GTGISNAQVPRETLWITDKYTPWSWEWRKGSGPLESLTLSLKEMNLDYVDLYMIHVP--- 130

Query: 118 DTNYIKDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLK 177
                      ++ TK  G   +D+      + W  M+E+      + IGVSNF + +L+
Sbjct: 131 -----------NITTKTAG---IDLK-----EAWLQMEEIYTRKMARNIGVSNFDVESLE 171

Query: 178 DLLASPGNKLTPAANQVEIHPLLPQNE--LINFCKSKKIMIEAYSPLGSTDAPLLK---- 231
            + +    K  P  NQ+E    + Q    ++ +C+   I++E YSPL     PL K    
Sbjct: 172 YIKSFA--KYQPVVNQIEFSAYMQQQSPGILKYCRENNIVVEGYSPL----VPLTKGKPG 225

Query: 232 --EPTILKIAKKNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKI--FTLSNEDFEA 287
             +  +  IA K       V++ W  Q G VV+  +   +R+  +  I  F LS EDF+ 
Sbjct: 226 PLDEILPGIAAKYGKSQLQVLLRWVTQNGIVVITTTGKKERLNESLNIFDFELSKEDFDQ 285

Query: 288 INNISKEK 295
           I N+ +EK
Sbjct: 286 ITNVGREK 293

>KAFR0B01200 Chr2 (224411..225358) [948 bp, 315 aa] {ON} Anc_7.285
           YDL124W
          Length = 315

 Score =  124 bits (310), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 93/305 (30%), Positives = 151/305 (49%), Gaps = 60/305 (19%)

Query: 13  SLNTGAQIPQV---GLGTWQSKDNDAYKSV---------LAALKAGYKHIDTAAIYRNED 60
           +LN G ++P +   G GT   K  +  ++           A    G  HID A +YR   
Sbjct: 10  TLNNGNKMPSIAIIGTGTAWYKTEETPETFSQELVDQIKYALTLPGIVHIDAAEVYRTYP 69

Query: 61  QVGQAIKDSG--VPREEIFVTTKLWSTQ---HHEPAKALDESLQRLGLDYVDLYLIHWPA 115
           +VG+A+++S    PR+EIF+T K +STQ      P   L   L++LGLDYVDLYL+H P 
Sbjct: 70  EVGKALRESHNVKPRDEIFITDK-YSTQLKISENPMVGLTNGLKKLGLDYVDLYLLHSPF 128

Query: 116 RLDTNYIKDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINN 175
                         +  + +G        +   + W+ M++L K GK K IGVSNFS+ +
Sbjct: 129 --------------ISKEKNG--------FTMEEAWKYMEDLYKAGKVKNIGVSNFSMAD 166

Query: 176 LKDLLASPGNKLTPAANQVEIHPLLPQNE---LINFCKSKKIMIEAYSPLGSTDAPLLKE 232
           L+ +L S   ++ P  NQ+E +  L QN+   ++NFC+   I + AY+PLG    PL ++
Sbjct: 167 LQRILKSC--EVKPQVNQIEFNAFL-QNQTPGIVNFCRENDIQVVAYTPLG----PLQRK 219

Query: 233 PT----------ILKIAKKNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFTLSN 282
                       + ++A+K +     +++ W ++RG + +  S    RI+  + +FT   
Sbjct: 220 SKNFEQENFHKFVKQLAEKYDKSEAQILLRWVSKRGIIPVTTSSKEKRIKDAQYLFTFDL 279

Query: 283 EDFEA 287
            D E 
Sbjct: 280 TDSEV 284

>ZYRO0E09614g Chr5 complement(765913..766839) [927 bp, 308 aa] {ON}
           similar to uniprot|Q07551 Saccharomyces cerevisiae
           YDL124W NADPH-dependent alpha-keto amide reductase
           reduces aromatic alpha-keto amides aliphatic alpha-keto
           esters and aromatic alpha-keto esters
          Length = 308

 Score =  122 bits (307), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 96/313 (30%), Positives = 149/313 (47%), Gaps = 64/313 (20%)

Query: 15  NTGAQIPQVGLGT---WQSKDNDA----------YKSVLAALKAGYKHIDTAAIYRNEDQ 61
            T   IP +G GT   W+    +              ++ A+  G+ HIDTA  Y   ++
Sbjct: 13  ETHTHIPVLGFGTGTQWRIAKREGETKGQFIDKLVDQLVTAVDLGFNHIDTAEFYLTHEE 72

Query: 62  VGQAIKDSGVPREEIFVTTKL----WS-TQHHEPAKALDESLQRLGLDYVDLYLIHWPAR 116
           VG+A++ S +PR+++F+T K     W+      P +A  + L+ LG+ Y DLY++H P  
Sbjct: 73  VGEALRRSQLPRDKLFITDKYNQGAWTGLDCSGPIQAAKKGLEALGIKYFDLYMLHRP-- 130

Query: 117 LDTNYIKDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNL 176
                    DI    TK +    +D+      + W  ++EL + G  KAIGVSNF +  L
Sbjct: 131 ---------DI----TKENA--GIDLQ-----EAWRQVEELYEAGIAKAIGVSNFPLETL 170

Query: 177 KDLLASPGNKLTPAANQVEIHPLLPQNE---LINFCKSKKIMIEAYSPLGSTDAPLLKE- 232
           K + +    +  P  +QVE HP L QN+   ++ +C++K I++EAYSPL    APL +  
Sbjct: 171 KQMESY--CRYLPMVHQVEFHPYL-QNQSPGVVEWCQNKHIVVEAYSPL----APLFRAR 223

Query: 233 --------PTILKIAKKNNVQPGHVVISWHAQRGYVVLPKSVNPDRIE--TNRKIFTLSN 282
                   P ++K   K+  Q   +V+ W   RG V L  S   +RI        F L  
Sbjct: 224 PGPLDDILPNLMKKYGKSETQ---IVLRWVIDRGIVALTTSSKEERIHEILGTLDFELEK 280

Query: 283 EDFEAINNISKEK 295
            D E IN +  +K
Sbjct: 281 SDVELINEVGSKK 293

>ZYRO0C09196g Chr3 complement(698826..699764) [939 bp, 312 aa] {ON}
           highly similar to uniprot|Q07551 Saccharomyces
           cerevisiae YDL124W NADPH-dependent alpha-keto amide
           reductase reduces aromatic alpha-keto amides aliphatic
           alpha-keto esters and aromatic alpha-keto esters
          Length = 312

 Score =  119 bits (297), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 92/291 (31%), Positives = 144/291 (49%), Gaps = 50/291 (17%)

Query: 12  LSLNTGAQIPQV---GLGT--WQSKDNDA------YKSVLAALK-AGYKHIDTAAIYRNE 59
            +LN G +IP V   G GT  ++ ++ DA       K +  AL   G  H+D A +YR  
Sbjct: 8   FTLNNGNKIPAVAVIGTGTRWYKKEETDANFSHALVKQIEYALTLPGVVHVDHAEVYRTY 67

Query: 60  DQVGQAIKDSGVPREEIFVTTKLWSTQH---HEPAKALDESLQRLGLDYVDLYLIHWPAR 116
            +  +A+K++  PR EIFVT K +S Q    ++P + LD  L+R GL+YVDLYL+H P  
Sbjct: 68  PEFSEALKNTKKPRNEIFVTDK-YSVQEKITNDPREGLDTGLKRTGLEYVDLYLLHSP-- 124

Query: 117 LDTNYIKDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNL 176
                          +K      ++       + W  ++EL   GK K IGVSNF + +L
Sbjct: 125 -------------FASKEKNGFTIE-------EAWAQLEELYHEGKAKNIGVSNFRVEDL 164

Query: 177 KDLLASPGNKLTPAANQVEIHPLLPQNE---LINFCKSKKIMIEAYSPLG---STDAPLL 230
           + +L     K+ P  NQ+E    L QN+   ++ F +   I +EAY+PLG     D    
Sbjct: 165 EKILKVA--KVKPQVNQIEFSAFL-QNQTPGVVKFSQDHDIQLEAYAPLGPLSKRDESEQ 221

Query: 231 KEP---TILKIAKKNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIF 278
            +P    I K+ +K +     +++ W ++RG + +  S  P RIE  + +F
Sbjct: 222 AKPFYDYIKKLTEKYSKTEAQILLRWVSKRGILPVTTSGQPKRIEDAQNLF 272

>KNAG0C04110 Chr3 (806389..807324) [936 bp, 311 aa] {ON} Anc_7.285
           YDL124W
          Length = 311

 Score =  118 bits (296), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 90/305 (29%), Positives = 145/305 (47%), Gaps = 49/305 (16%)

Query: 12  LSLNTGAQIPQV---GLGT-W---QSKDNDAYKSVLAALK-----AGYKHIDTAAIYRNE 59
           ++LN G ++P V   G GT W   + KD+     ++  L+      G  HID A +Y   
Sbjct: 8   VTLNNGHKMPAVAIIGTGTHWHHKKEKDHALSHELIEQLEFALSLPGVVHIDAAEMYGTY 67

Query: 60  DQVGQAIKDSGVPREEIFVTTK--LWSTQHHEPAKALDESLQRLGLDYVDLYLIHWPARL 117
            ++  A++ +  PR EIF+T K  L +    +P   L++SL+   LDYVDLYL+H P   
Sbjct: 68  PELSAALRMTEKPRSEIFITDKHALHAAMSKDPIAGLEDSLKANNLDYVDLYLLHSPFV- 126

Query: 118 DTNYIKDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLK 177
                                A +         W  M++L K GK K IGVSNFS+ +LK
Sbjct: 127 ---------------------AKEKPGLTLEGAWRQMEQLYKDGKAKNIGVSNFSVEDLK 165

Query: 178 DLLASPGNKLTPAANQVEIHPLLPQNE---LINFCKSKKIMIEAYSPLGSTDAPLLKEPT 234
            +L+    ++ P  NQ+E HP L QN+   ++ FC+ + I +EA++PLG       ++  
Sbjct: 166 RVLSVA--EIKPQVNQIEFHPFL-QNQTPGILKFCQDENIELEAFTPLGPLQVKTQEDEN 222

Query: 235 ------ILKIAKKNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFTLSNEDFEAI 288
                 I  ++ K       +++ W  +RG + +  S   DRI   + +F    ED E +
Sbjct: 223 DEFFKYISSLSGKYQKTEAQIILRWVTKRGVIPVTTSRRHDRIADAQNLFEFDLED-EEV 281

Query: 289 NNISK 293
             I++
Sbjct: 282 TKITR 286

>TDEL0D02790 Chr4 complement(533517..534506) [990 bp, 329 aa] {ON} 
          Length = 329

 Score =  118 bits (296), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 89/308 (28%), Positives = 154/308 (50%), Gaps = 56/308 (18%)

Query: 12  LSLNTGAQIPQV---GLGT-W---QSKDNDAYKSVLAALKA-----GYKHIDTAAIYRNE 59
            +LN G +IP V   G GT W   +  +++  K ++  +K      G  H+D A  Y   
Sbjct: 27  FTLNNGNKIPAVAVVGTGTTWFKNEETESNFSKELVEQIKYALTLPGIVHLDAAECYNTY 86

Query: 60  DQVGQAIKDSGVPREEIFVTTKLWST--QHHEPAKALDESLQRLGLDYVDLYLIHWPARL 117
            ++GQA+++S  PR+EIF+T K   T   H    +  +  ++++G+DYVDLYLIH P   
Sbjct: 87  QELGQALRESPKPRDEIFITDKFSPTPKNHGGVLERFESGIKKMGVDYVDLYLIHSPL-- 144

Query: 118 DTNYIKDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLK 177
                       +  + +G    +V        W+ +++L + GK K IGVSNF + +L+
Sbjct: 145 ------------IEKEKNGVTLEEV--------WKDLEKLYEAGKAKNIGVSNFRVEDLQ 184

Query: 178 DLLASPGNKLTPAANQVEIHPLLPQNE---LINFCKSKKIMIEAYSPLGSTDAPLLKEPT 234
            +L     K+ P  NQ+E H  L QN+   ++ F +   I +EAY+PLG    PL ++ +
Sbjct: 185 RILKVA--KVKPQVNQIEFHVFL-QNQTPGIVKFSQDNNIQLEAYTPLG----PLQRKQS 237

Query: 235 --------ILKIAKKNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFT--LSNED 284
                   + ++AKK       V++ W  +R  + +  S  P RI+  + +F+  L++E+
Sbjct: 238 DAGDFYNYVEELAKKYGKTEAQVLLRWVTRRHVLPITTSSKPQRIQAAQDLFSFDLTDEE 297

Query: 285 FEAINNIS 292
            + I  + 
Sbjct: 298 VKKITELG 305

>Kpol_381.8 s381 complement(20844..21359,21366..21695,21698..21781)
           [930 bp, 309 aa] {ON}
           complement(20844..21359,21366..21695,21698..21781) [930
           nt, 310 aa]
          Length = 309

 Score =  117 bits (293), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 102/323 (31%), Positives = 156/323 (48%), Gaps = 58/323 (17%)

Query: 12  LSLNTGAQIPQV---GLGT-WQSK------DNDAYKSVLAALKA-GYKHIDTAAIYRNED 60
            +LN G +I  V   G GT W+++       N+       AL   G  H+D A  YR   
Sbjct: 8   FTLNNGNKIRAVAIIGTGTKWKTEAQAHLLSNELVDQAKFALSLPGIVHVDAAEYYRTYP 67

Query: 61  QVGQAIKDSGVPREEIFVTTKLWSTQH--HEPAKALDESLQRLGLDYVDLYLIHWPARLD 118
           ++ +A+K+S  PR EIF+T K  +       P +AL+ +L  LGLDYVDLY++H+P   D
Sbjct: 68  ELNKALKESSKPRNEIFITDKFSTLLKITANPIEALNTALDSLGLDYVDLYVLHFP-EFD 126

Query: 119 TNYIKDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKD 178
             Y KD   LS+ T                  W  M+ L K GK K IGVSNFSI +L+ 
Sbjct: 127 PEY-KD---LSIET-----------------AW--MELLYKEGKAKNIGVSNFSIEHLER 163

Query: 179 LLASPGNKLTPAANQVEIHPLLPQNE---LINFCKSKKIMIEAYSPLGSTDAPLLKEPT- 234
           ++     K  P  NQ+E +  L QN+   ++ +C+     +EAYSPL    APL ++P  
Sbjct: 164 VMKIADVK--PQVNQIEFNAFL-QNQTPGIVKYCQQNGFQLEAYSPL----APLQRKPKN 216

Query: 235 ---------ILKIAKKNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFTLSNEDF 285
                    I +++ K       +++ W  +RG V +  S   +RI   + +F+    D 
Sbjct: 217 FNELPFYKYIDEVSAKYGKTDSEILLRWVTKRGIVPITTSSRHERIVNAQNLFSFDLTD- 275

Query: 286 EAINNISKEKGEKRVVNPNWSPF 308
           E ++ I+K   E+  +   W+ F
Sbjct: 276 EEVDKITKLGLEQPALRLYWNEF 298

>TBLA0F01980 Chr6 (493378..494286) [909 bp, 302 aa] {ON} Anc_7.285
           YDL124W
          Length = 302

 Score =  115 bits (287), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 92/313 (29%), Positives = 155/313 (49%), Gaps = 58/313 (18%)

Query: 9   TKTLSLNTGAQIPQV---GLGTWQSKDN--DAYKSVLA-----ALKA-GYKHIDTAAIYR 57
           T  ++LN G +IP +   G GT   K N  D Y   L      AL+  G  HID A +Y+
Sbjct: 5   TSLITLNNGNKIPGISIIGTGTRWYKYNPEDKYSDALVKQIENALELPGMLHIDCAEMYQ 64

Query: 58  NEDQVGQAIKDSGVPREEIFVTTKLWSTQHHE--PAKALDESLQRLGLDYVDLYLIHWPA 115
              +VG+A+++S  PR+EIF+T K    +     P + L  +L+++GL+YVDLYL+H+P 
Sbjct: 65  THAEVGEALRNSKKPRDEIFITDKYAIPRKFSSNPKEGLKLALEKMGLEYVDLYLLHFP- 123

Query: 116 RLDTNYIKDGDILSVPTKADGSRAVDVTNWNFI--KTWELMQELPKTGKTKAIGVSNFSI 173
                                   +D   ++F   + W++M++L   G  K IGVSNF +
Sbjct: 124 -----------------------IIDPKLYDFTLEEAWKMMEDLYNEGLAKNIGVSNFRV 160

Query: 174 NNLKDLLASPGNKLTPAANQVEIHPLLPQNE---LINFCKSKKIMIEAYSPLGSTDAPL- 229
            +L+ L  S    + P  NQ+E +  L QN+   + ++C    I +EA+ PL     PL 
Sbjct: 161 EDLEQL--SKSWVIKPQINQIEFNAYL-QNQTPGIYDYCIKNNIQLEAFCPL----VPLR 213

Query: 230 -LKEPTIL-----KIAKKNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFT--LS 281
            + E  +L     ++A+K +     +++ W +QR  + +  S  P+R+     IF+  L+
Sbjct: 214 EVNEKDLLPLYVKQLAQKYSKTENQIMLRWVSQRKVIPVTTSSRPERVRDAYDIFSFELT 273

Query: 282 NEDFEAINNISKE 294
            ++ E I  +  +
Sbjct: 274 QDEVEFITKLGSQ 286

>Ecym_3264 Chr3 complement(503010..503945) [936 bp, 311 aa] {ON}
           similar to Saccharomyces cerevisiae YDL124W
          Length = 311

 Score =  110 bits (274), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 102/327 (31%), Positives = 151/327 (46%), Gaps = 72/327 (22%)

Query: 8   STKTLSLNTGAQIPQ---VGLGTWQSKD---NDAYKSVLAALKA-----GYKHIDTAAIY 56
           + +  +LN G  IP    VG+G   +K     D  K+++  LK      G+ HI TA  Y
Sbjct: 5   TKRFFTLNNGNSIPAITTVGVGNKWTKIYGIRDGAKNLMEYLKEILALPGFLHIMTAEFY 64

Query: 57  RNEDQVGQAIKDSGVPREEIFVTTKLWSTQH--HEPAKALDESLQRLGLDYVDLYLIHWP 114
            N   +  A+K S  PR EI++T K  S       P +AL+ SL RLG DYVDLYLIH P
Sbjct: 65  PNNGLLSAALKASQKPRHEIWITDKYCSQCKLSSSPIEALERSLDRLGFDYVDLYLIHNP 124

Query: 115 ARLDTNYIKDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSIN 174
             LD++   +G  L                    K W+ M+ L KTGK K IGVSNF I 
Sbjct: 125 C-LDSS--PNGISLE-------------------KAWKQMELLYKTGKVKNIGVSNFRIE 162

Query: 175 NLKDLLASPGNKLTPAANQVEIHPLLPQNE---LINFCKSKKIMIEAYSPL--------G 223
           +L+ L  +   ++ P  N++E H  L QN+   +  + K+  +++  YSPL         
Sbjct: 163 DLERLKDA---EIKPQVNEIEFHAFL-QNQTPNIYEYAKTHDLLLCGYSPLFPLETKTED 218

Query: 224 STDAPLLKEPTILKIAKKNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKI------ 277
             D P  +   I+ +A+K N     +++ W    G  VLP       + TN K+      
Sbjct: 219 FMDFPFYR--YIIGLAEKYNKTEAQILLHWMNCLG--VLP-------VITNTKVKWYKEA 267

Query: 278 -----FTLSNEDFEAINNISKEKGEKR 299
                F L++E+ + I  + K+    R
Sbjct: 268 SDIISFELTSEELDMITELGKKHKPHR 294

>Kwal_33.13274 s33 (151643..151969) [327 bp, 108 aa] {ON} YJR096W -
           Hypothetical ORF [contig 119] FULL
          Length = 108

 Score = 76.6 bits (187), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 39/89 (43%), Positives = 53/89 (59%), Gaps = 6/89 (6%)

Query: 14  LNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNEDQVGQAIK----DS 69
           LN G QIP +G G ++    D    V +ALK GY+HIDTA +YRN+ +  Q ++    ++
Sbjct: 15  LNNGQQIPVIGFGVYEIPKEDTADRVYSALKDGYRHIDTAVLYRNQKEAAQGVRKYLDET 74

Query: 70  GVPREEIFVTTKLWSTQ--HHEPAKALDE 96
           G  RE I+ TTKLW +Q    E  KAL E
Sbjct: 75  GEARENIWFTTKLWDSQFGREETKKALQE 103

>TBLA0G01120 Chr7 complement(285827..286858) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 50/102 (49%), Gaps = 19/102 (18%)

Query: 15  NTGAQIPQ--VGLGTWQSKD---------NDAYKSVLAALKAGYKHIDTAAIYRN---ED 60
           NTG +I    VG  ++ SKD         N+ +K +  A  +G +  DTA  Y N   E 
Sbjct: 11  NTGLKISPIIVGCMSYGSKDWHPWIIEDKNEVFKILKTAYDSGLRTFDTADGYSNGQSEI 70

Query: 61  QVGQAIKDSGVPREEIFVTTKLWSTQHHEPAKALDESLQRLG 102
            +G+ +K+  +PRE + + TK+W+     P  +  E  QR G
Sbjct: 71  LLGEFLKEYEIPRETVIIMTKVWA-----PVDSSLEGFQRTG 107

>Suva_4.122 Chr4 (228898..228945,228942..229163,229167..229517) [621
           bp, 206 aa] {ON} YDL124W (REAL)
          Length = 206

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 44/183 (24%), Positives = 84/183 (45%), Gaps = 38/183 (20%)

Query: 50  IDTAA--IYRNE-DQVGQAIKDSGVPREEIFVTTKLWSTQHHEPAKAL----DESLQRLG 102
           ID AA  IY+    +VG+A+  +  P+ EIF+T K  S+   E +  L    D +L+++ 
Sbjct: 7   IDIAASEIYKQTYPEVGEALSLTKKPKTEIFLTDK--SSTQTEVSATLAMRPDMALKKIS 64

Query: 103 LDYVDLYLIHWPARLDTNYIKDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGK 162
           ++YVD++ +H P        K  ++L+                  +K       L ++ K
Sbjct: 65  VEYVDMHFLHSPF-----VFKQANVLN------------------LKDAMHTDHLRRSNK 101

Query: 163 TKAIGVSNFSINNLKDLLASPGNKLTPAANQVEIHPLLPQNE---LINFCKSKKIMIEAY 219
               G S+ ++  L+ +L +   +  P  NQ+++   L +N+   +   C+   I++  Y
Sbjct: 102 ANNRGASSVNVEELRRVLKTEDEE--PQVNQIKLRSSL-RNQTPGISKLCQENDILMAVY 158

Query: 220 SPL 222
           S L
Sbjct: 159 STL 161

>Suva_12.272 Chr12 complement(441543..442262,442266..442340) [795
           bp, 265 aa] {ON} YDL124W (REAL)
          Length = 265

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 52/204 (25%), Positives = 85/204 (41%), Gaps = 38/204 (18%)

Query: 27  TWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNEDQVGQAIKDSGVP-REEIFVTTKLWS- 84
           T+    N     ++  LKAG K IDTA IY + +   +AI +  +P R  I      +S 
Sbjct: 9   TFSLLSNQNSNEIVTVLKAGVKDIDTARIYPDNE---KAIGELQLPDRFTIHTKASGFSG 65

Query: 85  --TQHHEPAKALDESLQRLGLDYVDLYLIHWPARLDTNYIKDGDILSVPTKADGSRAVDV 142
                    K+++ESL  LG+  V+ +L+H P               +P +         
Sbjct: 66  GCLTRDNINKSIEESLSLLGVPSVETFLLHSPDP------------EIPLE--------- 104

Query: 143 TNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDL--LASPGNKLTPAANQVEIHPLL 200
                 +T + +  L + GK +  G+SNFS  ++K +   A   + + P   Q   + L 
Sbjct: 105 ------ETLDAINSLYEQGKFEKFGLSNFSTEDVKRIYDYAKSKDYVLPTVYQGNYNALS 158

Query: 201 PQ--NELINFCKSKKIMIEAYSPL 222
               N+L    K   I + AYSP+
Sbjct: 159 RAIVNDLFPLLKELHISLYAYSPI 182

>NCAS0C02450 Chr3 complement(455582..456613) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 63/292 (21%), Positives = 113/292 (38%), Gaps = 68/292 (23%)

Query: 23  VGLGTWQSKD---------NDAYKSVLAALKAGYKHIDTAAIYRN---EDQVGQAIKDSG 70
           VG  T+ SK+          + +K +      G +  DTA +Y N   E  +G+ +K   
Sbjct: 21  VGCMTYGSKNWANWVLEDKEEIFKILKHCYDNGLRTFDTADVYSNGTSERILGEFLKRFN 80

Query: 71  VPREEIFVTTKLWSTQHHEPAKALDESL-----QRLGLDYVDLYLIHWPARLDTNYIKDG 125
           + RE + + +K++          +DESL      ++  +Y+DL L  +   L+  +I  G
Sbjct: 81  IKRETVVIMSKIFF--------PVDESLDLHQGSKVDQEYIDLQL-SFQQGLNRKHIMAG 131

Query: 126 DILSVPTKADGSRAVDVTNWNFIKTWELMQELPKT-------GKTKAIGVSNFSINNLKD 178
              SV         +D+   + +     M+E+ ++       G+ + IG S+       +
Sbjct: 132 VANSVERLGT---YIDILQIHRLDKEASMEEIMRSLNDVVVSGQVRYIGASSMLATEFAE 188

Query: 179 L-LASPGNKLTPAANQVEIHPLL---PQNELINFCKSKKIMIEAYS---------PLGST 225
           L   +  N      N    + +L    +NELI FCK   + +  +S         P   T
Sbjct: 189 LQFIAKQNGWFQFINVQSYYNVLNREDENELIPFCKKHGVGLTVWSPNARGVLTRPADKT 248

Query: 226 DAPLLKEPTILK-------------------IAKKNNVQPGHVVISWHAQRG 258
              +L +PT +K                   IAKK  +    V ++W   +G
Sbjct: 249 GTRMLSDPTFIKMGLDKLDESDKEIIGVVEAIAKKKGISMAMVSMAWILNKG 300

>Ecym_2296 Chr2 complement(574287..575309) [1023 bp, 340 aa] {ON}
           similar to Ashbya gossypii ABR094W
          Length = 340

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 46/181 (25%), Positives = 73/181 (40%), Gaps = 52/181 (28%)

Query: 19  QIPQVGLGTWQSKDN----DAY-----KSVLAALKAGYKHIDTAAIYRNEDQVG----QA 65
           ++P++ LG     DN    D Y     + +  A+  G   IDT+  Y   + +     Q 
Sbjct: 18  ELPRLILGGATLMDNWYNDDPYSVPTVELLRYAMSRGINAIDTSPYYGPSEIIYGKALQE 77

Query: 66  IKDSGVPREEIFVTTKLWSTQHHE-------PAKALDESLQRLGLDYVDLYLIHWPARLD 118
           IKD   PREE F+ TK+      E          ++  S +RL  DY+DL  +H     D
Sbjct: 78  IKDE-FPREEYFICTKVGRVGRAEFNYSKENVRFSVKRSCERLHTDYLDLVYLH-----D 131

Query: 119 TNYIKDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPK---TGKTKAIGVSNFSINN 175
             Y++                       + K WE ++EL K    G  + IG+S + ++ 
Sbjct: 132 IEYVE-----------------------YDKIWEALRELRKLKDEGVIRHIGISGYPVDL 168

Query: 176 L 176
           L
Sbjct: 169 L 169

>Kpol_400.9 s400 complement(19154..20179) [1026 bp, 341 aa] {ON}
           complement(19154..20179) [1026 nt, 342 aa]
          Length = 341

 Score = 37.7 bits (86), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 70/330 (21%), Positives = 115/330 (34%), Gaps = 100/330 (30%)

Query: 15  NTGAQIPQVGLGT----------WQSKDNDA-YKSVLAALKAGYKHIDTAAIYRN---ED 60
           NTG ++  + +G           W   D +  +K +  A   G +  DTA +Y N   E 
Sbjct: 11  NTGLKVSPIIIGCMSFGSKKWSEWVEDDREKIFKILKYAYDKGLRTYDTANVYSNGESEI 70

Query: 61  QVGQAIKDSGVPREEIFVTTKLWSTQHHE---------PAKALD---------------- 95
            +G+ +K+  +PRE + + TKL+   +           P   L+                
Sbjct: 71  ILGEFLKNYKIPRETVIIMTKLYFPTNDNADYDIFSMTPEAILNNVNITGLSRKNIINSA 130

Query: 96  -ESLQRLGLDYVDLYLIHWPARLDTNYIKDGDILSVPTKADGSRAVDVTNWNFIKTWELM 154
            +S++RLG  Y D+  IH                    +AD           F +T   +
Sbjct: 131 RDSVRRLG-TYADIIQIH--------------------RADPDTP-------FEETMRAL 162

Query: 155 QELPKTGKTKAIGVSNFSINNLKDL-LASPGNKLTPAANQVEIHPLL---PQNELINFCK 210
            ++   G T+ IG S+       ++   +  N      N    + LL    + ELI F K
Sbjct: 163 NDIVVDGLTRYIGASSMLATEFVEMQFIAEKNDWFKFINSQSCYNLLYREDERELIPFAK 222

Query: 211 SKKIMIEAYSPL---------GSTDAPLLKE-------------------PTILKIAKKN 242
              I +  +SPL         G T     K+                     + +IAKK 
Sbjct: 223 RHNIALTPWSPLQRGVLCRPVGETSTRFEKDQFMSIGNIKDINSSDEEIITRVEEIAKKR 282

Query: 243 NVQPGHVVISWHAQRGYVVLPKSVNPDRIE 272
           N +   V + W  Q+G   +      DRI+
Sbjct: 283 NTKMATVALYWVIQKGCFPIVGMSKIDRID 312

>KNAG0M02340 Chr13 complement(431237..432166) [930 bp, 309 aa] {ON}
           Anc_2.604 YMR041C
          Length = 309

 Score = 37.7 bits (86), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 37/156 (23%), Positives = 69/156 (44%), Gaps = 21/156 (13%)

Query: 37  KSVLAALKAGYKHIDTAAIYRN-EDQVGQAIKDSGVPREEIFVTTKLWSTQHHEPAKALD 95
           +  L   +  +  +DT+  Y + E  VGQA+++  +PR EI+V TK+      E     D
Sbjct: 31  RKCLITHRRCFNAVDTSPYYGDSELLVGQALRELQIPRGEIYVCTKVGRVGVSE----FD 86

Query: 96  ESLQ--RLGLDYVDLYLIHWPARLDTNYIKDGDILSVPTKADGSRAVDVTNWNFIKTWEL 153
            S +  R+ +      L+     LD  Y+ D +    P +A             +   + 
Sbjct: 87  YSRENVRMSVMRSVERLVGEGGYLDVVYLHDVEF--QPQEA------------CLAALDE 132

Query: 154 MQELPKTGKTKAIGVSNFSINNLKDLLASPGNKLTP 189
           +Q+L + G  + +GVS + ++ L  L++   +  TP
Sbjct: 133 LQKLKRAGIVRNVGVSGYPLSKLYSLVSLCYDAGTP 168

>Suva_9.17 Chr9 (18179..19105) [927 bp, 308 aa] {ON} YNL331C (REAL)
          Length = 308

 Score = 36.6 bits (83), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 50/206 (24%), Positives = 82/206 (39%), Gaps = 40/206 (19%)

Query: 25  LGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNEDQVGQAIKDSGVP-REEIFVTTKLW 83
           L   Q  D D   ++L   KAG K IDTA IY + +++   I +  +P R  I      +
Sbjct: 14  LNLLQRSDIDEISAILE--KAGVKDIDTARIYPDSEKI---IGELQLPNRFTIHTKASGF 68

Query: 84  S---TQHHEPAKALDESLQRLGLDYVDLYLIHWPARLDTNYIKDGDILSVPTKADGSRAV 140
           S          K+++ESL  LG+  V+ + +H P                    D    +
Sbjct: 69  SGGCLTKDNINKSIEESLSLLGVPSVETFFLHSP--------------------DPETPI 108

Query: 141 DVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDL--LASPGNKLTPAANQVEIHP 198
           +       +T   +  L + GK K  G+SNF+  ++K +   A   N + P   Q   + 
Sbjct: 109 E-------ETLGAINSLYEQGKFKKFGLSNFATEDVKRIYEYAKSKNFVLPTVYQGSYNA 161

Query: 199 L--LPQNELINFCKSKKIMIEAYSPL 222
                +N+L    +       AYSP+
Sbjct: 162 FSRAIENDLFPLLRELHFSFYAYSPI 187

>TBLA0B10110 Chr2 complement(2432572..2433609) [1038 bp, 345 aa]
          {ON} 
          Length = 345

 Score = 36.2 bits (82), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 39/83 (46%), Gaps = 14/83 (16%)

Query: 15 NTGAQIPQVGLGT--WQSKDN---------DAYKSVLAALKAGYKHIDTAAIYRN---ED 60
          NTG +I     GT  + +K N         DAYK +  A   G +  DTA  Y N   E 
Sbjct: 11 NTGLKISPFIFGTMTFGNKKNMQWAIEEMEDAYKILKYAYDRGIRTFDTADAYANGLSET 70

Query: 61 QVGQAIKDSGVPREEIFVTTKLW 83
           +G  +K   +PRE + + TK++
Sbjct: 71 ILGSFLKHYNIPRETVVIMTKVF 93

>Kpol_449.4 s449 (14334..15359) [1026 bp, 341 aa] {ON}
          (14334..15359) [1026 nt, 342 aa]
          Length = 341

 Score = 36.2 bits (82), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 40/82 (48%), Gaps = 14/82 (17%)

Query: 15 NTGAQIPQVGLG-------TW----QSKDNDAYKSVLAALKAGYKHIDTAAIYRN---ED 60
          NTG ++  + +G       TW    Q    +A+K +  A   G +  DTA +Y N   E 
Sbjct: 11 NTGLKVSPLIIGCMSFGSKTWDEWVQDDKEEAFKILKHAYDRGIRSYDTANVYSNGQSEI 70

Query: 61 QVGQAIKDSGVPREEIFVTTKL 82
           +G+ ++   +PRE + + TKL
Sbjct: 71 ILGEFLRKYNIPRETVVIMTKL 92

>Suva_14.10 Chr14 complement(10349..11479) [1131 bp, 376 aa] {ON}
           YNL331C (REAL)
          Length = 376

 Score = 35.8 bits (81), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 49/100 (49%), Gaps = 23/100 (23%)

Query: 35  AYKSVLAALKAGYKHIDTAAIYRNEDQ---VGQAIKDSGVPREEIFVTTKLWSTQH---- 87
           A+K + A  +AG   IDTA  Y+NE     +G+ ++   + R++I + TK  ST +    
Sbjct: 55  AFKLLDAFYEAGGNFIDTANTYQNEQSEAWIGEWMESRKL-RDQIVIATKF-STDYKWYD 112

Query: 88  --------------HEPAKALDESLQRLGLDYVDLYLIHW 113
                         H    ++ +SL++L  D++D+  IHW
Sbjct: 113 VGKNRSANFCGNSKHSLHVSVRDSLRKLQTDWIDILYIHW 152

>YDL243C Chr4 complement(17577..18566) [990 bp, 329 aa] {ON}
           AAD4Putative aryl-alcohol dehydrogenase; involved in
           oxidative stress response; similar to P. chrysosporium
           aryl-alcohol dehydrogenase; expression induced in cells
           treated with the mycotoxin patulin
          Length = 329

 Score = 34.7 bits (78), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 49/99 (49%), Gaps = 21/99 (21%)

Query: 35  AYKSVLAALKAGYKHIDTAAIYRNEDQ---VGQAIKDSGVPREEIFVTTKL--------- 82
           A++ + A  +AG   IDTA  Y+NE+    +G+ +K   + R++I + TK          
Sbjct: 9   AFELLDAFYEAGGNCIDTANSYQNEESEIWIGEWMKSRKL-RDQIVIATKFTGDYKKYEV 67

Query: 83  -------WSTQH-HEPAKALDESLQRLGLDYVDLYLIHW 113
                  +   H H    ++ +SL++L  D++D+  +HW
Sbjct: 68  GGGKSANYCGNHKHSLHVSVRDSLRKLQTDWIDILYVHW 106

>KLLA0B09658g Chr2 complement(837873..838901) [1029 bp, 342 aa] {ON}
           similar to uniprot|Q06494 Saccharomyces cerevisiae
           YPR127W
          Length = 342

 Score = 34.7 bits (78), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 57/266 (21%), Positives = 98/266 (36%), Gaps = 66/266 (24%)

Query: 73  REEIFVTTK----LWSTQHHEPAKALDESLQ---RLGLDYVDLYLIHWPARLDTNYIKDG 125
           RE++ ++ K    L +      AK++  S++   ++   YVD+Y    PARLD   IK  
Sbjct: 81  REKVIISAKGAVDLQTLSPAGDAKSVSASIENTLKVFNGYVDIY---EPARLDLELIKKT 137

Query: 126 DILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDLLASPGN 185
                P +                T++ + E  K GK   I +S  +   ++ +    G 
Sbjct: 138 GESVFPRE----------------TFDTIVEYVKKGKIGGISLSEVTAEQIRAIHKEYGE 181

Query: 186 KLTPAANQVEIHPL-LPQNELINFCKSKKIMIEAYSPLG----------STDAPLLKEPT 234
            L     ++ +    +  N +++ C    + I AYSPLG          S+D P      
Sbjct: 182 YLVCVEVELSMFSAEILSNGIVDTCNELGLPIVAYSPLGRGLLTGALAKSSDIPAGDFRI 241

Query: 235 ILK---------------------IAKK-NNVQPGHVVISW-------HAQRGYVVLPKS 265
            LK                     IAK+ +NV    V I W       +     + +P  
Sbjct: 242 QLKRFQDDAFAHNKSLVEFLENEIIAKRSDNVTLPQVAIGWIRAISKNYPNTKIIPIPSG 301

Query: 266 VNPDRIETNRKIFTLSNEDFEAINNI 291
              D++ +N     LS+E+   I+  
Sbjct: 302 TTVDKVTSNYSFIELSDEELAKIDKF 327

>TBLA0E05040 Chr5 (1303453..1304481) [1029 bp, 342 aa] {ON} 
          Length = 342

 Score = 34.3 bits (77), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 64/315 (20%), Positives = 115/315 (36%), Gaps = 91/315 (28%)

Query: 28  WQSKDNDAYKSVLA-ALKAGYKHIDTAAIYRN---EDQVGQAIKDSGVPREEIFVTTKLW 83
           W   D +    +L  A   G +  DTA +Y N   E  +G+ ++   +PRE + + TK++
Sbjct: 34  WVLDDKEEIFGILKHAYDRGLRTYDTADVYSNGMSETILGEFLRTYNIPRETVVIMTKVF 93

Query: 84  S-----------------------TQHHEPAK----ALDESLQRLGLDYVDLYLIHWPAR 116
                                    Q H   K    A+  S++RLG  Y+D+Y IH   R
Sbjct: 94  FPVDDKMDISSNRTKTEEENLQLINQQHLSRKHILNAVKNSVKRLG-TYIDVYQIH---R 149

Query: 117 LDTNYIKDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNL 176
            D            P               F +T   + ++ + G  + +G S+      
Sbjct: 150 CDH---------ETP---------------FEETMRALNDVVEQGDVRYLGASSMLAVEF 185

Query: 177 KDL-LASPGNKLTPAANQVEIHPLL---PQNELINFCKSKKIMIEAYSPLG--------- 223
            ++   +  +      N    + L+    + E+I FCK   I +  +SP+          
Sbjct: 186 AEMQFIAEKHGWHKFVNMQSCYNLVYREDEREMIPFCKRHGIALTPWSPIQKGLLARPLG 245

Query: 224 ------STDAPLL---------KEPTIL----KIAKKNNVQPGHVVISWHAQRGYVVLPK 264
                 STD  L+          E  I+    K+A K N++   + + W  Q+G + +  
Sbjct: 246 SHTHRESTDGVLIARKLNQFTESEKEIINRVEKLAIKKNLKMVDISLGWVIQKGTLPILG 305

Query: 265 SVNPDRIETNRKIFT 279
             + +R++   K  T
Sbjct: 306 MSSIERVDEAIKTLT 320

>NCAS0C01990 Chr3 (365857..366888) [1032 bp, 343 aa] {ON} Anc_8.565
          Length = 343

 Score = 34.3 bits (77), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 51/220 (23%), Positives = 84/220 (38%), Gaps = 44/220 (20%)

Query: 28  WQSKDNDA-YKSVLAALKAGYKHIDTAAIYRN---EDQVGQAIKDSGVPREEIFVTTKLW 83
           W  +D D  +K +      G +  DTA +Y N   E  VG+ +K   + RE + + TK++
Sbjct: 34  WVMEDKDEIFKILKHCYDRGLRTFDTADVYSNGISERLVGEFLKKYNIKRETVVIMTKIF 93

Query: 84  S------TQHH-----EPAKALDESLQRLGLDYVDLYLIHWPARLDTNYIKDGDILSVPT 132
                    HH     + A  L  +LQR                L   +I DG   SV  
Sbjct: 94  FPVDESLDLHHGSNVNQEAMELQLTLQR---------------GLSRKHIIDGVANSVER 138

Query: 133 KADGSRAVDVTNWNFIKTWELMQELPK-------TGKTKAIGVSNFSINNLKDL-LASPG 184
                  +DV   + +     M+E+ +       +G+ + IG S+       +L   +  
Sbjct: 139 LGT---YIDVLQIHRLDEETSMEEIMRSLNDVVMSGQVRYIGASSMLATEFAELQFIAEK 195

Query: 185 N---KLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSP 221
           N   K   A +   +     + ELI FCK   + +  +SP
Sbjct: 196 NGWFKFISAQSYYNLINREDERELIPFCKKHGVGLIPWSP 235

>KLTH0E16852g Chr5 complement(1496072..1497199) [1128 bp, 375 aa]
           {ON} highly similar to uniprot|P42884 Saccharomyces
           cerevisiae YNL331C
          Length = 375

 Score = 33.9 bits (76), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 32/137 (23%), Positives = 61/137 (44%), Gaps = 36/137 (26%)

Query: 10  KTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAAL-------------KAGYKHIDTAAIY 56
           + LS N G ++  + LG       DA++  L ++             +AG   IDTA  Y
Sbjct: 19  RILSKNAGIRVSPLVLGA--MSIGDAWEETLGSMDKQRSFELLDAFYEAGGNFIDTANNY 76

Query: 57  RN---EDQVGQAIKDSGVPREEIFVTTKL----------------WSTQHHEPAK-ALDE 96
           +N   E+ +G+ +    + R++I + TK                 +S  H    + ++ +
Sbjct: 77  QNGQSEEWIGEWMSSRKI-RDQIVIATKYTSDYKAYQIGKNKSANFSGNHRRSLQLSVRD 135

Query: 97  SLQRLGLDYVDLYLIHW 113
           SL++L  D++D+  +HW
Sbjct: 136 SLRKLQTDWIDILYVHW 152

>KLLA0F19360g Chr6 (1792778..1793812) [1035 bp, 344 aa] {ON}
          highly similar to uniprot|Q02895 Saccharomyces
          cerevisiae YPL088W Putative aryl alcohol dehydrogenase
          transcription is activated by paralogous transcription
          factors Yrm1p and Yrr1p along with genes involved in
          multidrug resistance
          Length = 344

 Score = 33.1 bits (74), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 35/73 (47%), Gaps = 12/73 (16%)

Query: 23 VGLGTWQSKD-----NDAYKSVLAALKAGYKH----IDTAAIYRN---EDQVGQAIKDSG 70
          +G  ++ SKD      D  + + + LK  Y H     DTA  Y N   E  VG+ +K   
Sbjct: 21 IGCMSYGSKDWAAWVEDDKEKIFSTLKYCYDHGLRTFDTADFYSNGLSEKLVGEFLKKYN 80

Query: 71 VPREEIFVTTKLW 83
          + RE + + TK++
Sbjct: 81 IRRETVVILTKVY 93

>KAFR0A05360 Chr1 complement(1056443..1057483) [1041 bp, 346 aa]
           {ON} Anc_3.462 YPR127W
          Length = 346

 Score = 33.1 bits (74), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 32/160 (20%), Positives = 70/160 (43%), Gaps = 31/160 (19%)

Query: 73  REEIFVTTK--------LWSTQHHEPAKALDESLQRLGLDYVDLYLIHWPARLDTNYIKD 124
           R+E+ ++ K        +   ++ +   +++  ++ +G  Y+DL+ +   ARLD + IK 
Sbjct: 82  RKEVIISCKGGINNQTFMSEGKYDDVITSVENCIREIG-GYIDLFEV---ARLDESLIKA 137

Query: 125 GDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDLLASPG 184
           G+    P +                ++E + +L   G    I +S  +   ++ +    G
Sbjct: 138 GE--EYPRE----------------SFEALAKLVDGGLIGGISLSEVTSPQIRAIAKDFG 179

Query: 185 NKLTPAANQVEIHPL-LPQNELINFCKSKKIMIEAYSPLG 223
             LT    ++ +  L + +N++   C    ++I  YSPLG
Sbjct: 180 KYLTCVEVELSLFSLNIFENDVAKACSDLNLIIICYSPLG 219

>NCAS0A12950 Chr1 complement(2551851..2552822) [972 bp, 323 aa] {ON}
           Anc_2.604 YMR041C
          Length = 323

 Score = 32.7 bits (73), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 39/82 (47%), Gaps = 10/82 (12%)

Query: 41  AALKAGYKHIDTAAIYRN-EDQVGQAIKDSG--VPREEIFVTTKL-------WSTQHHEP 90
            A + G   IDT+  Y N E  +G+A+ + G   PR+   + TK+       +       
Sbjct: 32  VAFENGINCIDTSPYYGNSEILIGKALHNLGDKFPRDSYLICTKVGRLSLDSFDYSADNV 91

Query: 91  AKALDESLQRLGLDYVDLYLIH 112
            +++  S +RL  DY+DL  +H
Sbjct: 92  RRSVVRSCKRLNSDYLDLVYLH 113

>Ecym_6068 Chr6 (126754..129762) [3009 bp, 1002 aa] {ON} similar to
           Ashbya gossypii ADR241C
          Length = 1002

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 61/130 (46%), Gaps = 23/130 (17%)

Query: 52  TAAIYRNEDQVGQAIKDSGVPREEIFVTTKLWSTQHHEPA-------KALDESLQRLGLD 104
            A+ Y   DQ+   + D GVP E+I   TK  S +H++ A       K LD       L+
Sbjct: 769 VASHYIYLDQIVARLCDDGVPAEDI--NTKYSSIRHYKFALEKVLSKKVLDNEPLDGILE 826

Query: 105 YVDLYLIHWPARLDTNYIKDGDILSVPTKADGSRAVDVTNWNF------IKTWELMQELP 158
            +D+Y       L+ ++ K  ++  +   ++  R V+  +WN+      +   +L++E  
Sbjct: 827 LIDVY------DLEGHHHK--NVAKLEIVSNCLRKVETKHWNYLFQNLNLTPRDLLKECT 878

Query: 159 KTGKTKAIGV 168
           + G+ K +GV
Sbjct: 879 ENGEAKILGV 888

>ZYRO0F00858g Chr6 (68107..69147) [1041 bp, 346 aa] {ON} similar to
           uniprot|Q04212 Saccharomyces cerevisiae YMR041C
           Hypothetical ORF
          Length = 346

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 45/99 (45%), Gaps = 16/99 (16%)

Query: 29  QSKDNDAYKSVLAALKAGYKH----IDTAAIYR-NEDQVGQA---IKDSGVPREEIFVTT 80
           Q  D+     ++  LK G+ H    IDT+  Y  +E   GQA   I+D   PR   ++ T
Sbjct: 32  QYNDDPTKVPLVDMLKHGFNHGIRAIDTSPYYGPSEILYGQALEHIRDE-FPRNSYYICT 90

Query: 81  KLWSTQHHEPAKALDE-------SLQRLGLDYVDLYLIH 112
           K+   Q  E   + +        S QRL  DY+DL  +H
Sbjct: 91  KVGRIQLDEFDYSREHVRFSVLRSCQRLKTDYLDLVYLH 129

>Smik_14.1 Chr14 complement(607..1737) [1131 bp, 376 aa] {ON}
           YNL331C (REAL)
          Length = 376

 Score = 32.0 bits (71), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 47/99 (47%), Gaps = 21/99 (21%)

Query: 35  AYKSVLAALKAGYKHIDTAAIYRNEDQ---VGQAIKDSGVPREEIFVTTKL--------- 82
           A++ + A  +AG   +DTA  Y+NE     +G+ +K   V R++I + TK          
Sbjct: 55  AFELLDAFYEAGGNCVDTANSYQNEQSETWIGEWMKLRKV-RDQIVICTKYTGDYKKYEA 113

Query: 83  -------WSTQHHEPAK-ALDESLQRLGLDYVDLYLIHW 113
                  +   H      ++ +SL++L  D++D+  IHW
Sbjct: 114 GDGKSANYCGNHRRSLHVSVRDSLRKLQTDWIDILYIHW 152

>Skud_10.383 Chr10 (684416..685546) [1131 bp, 376 aa] {ON} YNL331C
           (REAL)
          Length = 376

 Score = 32.0 bits (71), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 45/99 (45%), Gaps = 21/99 (21%)

Query: 35  AYKSVLAALKAGYKHIDTAAIYRNEDQ---VGQAIKDSGVPREEIFVTTKL--------- 82
           A++ + A  +AG   IDTA  Y+NE     +G+ +    + R++I + TK          
Sbjct: 55  AFELLDAFFEAGGNFIDTANNYQNEQSEAWIGEWMVSRKL-RDQIVIATKFTTDYKKYEV 113

Query: 83  --------WSTQHHEPAKALDESLQRLGLDYVDLYLIHW 113
                        H    ++ +SL++L  D++D+  +HW
Sbjct: 114 GKGRSANFCGNHKHSLHVSVRDSLRKLQTDWIDILYVHW 152

>YNL331C Chr14 complement(16118..17248) [1131 bp, 376 aa] {ON}
           AAD14Putative aryl-alcohol dehydrogenase; similar to P.
           chrysosporium aryl-alcohol dehydrogenase; mutational
           analysis has not yet revealed a physiological role
          Length = 376

 Score = 32.0 bits (71), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 54/118 (45%), Gaps = 22/118 (18%)

Query: 17  GAQIPQVGLGTWQSKDND-AYKSVLAALKAGYKHIDTAAIYRNEDQ---VGQAIKDSGVP 72
           GA I     G   S + + A++ + A  +AG   IDTA  Y+NE+    +G+ +    + 
Sbjct: 36  GASIGDAWSGFMGSMNKEQAFELLDAFYEAGGNCIDTANSYQNEESEIWIGEWMASRKL- 94

Query: 73  REEIFVTTKL----------------WSTQHHEPAK-ALDESLQRLGLDYVDLYLIHW 113
           R++I + TK                 +   H      ++ +SL++L  D++D+  IHW
Sbjct: 95  RDQIVIATKFTGDYKKYEVGGGKSANYCGNHKRSLHVSVRDSLRKLQTDWIDILYIHW 152

>Smik_3.210 Chr3 (309527..310615) [1089 bp, 362 aa] {ON} YNL331C
           (REAL)
          Length = 362

 Score = 31.6 bits (70), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 32/131 (24%), Positives = 57/131 (43%), Gaps = 28/131 (21%)

Query: 10  KTLSLNTGAQIPQVGLGTWQSKD-------NDAYKSVLAALKAGYKHIDTAAIYRNE--- 59
           + LS   G  +  + LG   S D         A+K + A  KAG   ID A  Y NE   
Sbjct: 19  RVLSKTAGIGVSPLVLGATTSSDFLDSMNKKRAFKLLDAFNKAGGNFIDAANNYENEQWD 78

Query: 60  DQVGQAIKDSGVPREEIFVTTKLWS---------------TQHHEPA--KALDESLQRLG 102
           + +G+ ++   + R++I + TK                    +H+P+   ++ +SL +L 
Sbjct: 79  EWIGEWMESRKL-RDKIVICTKYAGDYKRCEAAQGKSANYCGYHQPSLRVSVRDSLHKLK 137

Query: 103 LDYVDLYLIHW 113
            D++D+  + W
Sbjct: 138 TDWIDILYVQW 148

>Suva_5.207 Chr5 complement(314580..316883) [2304 bp, 767 aa] {ON}
           YER091C (REAL)
          Length = 767

 Score = 32.0 bits (71), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 45/194 (23%), Positives = 77/194 (39%), Gaps = 16/194 (8%)

Query: 39  VLAALKAGYKHIDTAAIYRNEDQVGQAIKDSGVPREEIFVTTKLWSTQHHEPAKALDESL 98
           V+  L     H+D A   +  D V  AI D       I     +W     + +  +++++
Sbjct: 262 VIKGLPVSALHVDFARAPQQFDDVIAAIGDKQTLSVGIVDGRNIWKNDFKKSSAFVNKAI 321

Query: 99  QRLGLDYVDLY----LIHWPARLDTNYIKDGDI---LSVPTKADGSRAV---DVTNWNFI 148
           ++LG D V +     L+H P  L      D +I    S  T+      V   +V+  +  
Sbjct: 322 EKLGADRVVVATSSSLLHTPVDLTNETKLDAEIKGFFSFATQKLDEVVVITKNVSGQDVA 381

Query: 149 KTWEL-MQELPKTGKTKAIGVSNF-----SINNLKDLLASPGNKLTPAANQVEIHPLLPQ 202
              E   + +   GK+K I  S+      SI+      ASP  +  P   ++   PL P 
Sbjct: 382 AALEANAKSVESRGKSKLIHDSSVKARVASIDQKMSTRASPFEQRLPEQKKIFNLPLFPT 441

Query: 203 NELINFCKSKKIMI 216
             + +F ++K I I
Sbjct: 442 TTIGSFPQTKDIRI 455

>Smik_79.1 Chr79 complement(3..761) [759 bp, 253 aa] {ON} YNL331C
           (REAL)
          Length = 253

 Score = 31.2 bits (69), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 32/131 (24%), Positives = 57/131 (43%), Gaps = 28/131 (21%)

Query: 10  KTLSLNTGAQIPQVGLGTWQSKD-------NDAYKSVLAALKAGYKHIDTAAIYRNE--- 59
           + LS   G  +  + LG   S D         A+K + A  KAG   ID A  Y NE   
Sbjct: 19  RVLSKTAGIGVSPLVLGATTSSDFLDSMNKKRAFKLLDAFNKAGGNFIDAANNYENEQWD 78

Query: 60  DQVGQAIKDSGVPREEIFVTTKLWS---------------TQHHEPA--KALDESLQRLG 102
           + +G+ ++   + R++I + TK                    +H+P+   ++ +SL +L 
Sbjct: 79  EWIGEWMESRKL-RDKIVICTKYAGDYKRCEAAQGKSANYCGYHQPSLRVSVRDSLHKLK 137

Query: 103 LDYVDLYLIHW 113
            D++D+  + W
Sbjct: 138 TDWIDILYVQW 148

>KAFR0F03890 Chr6 complement(761303..762262) [960 bp, 319 aa] {ON} 
          Length = 319

 Score = 30.4 bits (67), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 47/217 (21%), Positives = 86/217 (39%), Gaps = 39/217 (17%)

Query: 28  WQSKDND-AYKSVLAALKAGYKHIDTAAIYRN---EDQVGQAIKDSGVPREEIFVTTKLW 83
           W  +D +  + ++      G +  DTA  Y N   E  +G+ +K   + RE + + TK++
Sbjct: 11  WVEEDKEKVFNTLKYCYDKGLRTFDTADYYSNGYSEILLGEFLKKYKIKRETVVILTKIF 70

Query: 84  STQHHEPAKALDESLQRLGLDYVDLYLIHWPARLDTNYIKDGDILSVPTKADG-SRAVDV 142
                     +DE+L        DL+L   P  +D   + +   LS     DG  R+V+ 
Sbjct: 71  F--------PVDETL--------DLHLGEEPIGVDQLDVVNQRGLSRKHIVDGVKRSVER 114

Query: 143 --TNWNFIKTWELMQELP------------KTGKTKAIGVSNFSINNLKDL-LASPGNKL 187
             T  + ++     Q+ P            + G  + IG S+       ++   +   + 
Sbjct: 115 LGTYIDVLQIHRFDQDTPIKERMKALNDVVEKGHVRYIGASSMLATEFAEMQFVAEKYEW 174

Query: 188 TPAANQVEIHPLL---PQNELINFCKSKKIMIEAYSP 221
               N   ++ L+    + ELI FCK   I +  +SP
Sbjct: 175 FQFVNSQSLYNLIYREDERELIPFCKRHNIALTPWSP 211

>NDAI0B00930 Chr2 (215394..218216) [2823 bp, 940 aa] {ON} Anc_5.76
           YGR250C
          Length = 940

 Score = 30.4 bits (67), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 31/73 (42%), Gaps = 15/73 (20%)

Query: 151 WELMQELPKTGKTKAIGVSNFSINNLKDLLASPGNKLTPAANQV---------------E 195
           W  ++E    GK K I + NF INN+K       NK     N+                E
Sbjct: 291 WNQLRENNDDGKFKCIFIGNFPINNMKQESGETENKDKSITNEFNYRITPEIIIEKIKSE 350

Query: 196 IHPLLPQNELINF 208
           + PL+P  E++++
Sbjct: 351 LLPLIPDFEILSY 363

>YFL056C Chr6 complement(14793..15431) [639 bp, 212 aa] {ON}
           AAD6Putative aryl-alcohol dehydrogenase; involved in
           oxidative stress response; similar to P. chrysosporium
           aryl-alcohol dehydrogenase; expression induced in cells
           treated with the mycotoxin patulin
          Length = 212

 Score = 29.6 bits (65), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 46/99 (46%), Gaps = 21/99 (21%)

Query: 35  AYKSVLAALKAGYKHIDTAAIYRNEDQ---VGQAIKDSGVPREEIFVTTKL--------- 82
           A++ + A  +AG   IDTA  Y+NE     +G+ +    + R++I + TK          
Sbjct: 55  AFELLDAFYEAGGNFIDTANNYQNEQSEAWIGEWMVSRKL-RDQIVIATKFTTDYKKYDV 113

Query: 83  -------WSTQHHEPAK-ALDESLQRLGLDYVDLYLIHW 113
                  +   H      ++ +SL++L  D++D+  +HW
Sbjct: 114 GGGKSANYCGNHKRSLHVSVRDSLRKLQTDWIDILYVHW 152

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.131    0.387 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 35,644,678
Number of extensions: 1606717
Number of successful extensions: 3733
Number of sequences better than 10.0: 155
Number of HSP's gapped: 3428
Number of HSP's successfully gapped: 161
Length of query: 312
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 203
Effective length of database: 40,982,805
Effective search space: 8319509415
Effective search space used: 8319509415
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 65 (29.6 bits)