Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_15.2975.432ON48645422480.0
Skud_15.2825.432ON48545421220.0
YOR119C (RIO1)5.432ON48445420510.0
Suva_8.1725.432ON48645420400.0
NCAS0F033605.432ON50948816460.0
KAFR0E039205.432ON49741316170.0
SAKL0G02486g5.432ON50040016090.0
KNAG0C049305.432ON49646816050.0
CAGL0L11594g5.432ON50747616000.0
Kpol_1062.315.432ON51342615960.0
KLTH0F16104g5.432ON54046015810.0
Kwal_55.214335.432ON47640015650.0
KLLA0E21121g5.432ON52642215650.0
TDEL0E019305.432ON50238915620.0
TBLA0A037605.432ON50441015610.0
TPHA0E017805.432ON50842015440.0
AER257W5.432ON47746215370.0
NDAI0B056505.432ON46238214880.0
Ecym_47635.432ON53846714900.0
ZYRO0F09988g5.432ON46039413490.0
NCAS0G015802.44ON4242351402e-08
TPHA0H009202.44ON4292321365e-08
Suva_14.1362.44ON4262331365e-08
CAGL0H08019g2.44ON4252341356e-08
Smik_14.1252.44ON4202321302e-07
NDAI0F036002.44ON4212321276e-07
KAFR0A077602.44ON4252351269e-07
Skud_14.1292.44ON4252321222e-06
ZYRO0C10340g2.44ON4162331188e-06
Kwal_23.45632.44ON4252631171e-05
Ecym_64492.44ON4172341161e-05
TDEL0A008602.44ON4192321161e-05
YNL207W (RIO2)2.44ON4252321161e-05
SAKL0E13552g2.44ON4192321152e-05
Kpol_400.72.44ON4252321152e-05
KLLA0D19008g2.44ON4222351142e-05
ABL166W2.44ON4142361142e-05
KNAG0F010602.44ON4282341143e-05
KLTH0B07722g2.44ON4282361043e-04
KLLA0F15576g5.200ON51264790.43
Ecym_11191.104ON79149751.3
TBLA0G003702.44ON444187722.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_15.297
         (486 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_15.297 Chr15 complement(509934..511394) [1461 bp, 486 aa] {...   870   0.0  
Skud_15.282 Chr15 complement(505219..506676) [1458 bp, 485 aa] {...   822   0.0  
YOR119C Chr15 complement(548792..550246) [1455 bp, 484 aa] {ON} ...   794   0.0  
Suva_8.172 Chr8 complement(306553..308013) [1461 bp, 486 aa] {ON...   790   0.0  
NCAS0F03360 Chr6 complement(679314..680843) [1530 bp, 509 aa] {O...   638   0.0  
KAFR0E03920 Chr5 complement(775345..776838) [1494 bp, 497 aa] {O...   627   0.0  
SAKL0G02486g Chr7 complement(206119..207621) [1503 bp, 500 aa] {...   624   0.0  
KNAG0C04930 Chr3 (951832..953322) [1491 bp, 496 aa] {ON} Anc_5.4...   622   0.0  
CAGL0L11594g Chr12 (1239169..1240692) [1524 bp, 507 aa] {ON} hig...   620   0.0  
Kpol_1062.31 s1062 (67759..69300) [1542 bp, 513 aa] {ON} (67759....   619   0.0  
KLTH0F16104g Chr6 (1306436..1308058) [1623 bp, 540 aa] {ON} simi...   613   0.0  
Kwal_55.21433 s55 (835062..836492) [1431 bp, 476 aa] {ON} YOR119...   607   0.0  
KLLA0E21121g Chr5 (1886452..1888032) [1581 bp, 526 aa] {ON} simi...   607   0.0  
TDEL0E01930 Chr5 (363913..365421) [1509 bp, 502 aa] {ON} Anc_5.4...   606   0.0  
TBLA0A03760 Chr1 complement(938917..940431) [1515 bp, 504 aa] {O...   605   0.0  
TPHA0E01780 Chr5 (357819..359345) [1527 bp, 508 aa] {ON} Anc_5.4...   599   0.0  
AER257W Chr5 (1110411..1111844) [1434 bp, 477 aa] {ON} Syntenic ...   596   0.0  
NDAI0B05650 Chr2 complement(1380239..1381627) [1389 bp, 462 aa] ...   577   0.0  
Ecym_4763 Chr4 (1483168..1484784) [1617 bp, 538 aa] {ON} similar...   578   0.0  
ZYRO0F09988g Chr6 complement(811306..812688) [1383 bp, 460 aa] {...   524   0.0  
NCAS0G01580 Chr7 (281438..282712) [1275 bp, 424 aa] {ON} Anc_2.44      59   2e-08
TPHA0H00920 Chr8 complement(188834..190123) [1290 bp, 429 aa] {O...    57   5e-08
Suva_14.136 Chr14 (250349..251629) [1281 bp, 426 aa] {ON} YNL207...    57   5e-08
CAGL0H08019g Chr8 (781773..783050) [1278 bp, 425 aa] {ON} highly...    57   6e-08
Smik_14.125 Chr14 (234660..235922) [1263 bp, 420 aa] {ON} YNL207...    55   2e-07
NDAI0F03600 Chr6 complement(860282..861547) [1266 bp, 421 aa] {O...    54   6e-07
KAFR0A07760 Chr1 complement(1560351..1561628) [1278 bp, 425 aa] ...    53   9e-07
Skud_14.129 Chr14 (244224..245501) [1278 bp, 425 aa] {ON} YNL207...    52   2e-06
ZYRO0C10340g Chr3 complement(793323..794573) [1251 bp, 416 aa] {...    50   8e-06
Kwal_23.4563 s23 (768125..769402) [1278 bp, 425 aa] {ON} YNL207W...    50   1e-05
Ecym_6449 Chr6 complement(873295..874548) [1254 bp, 417 aa] {ON}...    49   1e-05
TDEL0A00860 Chr1 (143723..144982) [1260 bp, 419 aa] {ON} Anc_2.4...    49   1e-05
YNL207W Chr14 (255353..256630) [1278 bp, 425 aa] {ON}  RIO2Essen...    49   1e-05
SAKL0E13552g Chr5 complement(1118842..1120101) [1260 bp, 419 aa]...    49   2e-05
Kpol_400.7 s400 complement(15841..17118) [1278 bp, 425 aa] {ON} ...    49   2e-05
KLLA0D19008g Chr4 complement(1598807..1600075) [1269 bp, 422 aa]...    49   2e-05
ABL166W Chr2 (88546..89790) [1245 bp, 414 aa] {ON} Syntenic homo...    49   2e-05
KNAG0F01060 Chr6 (188811..190097) [1287 bp, 428 aa] {ON} Anc_2.4...    49   3e-05
KLTH0B07722g Chr2 complement(625231..626517) [1287 bp, 428 aa] {...    45   3e-04
KLLA0F15576g Chr6 (1437595..1439133) [1539 bp, 512 aa] {ON} simi...    35   0.43 
Ecym_1119 Chr1 complement(244327..246702) [2376 bp, 791 aa] {ON}...    33   1.3  
TBLA0G00370 Chr7 (72205..73539) [1335 bp, 444 aa] {ON} Anc_2.44 ...    32   2.6  

>Smik_15.297 Chr15 complement(509934..511394) [1461 bp, 486 aa] {ON}
           YOR119C (REAL)
          Length = 486

 Score =  870 bits (2248), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/454 (93%), Positives = 426/454 (93%)

Query: 1   MSLEDNFDKLTVSQRASDHINNQLLEKYSHKIKTDELSFNRAKTSKDKANRATVENVLDP 60
           MSLEDNFDKLTVSQRASDHINNQLLEKYSHKIKTDELSFNRAKTSKDKANRATVENVLDP
Sbjct: 1   MSLEDNFDKLTVSQRASDHINNQLLEKYSHKIKTDELSFNRAKTSKDKANRATVENVLDP 60

Query: 61  RTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGKYEVLETDGPRP 120
           RTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGKYEVLETDGPRP
Sbjct: 61  RTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGKYEVLETDGPRP 120

Query: 121 EYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVI 180
           EYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVI
Sbjct: 121 EYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVI 180

Query: 181 PAPKPIEVKNNVLVMEFLSRGNGFASPKLKDYPYRDRGEIFHYYYTMVAYMRLLYQVCRL 240
           PAPKPIEVKNNVLVMEFLSRGNGFASPKLKDYPYRDRGEIFHYYYTMVAYMRLLYQVCRL
Sbjct: 181 PAPKPIEVKNNVLVMEFLSRGNGFASPKLKDYPYRDRGEIFHYYYTMVAYMRLLYQVCRL 240

Query: 241 VHADLSEYNTIIHDDKLFMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGISIFPERV 300
           VHADLSEYNTIIHDDKLFMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGISIFPERV
Sbjct: 241 VHADLSEYNTIIHDDKLFMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGISIFPERV 300

Query: 301 IFQFVISESLEKFKDDYHNVTDLVGYIAKNLPIKSTEQDEAEDEIFRSLHLVRSLGGLEE 360
           IFQFVISESLEKFKDDYHNVTDLVGYIAKNLPIKSTEQDEAEDEIFRSLHLVRSLGGLEE
Sbjct: 301 IFQFVISESLEKFKDDYHNVTDLVGYIAKNLPIKSTEQDEAEDEIFRSLHLVRSLGGLEE 360

Query: 361 RDFDRYTDGKFDLLKSLIAHDNERNFAASEQFEFDNADHTXXXXXXXXXXXXXXXXXXXX 420
           RDFDRYTDGKFDLLKSLIAHDNERNFAASEQFEFDNADHT                    
Sbjct: 361 RDFDRYTDGKFDLLKSLIAHDNERNFAASEQFEFDNADHTSGSGSEEFSDDEDDSSENDK 420

Query: 421 XXXXXXXXCAYYEDDEPKILKGKRYEDKDVKKLR 454
                   CAYYEDDEPKILKGKRYEDKDVKKLR
Sbjct: 421 EGNEESDDCAYYEDDEPKILKGKRYEDKDVKKLR 454

>Skud_15.282 Chr15 complement(505219..506676) [1458 bp, 485 aa] {ON}
           YOR119C (REAL)
          Length = 485

 Score =  822 bits (2122), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/454 (88%), Positives = 417/454 (91%), Gaps = 1/454 (0%)

Query: 1   MSLEDNFDKLTVSQRASDHINNQLLEKYSHKIKTDELSFNRAKTSKDKANRATVENVLDP 60
           MSLED FD+LTVSQRASDHINNQLLEKYSHKIKTDELSF++AKTSKDKANRATVENVLDP
Sbjct: 1   MSLEDRFDRLTVSQRASDHINNQLLEKYSHKIKTDELSFSKAKTSKDKANRATVENVLDP 60

Query: 61  RTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGKYEVLETDGPRP 120
           RTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETG+YEVLETDG R 
Sbjct: 61  RTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGQYEVLETDGLRK 120

Query: 121 EYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVI 180
           EYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRI+QSGVI
Sbjct: 121 EYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIHQSGVI 180

Query: 181 PAPKPIEVKNNVLVMEFLSRGNGFASPKLKDYPYRDRGEIFHYYYTMVAYMRLLYQVCRL 240
           PAP+P+EVKNNVLVMEFLSRGNGFASPKL+DYPYRDR EIFHYY+TMVAYMRLLYQVCRL
Sbjct: 181 PAPRPVEVKNNVLVMEFLSRGNGFASPKLRDYPYRDREEIFHYYHTMVAYMRLLYQVCRL 240

Query: 241 VHADLSEYNTIIHDDKLFMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGISIFPERV 300
           VHADLSEYNTIIH+DKL+MIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMG+SIFPERV
Sbjct: 241 VHADLSEYNTIIHNDKLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGVSIFPERV 300

Query: 301 IFQFVISESLEKFKDDYHNVTDLVGYIAKNLPIKSTEQDEAEDEIFRSLHLVRSLGGLEE 360
           IFQFVISESLEKFK DYHNV DLVGYIAKNLPIKSTEQDEAEDEIFRSLHLVRSLGGLEE
Sbjct: 301 IFQFVISESLEKFKGDYHNVIDLVGYIAKNLPIKSTEQDEAEDEIFRSLHLVRSLGGLEE 360

Query: 361 RDFDRYTDGKFDLLKSLIAHDNERNFAASEQFEFDNADHTXXXXXXXXXXXXXXXXXXXX 420
           RDFDRYTDGKFDLLKSLIAHDNERNFAASEQFEFDNADH                     
Sbjct: 361 RDFDRYTDGKFDLLKSLIAHDNERNFAASEQFEFDNADHESSSDLEESSDEEGDNSSGGE 420

Query: 421 XXXXXXXXCAYYEDDEPKILKGKRYEDKDVKKLR 454
                     YYEDDEPKILKGK+YEDKD+KKLR
Sbjct: 421 EDEESDDR-EYYEDDEPKILKGKKYEDKDIKKLR 453

>YOR119C Chr15 complement(548792..550246) [1455 bp, 484 aa] {ON}
           RIO1Essential serine kinase involved in cell cycle
           progression and processing of the 20S pre-rRNA into
           mature 18S rRNA
          Length = 484

 Score =  794 bits (2051), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/454 (86%), Positives = 408/454 (89%), Gaps = 2/454 (0%)

Query: 1   MSLEDNFDKLTVSQRASDHINNQLLEKYSHKIKTDELSFNRAKTSKDKANRATVENVLDP 60
           MSLED FD L+VSQ ASDHINNQLLEKYSHKIKTDELSF+RAKTSKDKANRATVENVLDP
Sbjct: 1   MSLEDKFDSLSVSQGASDHINNQLLEKYSHKIKTDELSFSRAKTSKDKANRATVENVLDP 60

Query: 61  RTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGKYEVLETDGPRP 120
           RTMRFLKSMV RGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETG+YEVLETDG R 
Sbjct: 61  RTMRFLKSMVTRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGQYEVLETDGSRA 120

Query: 121 EYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVI 180
           EYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVI
Sbjct: 121 EYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVI 180

Query: 181 PAPKPIEVKNNVLVMEFLSRGNGFASPKLKDYPYRDRGEIFHYYYTMVAYMRLLYQVCRL 240
           PAPKPIEVKNNVLVMEFLSRGNGFASPKLKDYPY++R EIFHYY+TMVAYMRLLYQVCRL
Sbjct: 181 PAPKPIEVKNNVLVMEFLSRGNGFASPKLKDYPYKNRDEIFHYYHTMVAYMRLLYQVCRL 240

Query: 241 VHADLSEYNTIIHDDKLFMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGISIFPERV 300
           VHADLSEYNTI+HDDKL+MIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGISIFPERV
Sbjct: 241 VHADLSEYNTIVHDDKLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGISIFPERV 300

Query: 301 IFQFVISESLEKFKDDYHNVTDLVGYIAKNLPIKSTEQDEAEDEIFRSLHLVRSLGGLEE 360
           IFQFVISE+LEKFK DY+N++ LV YIA NLPIKSTEQDEAEDEIFRSLHLVRSLGGLEE
Sbjct: 301 IFQFVISETLEKFKGDYNNISALVAYIASNLPIKSTEQDEAEDEIFRSLHLVRSLGGLEE 360

Query: 361 RDFDRYTDGKFDLLKSLIAHDNERNFAASEQFEFDNADHTXXXXXXXXXXXXXXXXXXXX 420
           RDFDRYTDGKFDLLKSLIAHDNERNFAASEQFEFDNADH                     
Sbjct: 361 RDFDRYTDGKFDLLKSLIAHDNERNFAASEQFEFDNADHECSSGTEEFSDDEEDGSSGSE 420

Query: 421 XXXXXXXXCAYYEDDEPKILKGKRYEDKDVKKLR 454
                       +  EPK+LKGK++EDKD+KKLR
Sbjct: 421 EDDEEEGEYYDDD--EPKVLKGKKHEDKDLKKLR 452

>Suva_8.172 Chr8 complement(306553..308013) [1461 bp, 486 aa] {ON}
           YOR119C (REAL)
          Length = 486

 Score =  790 bits (2040), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/454 (86%), Positives = 413/454 (90%)

Query: 1   MSLEDNFDKLTVSQRASDHINNQLLEKYSHKIKTDELSFNRAKTSKDKANRATVENVLDP 60
           MS ED F+KLTVSQRASDHINNQLL+K+SHKIKTDELSF++AKTSKDK+NRATVENVLDP
Sbjct: 1   MSFEDKFEKLTVSQRASDHINNQLLDKFSHKIKTDELSFSKAKTSKDKSNRATVENVLDP 60

Query: 61  RTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGKYEVLETDGPRP 120
           RTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPV+DEETGKYEVLETDG R 
Sbjct: 61  RTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVVDEETGKYEVLETDGLRA 120

Query: 121 EYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVI 180
           EYAIKIYKTSILVFKDRE+YVDGEFRFRN+RSQHNPRKMIKIWAEKEFRNLKRI+QSGVI
Sbjct: 121 EYAIKIYKTSILVFKDREKYVDGEFRFRNARSQHNPRKMIKIWAEKEFRNLKRIHQSGVI 180

Query: 181 PAPKPIEVKNNVLVMEFLSRGNGFASPKLKDYPYRDRGEIFHYYYTMVAYMRLLYQVCRL 240
           PAPKP+EVKNNVLVMEFLSRG+GFASPKLKDYPY+DR EIFHYYYTMVAYMRLLYQVCRL
Sbjct: 181 PAPKPVEVKNNVLVMEFLSRGDGFASPKLKDYPYKDREEIFHYYYTMVAYMRLLYQVCRL 240

Query: 241 VHADLSEYNTIIHDDKLFMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGISIFPERV 300
           VHADLSEYNTIIHDD+L+MIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGI+IFPERV
Sbjct: 241 VHADLSEYNTIIHDDQLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGINIFPERV 300

Query: 301 IFQFVISESLEKFKDDYHNVTDLVGYIAKNLPIKSTEQDEAEDEIFRSLHLVRSLGGLEE 360
           IFQFVISE LEKFK DY NV DL+GYI+KNLPIKSTEQDEAEDEIFRSLHLVRSLGGLEE
Sbjct: 301 IFQFVISEVLEKFKGDYKNVPDLIGYISKNLPIKSTEQDEAEDEIFRSLHLVRSLGGLEE 360

Query: 361 RDFDRYTDGKFDLLKSLIAHDNERNFAASEQFEFDNADHTXXXXXXXXXXXXXXXXXXXX 420
           RDFDRYTDGKFDLLKSLIAHDNERNFAASEQFEF++ DH                     
Sbjct: 361 RDFDRYTDGKFDLLKSLIAHDNERNFAASEQFEFNDNDHGSAPESEESSGSEYEDLSGSE 420

Query: 421 XXXXXXXXCAYYEDDEPKILKGKRYEDKDVKKLR 454
                     YY+DDEPKILKGK+YEDKDVKKLR
Sbjct: 421 EDEDDSDDSEYYDDDEPKILKGKKYEDKDVKKLR 454

>NCAS0F03360 Chr6 complement(679314..680843) [1530 bp, 509 aa] {ON}
           Anc_5.432 YOR119C
          Length = 509

 Score =  638 bits (1646), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/488 (66%), Positives = 371/488 (76%), Gaps = 45/488 (9%)

Query: 1   MSLEDNFDKLTVSQRA-SDHINNQLLEKYSHKIKTDELSFNRAKTSKDKANRATVENVLD 59
           MSLED FD+L +S    ++H NN++L+KY HK KTDE+SF R+KT+KDKANRATVENVLD
Sbjct: 1   MSLEDKFDRLNISNEPRTEHANNKILDKYEHKFKTDEMSFTRSKTNKDKANRATVENVLD 60

Query: 60  PRTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGK--APVIDEETGKY------- 110
           PRTMRFLK++ +RGVI+D NGCLSTGKEANVYHAFAG  K  A V+ E   +        
Sbjct: 61  PRTMRFLKALTSRGVISDFNGCLSTGKEANVYHAFAGDSKLHADVVLEAKEEEDEDEDEN 120

Query: 111 --------------EVLETD----------GPRPEYAIKIYKTSILVFKDRERYVDGEFR 146
                         E LET+            + EYA+KI+KTSILVFKDRERYVDGEFR
Sbjct: 121 EEDEDDLPIDHNLKEKLETELRPEMLTKVSQDKKEYAVKIFKTSILVFKDRERYVDGEFR 180

Query: 147 FRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVIPAPKPIEVKNNVLVMEFLSRGNGFAS 206
           FRNSRSQHNPRKMIKIWAEKEFRNL+RIYQSGVIP PKPIEVKNNVLVMEFL RG+GFAS
Sbjct: 181 FRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSGVIPVPKPIEVKNNVLVMEFLGRGDGFAS 240

Query: 207 PKLKDYPYRDRGEIFHYYYTMVAYMRLLYQVCRLVHADLSEYNTIIHDDKLFMIDVSQSV 266
           P+LKD+PY+DR EIFHYY+T+VAYMRL+YQ+CRLVHADLSEYN +IH DK+++IDVSQSV
Sbjct: 241 PRLKDHPYKDREEIFHYYHTIVAYMRLMYQICRLVHADLSEYNILIHKDKMYIIDVSQSV 300

Query: 267 EPEHPMSLDFLRMDIKNVNLYFEKMGISIFPERVIFQFVISESLEKFKDDYHNVTDLVGY 326
           EPEHPMSLDFLRMDIKN+N YFEKMGI IFPERVIFQF+IS++LE F  DY +  DL  Y
Sbjct: 301 EPEHPMSLDFLRMDIKNINFYFEKMGIDIFPERVIFQFIISDTLENFNGDYRDYNDLRDY 360

Query: 327 IAKNLPIKSTEQDEAEDEIFRSLHLVRSLGGLEERDFDRYTDGKFDLLKSLIAHDNERNF 386
           +A+NLPIK +EQDEAEDEIFRSL+LVR+L GLEERDFDRYTDGKFDLLKSLIAHDNE+NF
Sbjct: 361 VAQNLPIKKSEQDEAEDEIFRSLYLVRNLEGLEERDFDRYTDGKFDLLKSLIAHDNEKNF 420

Query: 387 AASEQFEFDNADHTXXXXXXXXXXXXXXXXXXXXXXXXXXXXCAYYEDDEPKILKGKRYE 446
           +A+EQF+    D T                                     K+LKGKRYE
Sbjct: 421 SAAEQFDLKAQDATTDEEDEISEEDFDGEDDDDEGYESEE-----------KVLKGKRYE 469

Query: 447 DKDVKKLR 454
           DKD KKLR
Sbjct: 470 DKDAKKLR 477

>KAFR0E03920 Chr5 complement(775345..776838) [1494 bp, 497 aa] {ON}
           Anc_5.432 YOR119C
          Length = 497

 Score =  627 bits (1617), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/413 (73%), Positives = 353/413 (85%), Gaps = 18/413 (4%)

Query: 1   MSLEDNFDKLTVS--QRASDHINNQLLEKYSHKIKTDELSFNRAKTSKDKANRATVENVL 58
           MS+ED FD L +S  + +SDHINNQ+L+KY HKIKT+E S +R KT+KDKANRATVENVL
Sbjct: 1   MSIEDKFDNLKISGGRGSSDHINNQILDKYGHKIKTNEFSLSRGKTNKDKANRATVENVL 60

Query: 59  DPRTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGK--------------APVID 104
           DPRTM+FL+++++RGVI+  +GCLSTGKEANVYHAFAGTG+               PV  
Sbjct: 61  DPRTMKFLQALMSRGVISSFDGCLSTGKEANVYHAFAGTGRPAGQVPTLVQEEMSVPVDP 120

Query: 105 EETGKYEVLETDGP--RPEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKI 162
            E    E  + +    R EYAIKIYKTSILVFKDRERYVDGEFRFRN+RSQHNPRKMIKI
Sbjct: 121 SELSAQEDKDENSTDRREEYAIKIYKTSILVFKDRERYVDGEFRFRNARSQHNPRKMIKI 180

Query: 163 WAEKEFRNLKRIYQSGVIPAPKPIEVKNNVLVMEFLSRGNGFASPKLKDYPYRDRGEIFH 222
           WAEKEFRNLKRIYQS VIPAPKPIE+KNNVLVMEFL+RG+GFASP+LKD+PY+DR EIFH
Sbjct: 181 WAEKEFRNLKRIYQSEVIPAPKPIEIKNNVLVMEFLNRGDGFASPRLKDHPYKDREEIFH 240

Query: 223 YYYTMVAYMRLLYQVCRLVHADLSEYNTIIHDDKLFMIDVSQSVEPEHPMSLDFLRMDIK 282
           YY+T+VAY+RLLYQVC LVHADLSEYNT++H  +L++IDVSQSVEPEHPMSLDFLRMDIK
Sbjct: 241 YYHTLVAYIRLLYQVCHLVHADLSEYNTLVHQGRLYVIDVSQSVEPEHPMSLDFLRMDIK 300

Query: 283 NVNLYFEKMGISIFPERVIFQFVISESLEKFKDDYHNVTDLVGYIAKNLPIKSTEQDEAE 342
           NVN YFEKMGI IFPER+IFQFVISE+L+KF  DY +  DL  Y+ +NLPIK+T QDEAE
Sbjct: 301 NVNFYFEKMGIDIFPERIIFQFVISETLDKFNGDYKSSDDLRDYVRQNLPIKATGQDEAE 360

Query: 343 DEIFRSLHLVRSLGGLEERDFDRYTDGKFDLLKSLIAHDNERNFAASEQFEFD 395
           DEIFRSL+LVR+L GLEERDFDRYT+G+FDLLKSL+AHDNE+NFAASEQ+E +
Sbjct: 361 DEIFRSLYLVRNLNGLEERDFDRYTEGRFDLLKSLLAHDNEKNFAASEQYELE 413

>SAKL0G02486g Chr7 complement(206119..207621) [1503 bp, 500 aa] {ON}
           similar to uniprot|Q12196 YOR119C Saccharomyces
           cerevisiae RIO1 Essential protein that plays a role in
           cell cycle progression
          Length = 500

 Score =  624 bits (1609), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/400 (75%), Positives = 348/400 (87%), Gaps = 10/400 (2%)

Query: 1   MSLEDNFDKLTV---SQRASDHINNQLLEKYSHKIKTDELSFNRAKTSKDKANRATVENV 57
           MS+E +F KL +        DH+N+++L+KYSH+IKTDELS  R KT+KDKANRATVENV
Sbjct: 1   MSVEASFSKLHLRDGPDEHRDHVNSRILDKYSHRIKTDELSLTRGKTNKDKANRATVENV 60

Query: 58  LDPRTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGKYEVLETDG 117
           LDPRTMRFL+ +V+RGV++DLNGCLSTGKEANVYHAFAG    P  + E    + L    
Sbjct: 61  LDPRTMRFLRGLVSRGVLSDLNGCLSTGKEANVYHAFAGNANQPSEEAEKDSKDEL---- 116

Query: 118 PRPEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQS 177
            + EYA+KIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRI+QS
Sbjct: 117 VKREYAVKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIHQS 176

Query: 178 GVIPAPKPIEVKNNVLVMEFLSRGNGFASPKLKDYPYRDRGEIFHYYYTMVAYMRLLYQV 237
           GVIP P+PIEV++NVLVMEFL+RGNGFASP+LKD+PY+DR EI +YY+TMVAYMRLLYQV
Sbjct: 177 GVIPCPQPIEVRSNVLVMEFLNRGNGFASPRLKDHPYKDREEIKYYYHTMVAYMRLLYQV 236

Query: 238 CRLVHADLSEYNTIIHDDKLFMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGISIFP 297
           C+LVHADLSEYNTI+H D+L+MIDVSQSV+PEHPMSLDFLRMDIKN+N YFEK GI IFP
Sbjct: 237 CQLVHADLSEYNTIVHHDRLYMIDVSQSVQPEHPMSLDFLRMDIKNINSYFEKTGIDIFP 296

Query: 298 ERVIFQFVISESLEKFKDDYHNVTDLVGYIAKNLPIKSTEQDEAEDEIFRSLHLVRSLGG 357
           ERVIFQF+ISE+L+KF+ DYHN  DL  Y++KNLP+KST +DEAEDE+FRSLHLVR+L G
Sbjct: 297 ERVIFQFIISETLDKFQGDYHNDQDLRDYVSKNLPLKSTAEDEAEDEVFRSLHLVRNLNG 356

Query: 358 LEERDFDRYTDGKFDLLKSLIAHDNER---NFAASEQFEF 394
           LEERDFDR+TDGKFDLLKSLIAHDN++   NF ASEQFE 
Sbjct: 357 LEERDFDRFTDGKFDLLKSLIAHDNKKNATNFNASEQFEI 396

>KNAG0C04930 Chr3 (951832..953322) [1491 bp, 496 aa] {ON} Anc_5.432
           YOR119C
          Length = 496

 Score =  622 bits (1605), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/468 (66%), Positives = 368/468 (78%), Gaps = 18/468 (3%)

Query: 1   MSLEDNFDKLTVSQRASDHI-NNQLLEKYSHKIKTDELSFNRAK-TSKDKANRATVENVL 58
           MS+E+ F+KL++     D   NN+LL+KY+HKIK D+ SF++ K T+KDKANRATVENVL
Sbjct: 1   MSVEEKFEKLSIDHHVKDDTANNKLLDKYAHKIKNDQFSFSKVKKTTKDKANRATVENVL 60

Query: 59  DPRTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAGTG----KAPVIDEET------- 107
           DPRTMRFL++++NRG+I+D NGCLSTGKEANVYHAFAG G       + DEE+       
Sbjct: 61  DPRTMRFLQALMNRGIISDFNGCLSTGKEANVYHAFAGDGVSRASGTLPDEESLLARLTQ 120

Query: 108 GKYEVLETDGPRPEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKE 167
            +  V  + G + EYAIKI+KTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKE
Sbjct: 121 EERAVQASVGGKKEYAIKIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKE 180

Query: 168 FRNLKRIYQSGVIPAPKPIEVKNNVLVMEFLSRGNGFASPKLKDYPYRDRGEIFHYYYTM 227
           FRNLKRIYQSG +P PKP+EVKNNVLVMEFL+RG+GFASP+L+DYPY+D   I  YY T+
Sbjct: 181 FRNLKRIYQSGAVPVPKPVEVKNNVLVMEFLNRGDGFASPRLRDYPYKDTDSIRQYYCTL 240

Query: 228 VAYMRLLYQVCRLVHADLSEYNTIIHDDKLFMIDVSQSVEPEHPMSLDFLRMDIKNVNLY 287
           VAYMRL+YQVC LVHADLSEYN ++H+D+L++IDVSQSV+PEHPMSLDFLRMDIKNVNLY
Sbjct: 241 VAYMRLMYQVCGLVHADLSEYNVLVHNDRLYIIDVSQSVQPEHPMSLDFLRMDIKNVNLY 300

Query: 288 FEKMGISIFPERVIFQFVISESLEKFKDDYHNVTDLVGYIAKNLPIKSTEQDEAEDEIFR 347
           F KMGI IFPER+IFQFVISESL+KF+ DY +  DL  Y+  NLP+K TEQDE EDE+FR
Sbjct: 301 FGKMGIDIFPERIIFQFVISESLDKFEGDYKSSKDLTEYVESNLPVKKTEQDEMEDEVFR 360

Query: 348 SLHLVRSLGGLEERDFDRYTDGKFDLLKSLIAHDNERNFAASE-QFEFDNADHTXXXXXX 406
           SL+LVR+L GLEERDFDR+T+GKFDLLKSL+AHD E+NF A+E QFEFD+ + +      
Sbjct: 361 SLYLVRNLEGLEERDFDRFTEGKFDLLKSLLAHDMEKNFTAAEQQFEFDDENDS----SS 416

Query: 407 XXXXXXXXXXXXXXXXXXXXXXCAYYEDDEPKILKGKRYEDKDVKKLR 454
                                   Y  DDE K+LKGK+YEDKD KKLR
Sbjct: 417 GSQDDDGEDEDEEESDGEDEEDVYYTTDDEDKVLKGKKYEDKDAKKLR 464

>CAGL0L11594g Chr12 (1239169..1240692) [1524 bp, 507 aa] {ON} highly
           similar to uniprot|Q12196 Saccharomyces cerevisiae
           YOR119c
          Length = 507

 Score =  620 bits (1600), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/476 (65%), Positives = 365/476 (76%), Gaps = 28/476 (5%)

Query: 3   LEDNFDKLTVSQRASDHINNQLLEKYSHKIKTDELSFNRAKTSKDKANRATVENVLDPRT 62
           L D F  + VS   +DHINNQ+++KY HKIKTDELS N+AKT+KDKANRATVENVLDPRT
Sbjct: 4   LSDKFRNVKVS---TDHINNQIMDKYGHKIKTDELSINKAKTNKDKANRATVENVLDPRT 60

Query: 63  MRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGKYEVLETDGP---- 118
           MRFL ++VNRGVIA LNGCLSTGKEANVYHAFAG+  A     +  K ++     P    
Sbjct: 61  MRFLNALVNRGVIAGLNGCLSTGKEANVYHAFAGSKMATEQQSDEPKEDIDANAIPSKGN 120

Query: 119 ------------------RPEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMI 160
                             R EYAIKIYKTSIL+FKDRERYVDGEFRFRNSRSQHNPRKMI
Sbjct: 121 IDISENRAKTAEDLIREGRKEYAIKIYKTSILIFKDRERYVDGEFRFRNSRSQHNPRKMI 180

Query: 161 KIWAEKEFRNLKRIYQSGVIPAPKPIEVKNNVLVMEFLSRGNGFASPKLKDYPYRDRGEI 220
           KIWAEKEFRNLKRIYQ GVIP+P+PIEVKNNVLVMEFL+RG+GFASPKL+DYPY+DR EI
Sbjct: 181 KIWAEKEFRNLKRIYQMGVIPSPEPIEVKNNVLVMEFLNRGDGFASPKLRDYPYKDREEI 240

Query: 221 FHYYYTMVAYMRLLYQVCRLVHADLSEYNTIIHDDKLFMIDVSQSVEPEHPMSLDFLRMD 280
           ++YY+ +V+YMRLLYQVCRLVHADLSEYNTI+H +KL+MIDVSQSVEPEHPMSLDFLRMD
Sbjct: 241 YYYYHILVSYMRLLYQVCRLVHADLSEYNTIVHKEKLYMIDVSQSVEPEHPMSLDFLRMD 300

Query: 281 IKNVNLYFEKMGISIFPERVIFQFVISESLEKFKDDYHNVTDLVGYIAKNLPIKSTEQDE 340
           IKNVNLYFEKMGI IF E+ IFQFVI+++L+KF  D ++  DL  Y+A N+PIK T++DE
Sbjct: 301 IKNVNLYFEKMGIEIFQEKAIFQFVITDTLDKFDGDMNSYEDLRKYVATNIPIKRTQEDE 360

Query: 341 AEDEIFRSLHLVRSLGGLEERDFDRYTDGKFDLLKSLIAHDNERNFAASE--QFEFDNAD 398
           AEDE+FRSLHLVR+L GLEERDFDR+TDGKFDLLKSL+A DN++N+ A++  +   D++D
Sbjct: 361 AEDEVFRSLHLVRNLEGLEERDFDRFTDGKFDLLKSLLAQDNKKNYIAAQASKINVDSSD 420

Query: 399 HTXXXXXXXXXXXXXXXXXXXXXXXXXXXXCAYYEDDEPKILKGKRYEDKDVKKLR 454
                                            YE + PK LKGK+YEDKD+KK R
Sbjct: 421 ENISDSEDEGSDDGSDDDTDGSDEEEQYSEAESYE-EVPKELKGKKYEDKDLKKQR 475

>Kpol_1062.31 s1062 (67759..69300) [1542 bp, 513 aa] {ON}
           (67759..69300) [1542 nt, 514 aa]
          Length = 513

 Score =  619 bits (1596), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/426 (71%), Positives = 349/426 (81%), Gaps = 31/426 (7%)

Query: 1   MSLEDNFDKLTVSQRASDHINNQLLEKYSHKIKTDELSFNRAKTSKDKANRATVENVLDP 60
           MS ++ FD+L +S    + +N ++LEKY HKIKTDELSF + KT+KDKANRATVENVLDP
Sbjct: 1   MSFDEKFDRLKIS---GNDVNTRILEKYGHKIKTDELSFTKGKTNKDKANRATVENVLDP 57

Query: 61  RTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPV------------------ 102
           RTMRFLK++ NRGVI+  NGCLSTGKEANVYHAFAG G +                    
Sbjct: 58  RTMRFLKALTNRGVISAFNGCLSTGKEANVYHAFAGDGTSSRNTDVKVEDLVKLTSVEVN 117

Query: 103 --IDEETG-KYEVLETDGPRP-------EYAIKIYKTSILVFKDRERYVDGEFRFRNSRS 152
              +E+ G    V + DG +P       EYAIKIYKTSILVFKDRERYVDGE+RFRNSRS
Sbjct: 118 QDSEEDNGDNNNVADIDGSKPEGVELRKEYAIKIYKTSILVFKDRERYVDGEYRFRNSRS 177

Query: 153 QHNPRKMIKIWAEKEFRNLKRIYQSGVIPAPKPIEVKNNVLVMEFLSRGNGFASPKLKDY 212
           QHNPRKMIKIWAEKEFRNL+RI+QSGVIPAPKP+EVK+NVLVMEFL+RGNGFASP+LKDY
Sbjct: 178 QHNPRKMIKIWAEKEFRNLRRIHQSGVIPAPKPVEVKSNVLVMEFLNRGNGFASPRLKDY 237

Query: 213 PYRDRGEIFHYYYTMVAYMRLLYQVCRLVHADLSEYNTIIHDDKLFMIDVSQSVEPEHPM 272
           PY+DR EIF YY+ +VAYMRLLYQVCRLVHADLSEYNTI+H  KL+MIDVSQSVEPEHPM
Sbjct: 238 PYKDRDEIFWYYHILVAYMRLLYQVCRLVHADLSEYNTIVHQGKLYMIDVSQSVEPEHPM 297

Query: 273 SLDFLRMDIKNVNLYFEKMGISIFPERVIFQFVISESLEKFKDDYHNVTDLVGYIAKNLP 332
           SLDFLRMDIKNVN YFEKMGI IFPER+IFQFVISE LE FK D ++  DL  ++  NLP
Sbjct: 298 SLDFLRMDIKNVNGYFEKMGIDIFPERIIFQFVISEKLETFKGDLNSADDLREFVKNNLP 357

Query: 333 IKSTEQDEAEDEIFRSLHLVRSLGGLEERDFDRYTDGKFDLLKSLIAHDNERNFAASEQF 392
           IKST++DEAEDE+FRSLHLVR+LGGLEERDFDR+TDGKFDLLK+LIA DN++NF ASEQ+
Sbjct: 358 IKSTDEDEAEDEVFRSLHLVRNLGGLEERDFDRFTDGKFDLLKTLIASDNQKNFTASEQY 417

Query: 393 EFDNAD 398
             ++ D
Sbjct: 418 GMEDLD 423

>KLTH0F16104g Chr6 (1306436..1308058) [1623 bp, 540 aa] {ON} similar
           to uniprot|Q12196 YOR119C Saccharomyces cerevisiae RIO1
           Essential protein that plays a role in cell cycle
           progression
          Length = 540

 Score =  613 bits (1581), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/460 (66%), Positives = 361/460 (78%), Gaps = 10/460 (2%)

Query: 1   MSLEDNFDKLTVSQRAS---DHINNQLLEKYSHKIKTDELSFNRAKTSKDKANRATVENV 57
           MSLED   KL++ ++     DHIN Q+L+K++H IKTDELS  RAKTSKDKANRATVENV
Sbjct: 53  MSLEDGLGKLSLHEKHGADRDHINTQILDKHAHNIKTDELSVTRAKTSKDKANRATVENV 112

Query: 58  LDPRTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGKYEVLETDG 117
           LDPRTMRFL+++ +RGVI++ NGCLSTGKEANVYHAFAG G     +E+    +VL   G
Sbjct: 113 LDPRTMRFLQALKSRGVISEFNGCLSTGKEANVYHAFAGYGAKSSEEEQ----KVLPNQG 168

Query: 118 PRPEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQS 177
            R EYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQS
Sbjct: 169 ERREYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQS 228

Query: 178 GVIPAPKPIEVKNNVLVMEFLSRGNGFASPKLKDYPYRDRGEIFHYYYTMVAYMRLLYQV 237
           GV+PAP+PIEVK+NVLVMEFL+RG+GFASPKLKD+PY+DR E  +YY+TMVAY+RLLYQ 
Sbjct: 229 GVVPAPEPIEVKSNVLVMEFLNRGDGFASPKLKDFPYKDRDETLYYYHTMVAYIRLLYQC 288

Query: 238 CRLVHADLSEYNTIIHDDKLFMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGISIFP 297
           C+LVHADLSEYNTI+H+ KL++IDVSQSV+PEHPMSLDFLRMDIKN+N YFE+M I IFP
Sbjct: 289 CQLVHADLSEYNTIVHNQKLYVIDVSQSVQPEHPMSLDFLRMDIKNINSYFERMSIDIFP 348

Query: 298 ERVIFQFVISESLEKFKDDYHNVTDLVGYIAKNLPIKSTEQDEAEDEIFRSLHLVRSLGG 357
           ER IFQFVIS+ LEKF+ +Y N  DL  Y+AK L  KS  +DEAEDE+FRSLHLVR+LGG
Sbjct: 349 ERAIFQFVISDKLEKFEGEYTNAEDLRQYVAKTLRPKSGPEDEAEDEVFRSLHLVRNLGG 408

Query: 358 LEERDFDRYTDGKFDLLKSLIAHDNER---NFAASEQFEFDNADHTXXXXXXXXXXXXXX 414
           LEERDFDR+T GKFDLLKSLIAHDN++   NF ASEQ+E  ++                 
Sbjct: 409 LEERDFDRFTLGKFDLLKSLIAHDNQKVASNFTASEQYELSSSSDEEVSEDEDYNESGSG 468

Query: 415 XXXXXXXXXXXXXXCAYYEDDEPKILKGKRYEDKDVKKLR 454
                               ++ K +KGK++EDKD KK R
Sbjct: 469 SEDDDGDDESGESSDEEEWLEKSKEIKGKKHEDKDSKKQR 508

>Kwal_55.21433 s55 (835062..836492) [1431 bp, 476 aa] {ON} YOR119C
           (RIO1) - similar to a C.elegans ZK632.3 protein [contig
           130] FULL
          Length = 476

 Score =  607 bits (1565), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/400 (73%), Positives = 338/400 (84%), Gaps = 10/400 (2%)

Query: 1   MSLEDNFDKLTVS---QRASDHINNQLLEKYSHKIKTDELSFNRAKTSKDKANRATVENV 57
           MSL+D  D L +    +   DHIN Q+L+K++H IK DELS +R KTSKDKANRATVENV
Sbjct: 1   MSLKDRMDNLRLRDNFEPQDDHINTQILDKHAHNIKADELSVSRGKTSKDKANRATVENV 60

Query: 58  LDPRTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGKYEVLETDG 117
           LDPRTMRFL+++ +RGVI+  NGC+STGKEANVYHAFA  G      EE G  EVL    
Sbjct: 61  LDPRTMRFLQALTSRGVISQFNGCVSTGKEANVYHAFAEIGAKNT--EEAG--EVLPNLE 116

Query: 118 PRPEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQS 177
            R E AIKI+KTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQS
Sbjct: 117 ERRELAIKIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQS 176

Query: 178 GVIPAPKPIEVKNNVLVMEFLSRGNGFASPKLKDYPYRDRGEIFHYYYTMVAYMRLLYQV 237
           G++PAP+P+EV++NVLVMEFLSRGNGFASP+LKDYPY+DR E  HYYYTMVAY+RLLYQ 
Sbjct: 177 GLVPAPEPVEVRSNVLVMEFLSRGNGFASPRLKDYPYKDREETAHYYYTMVAYIRLLYQC 236

Query: 238 CRLVHADLSEYNTIIHDDKLFMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGISIFP 297
           C+LVHADLSEYN I+H+ +L++IDVSQSV+PEHPMSLDFLRMDIKNVN YFE+M + +FP
Sbjct: 237 CQLVHADLSEYNAIVHNKELYIIDVSQSVQPEHPMSLDFLRMDIKNVNNYFERMSVDVFP 296

Query: 298 ERVIFQFVISESLEKFKDDYHNVTDLVGYIAKNLPIKSTEQDEAEDEIFRSLHLVRSLGG 357
           ERVIFQFVISE+L+KF  DY +  DL  Y++KNLP+KS  QDEAEDE+FRSLHLVR+LGG
Sbjct: 297 ERVIFQFVISETLDKFSGDYTSSVDLRDYVSKNLPVKSGPQDEAEDEVFRSLHLVRNLGG 356

Query: 358 LEERDFDRYTDGKFDLLKSLIAHDNER---NFAASEQFEF 394
           LEERDFDR+T GKFDLLKSLIAHDNER    F ASEQFE 
Sbjct: 357 LEERDFDRFTLGKFDLLKSLIAHDNERVASTFTASEQFEL 396

>KLLA0E21121g Chr5 (1886452..1888032) [1581 bp, 526 aa] {ON} similar
           to uniprot|Q12196 YOR119C Saccharomyces cerevisiae RIO1
           Essential protein that plays a role in cell cycle
           progression
          Length = 526

 Score =  607 bits (1565), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/422 (69%), Positives = 345/422 (81%), Gaps = 31/422 (7%)

Query: 1   MSLEDNFDKLTVSQRASDHINNQLLEKYSHKIKTDELSFNRAKTSKDKANRATVENVLDP 60
           M+++D  +KL ++ R  +H+N Q+LE+Y++ IKTDELS  R KTSKDKANRATVENVLDP
Sbjct: 2   MNIDDKLEKLNLANR-DEHVNTQILERYANSIKTDELSLTRGKTSKDKANRATVENVLDP 60

Query: 61  RTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAGT----------------------- 97
           RTMRFLKSM+NRG+++  NGCLSTGKEANVYHAFAG                        
Sbjct: 61  RTMRFLKSMMNRGILSAFNGCLSTGKEANVYHAFAGNHEERHLLVEGHDDTIGAPQNIES 120

Query: 98  --GKAPVIDEETGKYEVLETDGPR--PEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQ 153
              KA   + E        TD P+   EYA+KIYKTSILVFKDRERYVDGEFRFRNSRSQ
Sbjct: 121 TKQKALTAESEDATSTSTATDEPKNKKEYAVKIYKTSILVFKDRERYVDGEFRFRNSRSQ 180

Query: 154 HNPRKMIKIWAEKEFRNLKRIYQSGVIPAPKPIEVKNNVLVMEFLSRGNGFASPKLKDYP 213
           HNPRKMIKIWAEKEFRNLKRIYQSGVIP PKPIEV++NVLVMEFL+RG+GFASP+LKD+P
Sbjct: 181 HNPRKMIKIWAEKEFRNLKRIYQSGVIPCPKPIEVRSNVLVMEFLNRGDGFASPRLKDHP 240

Query: 214 YRDRGEIFHYYYTMVAYMRLLYQVCRLVHADLSEYNTIIHDDKLFMIDVSQSVEPEHPMS 273
           Y+DR EI HYY  M+AYMRLLYQVCRLVHADLSEYN+I+H+DKL++IDVSQSV+PEHPMS
Sbjct: 241 YKDREEIKHYYNLMIAYMRLLYQVCRLVHADLSEYNSIVHEDKLYIIDVSQSVQPEHPMS 300

Query: 274 LDFLRMDIKNVNLYFEKMGISIFPERVIFQFVISESLEKFKDDYHNVTDLVGYIAKNLPI 333
           LDFLRMDIKNVN YF+K+GI IFPERVIFQF+ISE L+KFK DY +  DL  Y+A NLP+
Sbjct: 301 LDFLRMDIKNVNSYFQKLGIDIFPERVIFQFIISEVLDKFKGDYRSSDDLETYVADNLPL 360

Query: 334 KSTEQDEAEDEIFRSLHLVRSLGGLEERDFDRYTDGKFDLLKSLIAHDNER---NFAASE 390
           K T++DEAEDE+FRSLHL+R+LGGLEERDFDR+TDGKFDLLKSLIA++N +   NF ASE
Sbjct: 361 KLTDEDEAEDEVFRSLHLIRNLGGLEERDFDRFTDGKFDLLKSLIANENRKYSENFTASE 420

Query: 391 QF 392
           Q+
Sbjct: 421 QY 422

>TDEL0E01930 Chr5 (363913..365421) [1509 bp, 502 aa] {ON} Anc_5.432
           YOR119C
          Length = 502

 Score =  606 bits (1562), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/389 (75%), Positives = 336/389 (86%), Gaps = 9/389 (2%)

Query: 1   MSLEDNFDKLTVSQRASDHINNQLLEKYSHKIKTDELSFNRAKTSKDKANRATVENVLDP 60
           MSLED FD+L +S    +H N Q+L+K+S+ IKTDELSF R+K+SKDKANRATVENVLDP
Sbjct: 1   MSLEDQFDRLDISH-GREHANIQILDKHSNNIKTDELSFTRSKSSKDKANRATVENVLDP 59

Query: 61  RTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGKYEVLETDGPRP 120
           RTMRFLKSM+NRGVI++ NGCLSTGKEANVYHAFAG     + D + G  +     G + 
Sbjct: 60  RTMRFLKSMMNRGVISEFNGCLSTGKEANVYHAFAGES---IEDSKDGHVQ-----GEKK 111

Query: 121 EYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVI 180
           E AIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNL+RI QSGVI
Sbjct: 112 ELAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRINQSGVI 171

Query: 181 PAPKPIEVKNNVLVMEFLSRGNGFASPKLKDYPYRDRGEIFHYYYTMVAYMRLLYQVCRL 240
           PAPKP+EVKNNVLVMEFLSRG+GFASP+LKD+ + DR EI+HYY+TM+AY+RLLYQVCRL
Sbjct: 172 PAPKPVEVKNNVLVMEFLSRGDGFASPRLKDHLFADRAEIYHYYHTMLAYIRLLYQVCRL 231

Query: 241 VHADLSEYNTIIHDDKLFMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGISIFPERV 300
           VHADLSEYN I+HD KL++IDVSQSVEPEHPMSLDFLRMDIKN+N YFEKMGI IFPER+
Sbjct: 232 VHADLSEYNAIVHDQKLYIIDVSQSVEPEHPMSLDFLRMDIKNINAYFEKMGIDIFPERL 291

Query: 301 IFQFVISESLEKFKDDYHNVTDLVGYIAKNLPIKSTEQDEAEDEIFRSLHLVRSLGGLEE 360
           IFQFVISE+LEKF  +  +  DL  Y++K LP+KST  D  EDEIFRSLHLVR+L GLEE
Sbjct: 292 IFQFVISETLEKFDGNPKSSADLSNYVSKALPVKSTTGDVEEDEIFRSLHLVRNLEGLEE 351

Query: 361 RDFDRYTDGKFDLLKSLIAHDNERNFAAS 389
           RDFDR+TDGKFDLLKSLIAHDNER+  A+
Sbjct: 352 RDFDRFTDGKFDLLKSLIAHDNERHLRAA 380

>TBLA0A03760 Chr1 complement(938917..940431) [1515 bp, 504 aa] {ON}
           Anc_5.432 YOR119C
          Length = 504

 Score =  605 bits (1561), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/410 (70%), Positives = 343/410 (83%), Gaps = 17/410 (4%)

Query: 1   MSLEDNFDKLTVSQRASDHINNQLLEKYSHKIKTDELSFNRAKTSKDKANRATVENVLDP 60
           M L+D+F KL +S   ++H NN++L+K+ HKIKTDE S +R KT+KDKANRATVENVLDP
Sbjct: 1   MVLDDDFQKLDLS---NNHDNNRILDKHGHKIKTDEFSISRGKTNKDKANRATVENVLDP 57

Query: 61  RTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGKYEVLETD---- 116
           RTMRFLK++ +RG+I+D NGC+STGKEANVYHAFAG   +P   +    +E L       
Sbjct: 58  RTMRFLKALTSRGIISDFNGCISTGKEANVYHAFAGDTISPFEPKTHDSFENLVNTYDPY 117

Query: 117 ----------GPRPEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEK 166
                      PR EYAIKIYKTSILVFKDRERYVDGE+RFRNSRSQHNPRKMIKIWAEK
Sbjct: 118 SNPNNNDTILEPRKEYAIKIYKTSILVFKDRERYVDGEYRFRNSRSQHNPRKMIKIWAEK 177

Query: 167 EFRNLKRIYQSGVIPAPKPIEVKNNVLVMEFLSRGNGFASPKLKDYPYRDRGEIFHYYYT 226
           EFRNLKRIYQS VIP PKPIEVKNNVLVMEFL+RG+GFASP+LKDYPY+D  +I HYY+T
Sbjct: 178 EFRNLKRIYQSKVIPVPKPIEVKNNVLVMEFLNRGDGFASPRLKDYPYKDHNDIVHYYHT 237

Query: 227 MVAYMRLLYQVCRLVHADLSEYNTIIHDDKLFMIDVSQSVEPEHPMSLDFLRMDIKNVNL 286
           M+ Y+RLLYQVCRLVHADLSEYNT++H +KL++IDVSQSVEPEHPMSLDFLRMDIKN+N 
Sbjct: 238 MIVYIRLLYQVCRLVHADLSEYNTLVHKNKLYVIDVSQSVEPEHPMSLDFLRMDIKNINN 297

Query: 287 YFEKMGISIFPERVIFQFVISESLEKFKDDYHNVTDLVGYIAKNLPIKSTEQDEAEDEIF 346
           YFE+MG++IF ER+IFQF ISE+L+ F  +Y N  DL  Y+  NLP+K   +D+AEDEIF
Sbjct: 298 YFERMGVAIFAERIIFQFTISETLDNFNGNYSNEDDLRMYVKNNLPLKVPGKDDAEDEIF 357

Query: 347 RSLHLVRSLGGLEERDFDRYTDGKFDLLKSLIAHDNERNFAASEQFEFDN 396
           RSLHLVR+LGGLEERDFDRYTDGKFDLLKSLIAHDNE+NF+ASEQ+ F++
Sbjct: 358 RSLHLVRNLGGLEERDFDRYTDGKFDLLKSLIAHDNEKNFSASEQYNFED 407

>TPHA0E01780 Chr5 (357819..359345) [1527 bp, 508 aa] {ON} Anc_5.432
           YOR119C
          Length = 508

 Score =  599 bits (1544), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/420 (70%), Positives = 344/420 (81%), Gaps = 26/420 (6%)

Query: 1   MSLEDNFDKLTVSQRASDHINNQLLEKYSHKIKTDELSFNRAKTSKDKANRATVENVLDP 60
           MSLE  FDKL V +  S+HIN+++LEKY HKIKTDELS  + KT+KDKANRATVENVLDP
Sbjct: 1   MSLEGKFDKLKVHE--SEHINSKILEKYGHKIKTDELSDTKGKTNKDKANRATVENVLDP 58

Query: 61  RTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKA-------PVIDE-------- 105
           RTM+ LK+++NRGVI + NGCLSTGKEANVYHAFAG GK        P I E        
Sbjct: 59  RTMKSLKTLINRGVIFEFNGCLSTGKEANVYHAFAGDGKVKGNAEVLPQISELEDVLNKE 118

Query: 106 --------ETGKYEVLETD-GPRPEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNP 156
                    T K E  +T    R EYAIKIYKTSILVFKDRERYVDGEFRFRN+RSQHNP
Sbjct: 119 LIPGQIEVPTIKSEEEQTQLKQRKEYAIKIYKTSILVFKDRERYVDGEFRFRNARSQHNP 178

Query: 157 RKMIKIWAEKEFRNLKRIYQSGVIPAPKPIEVKNNVLVMEFLSRGNGFASPKLKDYPYRD 216
           RKMIKIWAEKEFRNL+RI+QSG+IPAP+P+EVK N+LVMEFL RG+GFASP+L+D+ Y+ 
Sbjct: 179 RKMIKIWAEKEFRNLRRIFQSGIIPAPEPVEVKYNILVMEFLGRGDGFASPRLRDHQYKT 238

Query: 217 RGEIFHYYYTMVAYMRLLYQVCRLVHADLSEYNTIIHDDKLFMIDVSQSVEPEHPMSLDF 276
           R EI +YY+T+VAY+RLLYQVCRLVHADLSEYNTI+HDDKL++IDVSQSVEPEHPMSLDF
Sbjct: 239 REEIIYYYHTLVAYIRLLYQVCRLVHADLSEYNTIVHDDKLYVIDVSQSVEPEHPMSLDF 298

Query: 277 LRMDIKNVNLYFEKMGISIFPERVIFQFVISESLEKFKDDYHNVTDLVGYIAKNLPIKST 336
           LRMDIKNVN YFEKMGI IFPER+IFQFVIS  L+KF  D  +  DL  YIA  LP+K T
Sbjct: 299 LRMDIKNVNGYFEKMGIDIFPERIIFQFVISSELDKFTGDPRSSVDLRNYIAHYLPVKCT 358

Query: 337 EQDEAEDEIFRSLHLVRSLGGLEERDFDRYTDGKFDLLKSLIAHDNERNFAASEQFEFDN 396
           ++DE +DEIFRSLHLVR+L GLEERDFDR+TDGKFDLLK+LIA DN++NF AS QF+F+N
Sbjct: 359 DEDELKDEIFRSLHLVRNLDGLEERDFDRFTDGKFDLLKTLIASDNQKNFTASTQFDFNN 418

>AER257W Chr5 (1110411..1111844) [1434 bp, 477 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR119C (RIO1)
          Length = 477

 Score =  596 bits (1537), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/462 (64%), Positives = 357/462 (77%), Gaps = 25/462 (5%)

Query: 1   MSLEDNFDKLTVSQRASDHINNQLLEKYSHKIKTDELSFNRAKTSKDKANRATVENVLDP 60
           M LED   KL +    +DH N ++LEK++++IKTDELS  + KT+KDKANRATVENVLDP
Sbjct: 1   MDLEDQLRKLKLRD-DTDHDNTRILEKFANQIKTDELSLTKGKTNKDKANRATVENVLDP 59

Query: 61  RTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAG-TGKAPVIDEETGKYEVLETDGPR 119
           RTMRFL+++VNRGV+++ NGCLSTGKEANVYHA +G T  AP                 +
Sbjct: 60  RTMRFLRALVNRGVLSEFNGCLSTGKEANVYHALSGATEGAP----------------EK 103

Query: 120 PEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGV 179
            EYA+KIYKTSILVFKDRERYVDGEFRFRN+RS HNPRKMIKIWAEKEFRNLKRIYQSGV
Sbjct: 104 SEYAVKIYKTSILVFKDRERYVDGEFRFRNARSHHNPRKMIKIWAEKEFRNLKRIYQSGV 163

Query: 180 IPAPKPIEVKNNVLVMEFLSRGNGFASPKLKDYPYRDRGEIFHYYYTMVAYMRLLYQVCR 239
           IP P+P+E+K+NVLVMEFL+RG+GFASP+LKDYP++DR EI+HYY+ MV+Y+RLLYQVC+
Sbjct: 164 IPCPQPVEIKSNVLVMEFLNRGDGFASPRLKDYPFKDRDEIYHYYHVMVSYIRLLYQVCQ 223

Query: 240 LVHADLSEYNTIIHDDKLFMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGISIFPER 299
           LVHADLSEYN+I+H  KL++IDVSQSV+PEHPMSLDFLRMDIKN+N+YFE+MGI IFPER
Sbjct: 224 LVHADLSEYNSIVHQSKLYIIDVSQSVQPEHPMSLDFLRMDIKNINMYFERMGIDIFPER 283

Query: 300 VIFQFVISESLEKFKDDYHNVTDLVGYIAKNLPIKSTEQDEAEDEIFRSLHLVRSLGGLE 359
           VIFQFVISE+L+KF+ D  +  DL  Y+A NLP K T QDEAED++FRSLHLVR+LGGLE
Sbjct: 284 VIFQFVISETLDKFRGDMRSAEDLRSYVAANLPRKQTAQDEAEDQVFRSLHLVRNLGGLE 343

Query: 360 ERDFDRYTDGKFDLLKSLIAHDNER---NFAASEQFEFDNADHTXXXXXXXXXXXXXXXX 416
           ERDFDR+TDGKFDLLKSLIA DN +    F ASEQ++  ++D                  
Sbjct: 344 ERDFDRFTDGKFDLLKSLIAQDNAKISNTFTASEQYDLSDSDDAEDEDEDADEGQDEDGS 403

Query: 417 XXXXXXXXXXXXCAYYEDD----EPKILKGKRYEDKDVKKLR 454
                        +  + D     PK+L GK+YEDKD KKLR
Sbjct: 404 ESGTDSDSSSDDESGDDKDDYELRPKVLVGKKYEDKDAKKLR 445

>NDAI0B05650 Chr2 complement(1380239..1381627) [1389 bp, 462 aa]
           {ON} Anc_5.432 YOR119C
          Length = 462

 Score =  577 bits (1488), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/382 (73%), Positives = 324/382 (84%), Gaps = 21/382 (5%)

Query: 37  LSFNRAKTSKDKANRATVENVLDPRTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAG 96
           +SF + KT+KDKANRATVENVLDPRTM+FLK++ +RGVI+D NGCLSTGKEANVYHAFAG
Sbjct: 1   MSFTKGKTNKDKANRATVENVLDPRTMKFLKALTSRGVISDFNGCLSTGKEANVYHAFAG 60

Query: 97  TGKAPV-----------IDEETGKYEVLETD-GP--------RPEYAIKIYKTSILVFKD 136
             K              IDEE  K E LET   P        + EYA+KI+KTSILVFKD
Sbjct: 61  DSKLHSDDTDEPHDDNNIDEEALK-EKLETQINPEETRLQKDKKEYAVKIFKTSILVFKD 119

Query: 137 RERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVIPAPKPIEVKNNVLVME 196
           RERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNL+RIYQS VIP PKPIEVKNNVL+ME
Sbjct: 120 RERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSNVIPVPKPIEVKNNVLIME 179

Query: 197 FLSRGNGFASPKLKDYPYRDRGEIFHYYYTMVAYMRLLYQVCRLVHADLSEYNTIIHDDK 256
           FL+RG+GFASP+L+DYPY+DR E+ HYY+  +AYMRL+YQVCRLVHADLSEYN +IH++ 
Sbjct: 180 FLNRGDGFASPRLRDYPYKDREEVIHYYHIAIAYMRLMYQVCRLVHADLSEYNILIHNNL 239

Query: 257 LFMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGISIFPERVIFQFVISESLEKFKDD 316
           +++IDVSQSVEPEHPMSLDFLRMDIKN+N+YF++MGI IFPERVIFQF+ISE+L+KF  +
Sbjct: 240 MYIIDVSQSVEPEHPMSLDFLRMDIKNINMYFDRMGIDIFPERVIFQFIISETLDKFTGN 299

Query: 317 YHNVTDLVGYIAKNLPIKSTEQDEAEDEIFRSLHLVRSLGGLEERDFDRYTDGKFDLLKS 376
           Y++  DL  Y+AK LPIK T QDEAEDEIFRSL+LVR+L GLEERDFDRYTDGKFDLLKS
Sbjct: 300 YNDYNDLRDYVAKTLPIKKTAQDEAEDEIFRSLYLVRNLEGLEERDFDRYTDGKFDLLKS 359

Query: 377 LIAHDNERNFAASEQFEFDNAD 398
           LIAHDNE+NF+A+EQFE  + D
Sbjct: 360 LIAHDNEKNFSAAEQFEIQDDD 381

>Ecym_4763 Chr4 (1483168..1484784) [1617 bp, 538 aa] {ON} similar to
           Ashbya gossypii AER257W
          Length = 538

 Score =  578 bits (1490), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/467 (62%), Positives = 352/467 (75%), Gaps = 14/467 (2%)

Query: 1   MSLEDNFDKLTVSQRASDHINNQLLEKYSHKIKTDELSFNRAKTSKDKANRATVENVLDP 60
           M LE+   +L +    S+H N+++L+K++++IKTDELS  R KTSKDKANRATVENVLDP
Sbjct: 33  MDLENKLGRLKLLDH-SEHENSRILDKFANQIKTDELSVTRGKTSKDKANRATVENVLDP 91

Query: 61  RTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAGT----GKAPVIDEETGKYEVLETD 116
           RTMRFL+S+++RG+I + NGCLSTGKEANVYHAF        K   +  ++      E D
Sbjct: 92  RTMRFLRSLIHRGIITEFNGCLSTGKEANVYHAFGNAVDIVEKQHKVIRQSSICSDSEGD 151

Query: 117 GPRPEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQ 176
             + EYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIY 
Sbjct: 152 TKKVEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYH 211

Query: 177 SGVIPAPKPIEVKNNVLVMEFLSRGNGFASPKLKDYPYRDRGEIFHYYYTMVAYMRLLYQ 236
           +GVI  PKPIE+K+NVLVMEFL+RG+GFASPKLKDYPY DR EI+++Y+ MVAY+RLLYQ
Sbjct: 212 TGVISCPKPIEIKSNVLVMEFLNRGDGFASPKLKDYPYSDRQEIYYFYHVMVAYIRLLYQ 271

Query: 237 VCRLVHADLSEYNTIIHDDKLFMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGISIF 296
           VC+LVHADLSEYN+I+H+ KL++IDVSQSV+PEHPMSLDFLRMDIKN+N YF K+GI++F
Sbjct: 272 VCQLVHADLSEYNSIVHESKLYIIDVSQSVQPEHPMSLDFLRMDIKNINAYFVKIGINVF 331

Query: 297 PERVIFQFVISESLEKFKDDYHNVTDLVGYIAKNLPIKSTEQDEAEDEIFRSLHLVRSLG 356
            ER IFQFVISE LEKFK DY +   L  Y ++ LP+K TE+DE EDEIFRSLHLVR+LG
Sbjct: 332 SERAIFQFVISEKLEKFKGDYRSYDHLQKYASEYLPLKLTEEDEVEDEIFRSLHLVRNLG 391

Query: 357 GLEERDFDRYTDGKFDLLKSLIAHDNE---RNFAASEQFEFDNADHTXXXXXXXXXXXXX 413
           GLEE DFDR+T+GKFDLLKSL++ DN+   + F ASEQFE  ++                
Sbjct: 392 GLEEGDFDRFTNGKFDLLKSLVSQDNQKVAKTFTASEQFELSDSGTDSVDHGDSDEDLSS 451

Query: 414 XXXXXXXXXXXXXXXCAYYEDDEP------KILKGKRYEDKDVKKLR 454
                           +  E DE       K  KGK+YEDKD +KLR
Sbjct: 452 DESNSETENDSDDSQSSDEEPDEDTREHRIKEPKGKKYEDKDTRKLR 498

>ZYRO0F09988g Chr6 complement(811306..812688) [1383 bp, 460 aa] {ON}
           similar to uniprot|Q12196 YOR119C Saccharomyces
           cerevisiae RIO1 Essential protein that plays a role in
           cell cycle progression
          Length = 460

 Score =  524 bits (1349), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/394 (64%), Positives = 308/394 (78%), Gaps = 25/394 (6%)

Query: 1   MSLEDNFDKLTVSQRASDHINNQLLEKYSHKIKTDELSFNRA-KTSKDKANRATVENVLD 59
           MSLE  FD+L VS+      N ++LEKY ++I+    +  +  KT KDK++RATVENVLD
Sbjct: 1   MSLETEFDRLHVSKHQD---NTRILEKYENRIENGGFTSGKGNKTYKDKSDRATVENVLD 57

Query: 60  PRTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGKYEVLETDGPR 119
           PRTM+FL ++ NRGVI++ NGC+S+GKEANVYHAF   G+                    
Sbjct: 58  PRTMKFLSALTNRGVISEFNGCISSGKEANVYHAFGPEGQ-------------------- 97

Query: 120 PEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGV 179
            E AIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNL+RI+ SGV
Sbjct: 98  -ELAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRIHSSGV 156

Query: 180 IPAPKPIEVKNNVLVMEFLSRGNGFASPKLKDYPYRDRGEIFHYYYTMVAYMRLLYQVCR 239
           +P   P+EVK+NVLVM+FL+RG+G  SP+LKDY Y+D  E+ HYYY  +AYMRLLYQVCR
Sbjct: 157 VPTACPVEVKSNVLVMQFLNRGDGAPSPRLKDYQYKDELEVAHYYYKAIAYMRLLYQVCR 216

Query: 240 LVHADLSEYNTIIHDDKLFMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGISIFPER 299
           LVHADLSEYN ++H + L +IDVSQSVEP HPMSLDFLRMDIKN+N YF KMG+S+F ER
Sbjct: 217 LVHADLSEYNIVVHQNALHIIDVSQSVEPYHPMSLDFLRMDIKNINAYFGKMGVSLFQER 276

Query: 300 VIFQFVISESLEKFKDDYHNVTDLVGYIAKNLPIKSTEQDEAEDEIFRSLHLVRSLGGLE 359
           +IFQF+I+E+LE F+ DY    DLV Y+ ++LP+K+  +   EDEIFRSLHLVRSLGGLE
Sbjct: 277 MIFQFIIAETLEGFQGDYKTADDLVEYLVEHLPLKTPTEGADEDEIFRSLHLVRSLGGLE 336

Query: 360 ERDFDRYTDGKFDLLKSLIAHDNERNFAASEQFE 393
           ERDFDR+TDGKFDLLKSLIA+DNERN    +Q E
Sbjct: 337 ERDFDRFTDGKFDLLKSLIANDNERNLQRPQQQE 370

>NCAS0G01580 Chr7 (281438..282712) [1275 bp, 424 aa] {ON} Anc_2.44
          Length = 424

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 52/235 (22%), Positives = 99/235 (42%), Gaps = 47/235 (20%)

Query: 66  LKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGKYEVLETDGPRPEYAIK 125
           LK+M+NR  I  + G +  GKE+++Y   A  G                   PR     +
Sbjct: 85  LKTMLNRNTIYSIGGSIGVGKESDIYQVSAVDGN------------------PRVMKIHR 126

Query: 126 IYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVIPAPKP 185
           + +TS    ++   Y+      RN++   N   + ++ A KE++ +  +Y  G    P+P
Sbjct: 127 LGRTSFHTVRNNRDYL------RNTKQGVNWMYLSRLAANKEYQFMSMLYTKG-FEVPEP 179

Query: 186 IEVKNNVLVMEFLSRGNGFASPKLKDYP---YRDRGEIFHYYYTMVAYMRLLYQVCRLVH 242
            +   +++VME            +K YP    R    I   Y  ++ ++  L     L+H
Sbjct: 180 FDNSRHIIVMEL-----------IKGYPMRRLRKHKNIPKLYSDLMNFIVKLGN-SGLIH 227

Query: 243 ADLSEYNTII-------HDDKLFMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEK 290
            D +E+N +I       +D    +ID  Q +  +H  +  + + D+  +  +F+K
Sbjct: 228 CDFNEFNIMIKDKPEDENDCGFVVIDFPQCISIQHQDAAYYFQRDVDCIRRFFKK 282

>TPHA0H00920 Chr8 complement(188834..190123) [1290 bp, 429 aa] {ON}
           Anc_2.44 YNL207W
          Length = 429

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 51/232 (21%), Positives = 101/232 (43%), Gaps = 41/232 (17%)

Query: 66  LKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGKYEVLETDGPRPEYAIK 125
           LKS++N+  +  + G +  GKE+++Y             ++ G   VL+          +
Sbjct: 85  LKSLLNKDTVYSIGGTIGVGKESDIYEG----------SDKNGNKRVLKIH--------R 126

Query: 126 IYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVIPAPKP 185
           + +TS    K+   Y+      R S    N   + K+ A KE++ +  +Y  G    P+P
Sbjct: 127 LGRTSFHTVKNNRDYL------RRSNQGTNWMNLSKLAANKEYQFMSLLYTKG-FKVPEP 179

Query: 186 IEVKNNVLVMEFLSRGNGFASPKLKDYPYRDRGEIFHYYYTMVAYMRLLYQVCRLVHADL 245
            +   +V+VME +    G+   +L     R   +I   Y  ++ ++  L     L+H D 
Sbjct: 180 FDNSRHVIVMELI---RGYPMRRL-----RKHKDIPKLYSDLMKFILQLAN-SGLIHCDF 230

Query: 246 SEYNTIIHDD-------KLFMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEK 290
           +E+N +I D+          +ID  Q +  +H  +  + + D+  +  +F+K
Sbjct: 231 NEFNIMIKDEVEDENDCGFVVIDFPQCISIQHKDADFYFKRDVDGIRRFFKK 282

>Suva_14.136 Chr14 (250349..251629) [1281 bp, 426 aa] {ON} YNL207W
           (REAL)
          Length = 426

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 53/233 (22%), Positives = 101/233 (43%), Gaps = 43/233 (18%)

Query: 66  LKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGKYEVLETDG-PRPEYAI 124
           LK+M+NR  +  +   +  GKE+++                   Y+V + DG PR     
Sbjct: 85  LKTMLNRDTVYSVGNTIGVGKESDI-------------------YKVSDKDGNPRVIKIH 125

Query: 125 KIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVIPAPK 184
           ++ +TS    ++   Y+      R S    N   + ++ A KE++ +  +Y  G    P+
Sbjct: 126 RLGRTSFHTVRNNRDYL------RKSSQGANWMHLSRLAANKEYQFMSMLYSKG-FKVPE 178

Query: 185 PIEVKNNVLVMEFLSRGNGFASPKLKDYPYRDRGEIFHYYYTMVAYMRLLYQVCRLVHAD 244
           P +   +++VME +   NGF   +L     R    I   Y  ++ ++  L     L+H D
Sbjct: 179 PFDNSRHIVVMELI---NGFPMRRL-----RKHKNIPKLYSDLMCFIVQLGN-SGLIHCD 229

Query: 245 LSEYNTIIHDD-------KLFMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEK 290
            +E+N +I D+          +ID  Q V  +H  +  + + D+  +  +F+K
Sbjct: 230 FNEFNVMIKDELEDENDCGFVVIDFPQCVSIQHQDADYYFQRDVDCIRRFFKK 282

>CAGL0H08019g Chr8 (781773..783050) [1278 bp, 425 aa] {ON} highly
           similar to uniprot|P40160 Saccharomyces cerevisiae
           YNL207w
          Length = 425

 Score = 56.6 bits (135), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 51/234 (21%), Positives = 101/234 (43%), Gaps = 43/234 (18%)

Query: 66  LKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGKYEVLETDGPRPEYAIK 125
           L++++N+ V+  +   +  GKE+++Y      G A V+                     +
Sbjct: 85  LRTLLNQEVVYSVGNTIGVGKESDIYQVSDRNGTAKVMKIH------------------R 126

Query: 126 IYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVIPAPKP 185
           + +TS    K+   Y+      RNSR   N   + K+ A KEF  +  +Y  G I  P+ 
Sbjct: 127 LGRTSFHTVKNNRDYL------RNSRQGTNWMHLSKLAASKEFEFMSMLYAKGFI-VPQA 179

Query: 186 IEVKNNVLVMEFLSRGNGFASPKLKDYPYRDRGEIFHYYYTMVAYMRLLYQVCRLVHADL 245
                +V+VM+ +   +G+   +L     R+   I   Y  ++ ++  L     L+H D 
Sbjct: 180 YGCSRHVVVMDLI---DGYPMRRL-----REHKNIPKLYSDLMTFIVKLAN-SGLIHCDF 230

Query: 246 SEYNTIIHDDK---------LFMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEK 290
           +E+N +I +D+           +ID  Q +  +H  +  + + D+  +  +F+K
Sbjct: 231 NEFNIMIKNDEAVTDEKDCGFVVIDFPQCISIQHKDAEFYFKRDVDCIRRFFKK 284

>Smik_14.125 Chr14 (234660..235922) [1263 bp, 420 aa] {ON} YNL207W
           (REAL)
          Length = 420

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 51/232 (21%), Positives = 97/232 (41%), Gaps = 41/232 (17%)

Query: 66  LKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGKYEVLETDGPRPEYAIK 125
           LK+M+NR  +  +   +  GKE+++Y      GK                  PR     +
Sbjct: 85  LKTMLNRDTVYSVGNTIGVGKESDIYKVSDKNGK------------------PRVMKIHR 126

Query: 126 IYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVIPAPKP 185
           + +TS    ++   Y+      RNS    N   + ++ A KE++ +  +Y  G    P+P
Sbjct: 127 LGRTSFHSVRNNRDYL------RNSNQGANWMHLSRLAANKEYQFMSMLYSKG-FKVPEP 179

Query: 186 IEVKNNVLVMEFLSRGNGFASPKLKDYPYRDRGEIFHYYYTMVAYMRLLYQVCRLVHADL 245
            +   +++VME +    G+   +L     R    I   Y  ++ ++  L     L+H D 
Sbjct: 180 FDNSRHIVVMELIE---GYPMRRL-----RKHKNIPKLYSDLMCFIVELAN-SGLIHCDF 230

Query: 246 SEYNTII-------HDDKLFMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEK 290
           +E+N +I        D    +ID  Q V  +H  +  + + D+  +  +F+K
Sbjct: 231 NEFNIMIKNEVEDEKDCGFVVIDFPQCVSIQHQDADYYFQRDVDCIRRFFKK 282

>NDAI0F03600 Chr6 complement(860282..861547) [1266 bp, 421 aa] {ON}
           Anc_2.44 YNL207W
          Length = 421

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 46/232 (19%), Positives = 104/232 (44%), Gaps = 40/232 (17%)

Query: 66  LKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGKYEVLETDGPRPEYAIK 125
           LK+M+NR  +  + G +  GKE+++Y           + ++ G  +V++          +
Sbjct: 85  LKTMLNRDTVYSIGGSIGVGKESDIYQ----------VSDKNGVSKVMKIH--------R 126

Query: 126 IYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVIPAPKP 185
           + +TS    ++   Y+      +N ++  N   + ++ A KE++ +  +Y  G    P+P
Sbjct: 127 LGRTSFHTVRNNRDYLK-----KNVKNGVNWMYLSQLAANKEYQFMSMLYTKG-FEVPEP 180

Query: 186 IEVKNNVLVMEFLSRGNGFASPKLKDYPYRDRGEIFHYYYTMVAYMRLLYQVCRLVHADL 245
            +   ++++M  +    G+   +L     R    I   Y  ++ ++  L     L+H D 
Sbjct: 181 FDNSRHIIIMGLIE---GYPMRRL-----RKHNNIPKLYNDLMKFIVRLAN-SGLIHCDF 231

Query: 246 SEYNTIIHDD-------KLFMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEK 290
           +E+N +I D+          +ID  Q +  +HP +  + + D+  +  +F+K
Sbjct: 232 NEFNIMIKDEVEDENDCGFVVIDFPQCISIQHPDAEFYFQRDVDCIRRFFKK 283

>KAFR0A07760 Chr1 complement(1560351..1561628) [1278 bp, 425 aa]
           {ON} Anc_2.44 YNL207W
          Length = 425

 Score = 53.1 bits (126), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 49/235 (20%), Positives = 103/235 (43%), Gaps = 46/235 (19%)

Query: 66  LKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGKYEVLETDGPRPEYAIK 125
           LK+M+NR  +  + G +  GKE+++Y           + +  G  +V++          +
Sbjct: 85  LKTMLNRETVYSVGGTIGVGKESDIYR----------VSDRNGTEKVMKIH--------R 126

Query: 126 IYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVIPAPKP 185
           + +TS    K++  Y+      +N+++  N   + KI A KE++ +  ++  G    P+ 
Sbjct: 127 LGRTSFHTVKNKRDYIK-----KNAKNGVNWMYLSKIAAGKEYQFMTLLFAKG-FDVPEA 180

Query: 186 IEVKNNVLVMEFLSRGNGFASPKLKDYP---YRDRGEIFHYYYTMVAYMRLLYQVCRLVH 242
            +   + +VME            +K YP    R    I   Y  +++++  L     L+H
Sbjct: 181 FDCSRHCIVMEL-----------IKGYPMRRLRKHKNIPKLYSDLMSFIVKLGN-SGLIH 228

Query: 243 ADLSEYNTII-------HDDKLFMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEK 290
            D +E+N +I       +D    +ID  Q +  +H  +  + + D+  +  +F+K
Sbjct: 229 CDFNEFNIMIKDKVEDENDPGFVVIDFPQCISIQHNDAEFYFKRDVDCIRRFFKK 283

>Skud_14.129 Chr14 (244224..245501) [1278 bp, 425 aa] {ON} YNL207W
           (REAL)
          Length = 425

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 48/232 (20%), Positives = 96/232 (41%), Gaps = 41/232 (17%)

Query: 66  LKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGKYEVLETDGPRPEYAIK 125
           LK+M+NR  +  +   +  GKE+++Y      G                   PR     +
Sbjct: 85  LKTMLNRNTVYSVGNTIGVGKESDIYKVSDKNGN------------------PRVMKIHR 126

Query: 126 IYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVIPAPKP 185
           + +TS    ++   Y+      +NS    N   + ++ A KE++ +  +Y  G    P+P
Sbjct: 127 LGRTSFHSVRNNRDYL------KNSNQGANWMHLSRLAANKEYQFMSMLYSKG-FKVPEP 179

Query: 186 IEVKNNVLVMEFLSRGNGFASPKLKDYPYRDRGEIFHYYYTMVAYMRLLYQVCRLVHADL 245
            +   +++VME +    G+   +L     R    I   Y  ++ ++  L     L+H D 
Sbjct: 180 FDNSRHIVVMELIE---GYPMRRL-----RKHKNIPKLYSDLMCFVVELAN-SGLIHCDF 230

Query: 246 SEYNTII-------HDDKLFMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEK 290
           +E+N ++        D    +ID  Q V  +H  +  + + D+  +  +F+K
Sbjct: 231 NEFNIMVKDKVEDEQDCGFVVIDFPQCVSIQHQDADYYFQRDVDCIRRFFKK 282

>ZYRO0C10340g Chr3 complement(793323..794573) [1251 bp, 416 aa] {ON}
           similar to uniprot|P40160 Saccharomyces cerevisiae
           YNL207W RIO2 Protein required for cell viability
          Length = 416

 Score = 50.1 bits (118), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 49/233 (21%), Positives = 100/233 (42%), Gaps = 42/233 (18%)

Query: 66  LKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGKYEVLETDGPRPEYAIK 125
           +K+M+NR  +  +   +  GKE+++Y           + +  G  +V++          +
Sbjct: 85  IKAMLNRDTVYSIGNTIGVGKESDIYK----------VSDRNGNAQVMKIH--------R 126

Query: 126 IYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVIPAPKP 185
           + +TS    ++   Y+      ++SR   +   +  + A KE+  L  ++  G    P+ 
Sbjct: 127 LGRTSFTSVRNNRDYL------KHSRQGTSWMHLSLLAAHKEYEFLALLHSRG-FQVPEA 179

Query: 186 IEVKNNVLVMEFLSRGNGFASPKLKDYPYRDRGEIFHYYYTMVAYMRLLYQVCRLVHADL 245
            +   ++++MEF+    GF    L     R    I   Y  ++ +   L +   L+H D 
Sbjct: 180 FDNSRHMVLMEFI---KGFPMKNL-----RTHSNIPKLYSDLMKFAVDLAK-SGLIHCDY 230

Query: 246 SEYNTIIHDD--------KLFMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEK 290
           +E+N +I D            +ID  Q +  +HP +  F R DI+ +  +F+K
Sbjct: 231 NEFNIMIKDQDTTDSSDCGFVVIDFPQCISIQHPDAEFFFRRDIECIRRFFKK 283

>Kwal_23.4563 s23 (768125..769402) [1278 bp, 425 aa] {ON} YNL207W
           (RIO2) -  [contig 4] FULL
          Length = 425

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 52/263 (19%), Positives = 112/263 (42%), Gaps = 55/263 (20%)

Query: 66  LKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGKYEVLETDGPRPEYAIK 125
           LK+M+NR  +  +   +  GKE++VY   A  G                   PR     +
Sbjct: 85  LKAMLNRDTVYSIGNVIGVGKESDVYRVSAKDGT------------------PRVLKIHR 126

Query: 126 IYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMI-KIWAEKEFRNLKRIYQSGVIPAPK 184
           + +TS    K+   Y+         R+Q      + ++ A KE++ +  +Y  G +  P+
Sbjct: 127 LGRTSFTTVKNNRDYL--------KRNQSGSWMFLSRLAANKEYQFMSLLYSKGFV-VPE 177

Query: 185 PIEVKNNVLVMEFLSRGNGFASPKLKDYPYRDRGEIFHYYYTMVAYMRLLYQVCRLVHAD 244
           P +   ++++M+ +   +G+   ++     R    +   Y  +++++  L     L+H D
Sbjct: 178 PFDNSRHMILMQLI---DGYPMRRM-----RSHKNLPKLYSDLMSFIVKLANHG-LIHCD 228

Query: 245 LSEYNTIIH-------DDKLFMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGISIFP 297
            +E+N +I        D    +ID  Q +  +H  + ++ + D+  +  +F K       
Sbjct: 229 FNEFNIMIKNKVTDADDCGFIVIDFPQCISIQHQDAEEYFKRDVDCIRRFFAK------- 281

Query: 298 ERVIFQFVISESL---EKFKDDY 317
            ++ ++ V+ ES+   + F D Y
Sbjct: 282 -KLKYEPVVDESMLDEDGFGDGY 303

>Ecym_6449 Chr6 complement(873295..874548) [1254 bp, 417 aa] {ON}
           similar to Ashbya gossypii ABL166W
          Length = 417

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 47/234 (20%), Positives = 98/234 (41%), Gaps = 46/234 (19%)

Query: 66  LKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGKYEVLETDGPRPEYAIK 125
           LKS++N+  +  +   +  GKE+++Y     T +A V+                     +
Sbjct: 85  LKSLLNKNALYSVGNTIGVGKESDIYQVSTSTSEALVMKIH------------------R 126

Query: 126 IYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVIPAPKP 185
           + +TS    K+   Y+    R +++   H    +  + A KE++ +  +Y  G    P+P
Sbjct: 127 LGRTSFHTVKNNRDYLK---RGQSASWMH----LSSLAANKEYQFMNLLYSKG-FKVPRP 178

Query: 186 IEVKNNVLVMEFLSRGNGFASPKLKDYPYRDRGEIFHYYYTMVAYMRLLYQVCR--LVHA 243
            +   ++++ME+           +K YP R   E           M+ + Q+    L+H 
Sbjct: 179 YDNSRHIILMEY-----------IKGYPMRRLREHKDLPRLYSELMKFIVQLGNHGLIHC 227

Query: 244 DLSEYNTIIHDDK-------LFMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEK 290
           D +E+N +I D           +ID  Q +  +H  +  + + D++ +  +F+K
Sbjct: 228 DFNEFNIMIKDKTDGPDDLGFIVIDFPQCISIQHKDAEYYFQRDVECIRRFFKK 281

>TDEL0A00860 Chr1 (143723..144982) [1260 bp, 419 aa] {ON} Anc_2.44
           YNL207W
          Length = 419

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 49/232 (21%), Positives = 96/232 (41%), Gaps = 41/232 (17%)

Query: 66  LKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGKYEVLETDGPRPEYAIK 125
           +KSM+NR  +      +  GKE+++Y      G A V+                     +
Sbjct: 85  VKSMLNRDTVYSFGNTIGVGKESDIYQVSDKNGVAKVMKIH------------------R 126

Query: 126 IYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVIPAPKP 185
           + +TS    K+   Y+      + +    N   +  + A+KE++ +  +Y  G I  P+P
Sbjct: 127 LGRTSFHTVKNNRDYL------KKNAHGTNWMHLSLLAAQKEYQFMSLLYSKGFI-VPQP 179

Query: 186 IEVKNNVLVMEFLSRGNGFASPKLKDYPYRDRGEIFHYYYTMVAYMRLLYQVCRLVHADL 245
            +   ++++ME +   +GF    L     R+   I   Y  ++ +   L     L+H D 
Sbjct: 180 YDNSRHIVLMELI---DGFPMRNL-----RNHSNIPKLYSDLMTFAVKLAN-SGLIHCDF 230

Query: 246 SEYNTII-------HDDKLFMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEK 290
           +E+N +I        D    +ID  Q +  +H  +  + + DI+ +  +F K
Sbjct: 231 NEFNIMIKNTVEDSKDCGFVVIDFPQCISIQHKDADFYFQRDIECIRRFFRK 282

>YNL207W Chr14 (255353..256630) [1278 bp, 425 aa] {ON}
           RIO2Essential serine kinase involved in the processing
           of the 20S pre-rRNA into mature 18S rRNA; has similarity
           to Rio1p
          Length = 425

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 47/232 (20%), Positives = 96/232 (41%), Gaps = 41/232 (17%)

Query: 66  LKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGKYEVLETDGPRPEYAIK 125
           LK+M+NR  +  +   +  GKE+++Y      G                   PR     +
Sbjct: 85  LKTMLNRDTVYSVGNTIGVGKESDIYKVSDKNGN------------------PRVMKIHR 126

Query: 126 IYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVIPAPKP 185
           + +TS    ++   Y+      + S    N   + ++ A KE++ +  +Y  G    P+P
Sbjct: 127 LGRTSFHSVRNNRDYL------KKSNQGANWMHLSRLAANKEYQFMSMLYSKG-FKVPEP 179

Query: 186 IEVKNNVLVMEFLSRGNGFASPKLKDYPYRDRGEIFHYYYTMVAYMRLLYQVCRLVHADL 245
            +   +++VME +    G+   +L     R    I   Y  ++ ++  L     L+H D 
Sbjct: 180 FDNSRHIVVMELIE---GYPMRRL-----RKHKNIPKLYSDLMCFIVDLAN-SGLIHCDF 230

Query: 246 SEYNTII-------HDDKLFMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEK 290
           +E+N +I       +D    +ID  Q +  +H  +  + + D+  +  +F+K
Sbjct: 231 NEFNIMIKDKLEDENDCGFVVIDFPQCISIQHQDADYYFQRDVDCIRRFFKK 282

>SAKL0E13552g Chr5 complement(1118842..1120101) [1260 bp, 419 aa]
           {ON} highly similar to uniprot|P40160 YNL207W
           Saccharomyces cerevisiae RIO2 Protein required for cell
           viability
          Length = 419

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 45/232 (19%), Positives = 100/232 (43%), Gaps = 42/232 (18%)

Query: 66  LKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGKYEVLETDGPRPEYAIK 125
           LK+M+NR  +  +   +  GKE+++Y           + +  G   V++          +
Sbjct: 85  LKAMLNRDTVYSIGATIGVGKESDIYQ----------VSDRNGNSRVMKIH--------R 126

Query: 126 IYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVIPAPKP 185
           + +TS    K+   Y+ G       R   +   + ++ A KE++ +  +Y  G    P+P
Sbjct: 127 LGRTSFQTVKNNRDYLKG-------RQSASWMFLSRLAANKEYQFMSLLYSKG-FKVPEP 178

Query: 186 IEVKNNVLVMEFLSRGNGFASPKLKDYPYRDRGEIFHYYYTMVAYMRLLYQVCRLVHADL 245
            +   ++++ME +    G+   +L     R   ++   Y  ++ ++  L     L+H D 
Sbjct: 179 FDNSRHIILMELIK---GYPMRRL-----RKHHDLPKLYSDLMCFIVNLANHG-LIHCDF 229

Query: 246 SEYNTIIHDD-------KLFMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEK 290
           +E+N +I D+          +ID  Q +  +H  +  + + D+  +  +F+K
Sbjct: 230 NEFNIMIKDEVDDENDCGFVVIDFPQCISIQHKDAEYYFQRDVDCIRRFFKK 281

>Kpol_400.7 s400 complement(15841..17118) [1278 bp, 425 aa] {ON}
           complement(15841..17118) [1278 nt, 426 aa]
          Length = 425

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 47/232 (20%), Positives = 100/232 (43%), Gaps = 41/232 (17%)

Query: 66  LKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGKYEVLETDGPRPEYAIK 125
           LKS++N+  +  +   +  GKE+++Y A           +  G++ V++          +
Sbjct: 85  LKSLLNKDTVYSVGNTIGVGKESDIYQA----------SDRNGEHRVMKIH--------R 126

Query: 126 IYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVIPAPKP 185
           + +TS    K+   Y+      +      +   + ++ A KE++ +  +Y  G    PK 
Sbjct: 127 LGRTSFHTVKNNRDYL------KKYNQGASWMFLSRVAANKEYQFMSLLYSKG-FTVPKA 179

Query: 186 IEVKNNVLVMEFLSRGNGFASPKLKDYPYRDRGEIFHYYYTMVAYMRLLYQVCRLVHADL 245
            +   +++VME +    GF   +L     R    I   Y  ++ ++  L     L+H D 
Sbjct: 180 FDNSRHIVVMELIK---GFPLRRL-----RKHDNIPKLYSDLMCFIVNLAN-SGLIHCDF 230

Query: 246 SEYNTIIHDDK-------LFMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEK 290
           +E+N +I D+K         +ID  Q +  +H  +  + + D+  +  +F+K
Sbjct: 231 NEFNIMIKDEKDDENDCGFIVIDFPQCISIQHKDADFYFKRDVDCIRRFFKK 282

>KLLA0D19008g Chr4 complement(1598807..1600075) [1269 bp, 422 aa]
           {ON} highly similar to uniprot|P40160 YNL207W
           Saccharomyces cerevisiae RIO2 Protein required for cell
           viability,
          Length = 422

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 51/235 (21%), Positives = 104/235 (44%), Gaps = 48/235 (20%)

Query: 66  LKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGKYEVLETDGPRPEYAIK 125
           LKSM+NR  +  +   +  GKE+++Y           + + +G+ +VL+          +
Sbjct: 85  LKSMLNRDTLYSVGTTIGVGKESDIYQ----------VSDRSGESKVLKIH--------R 126

Query: 126 IYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVIPAPKP 185
           + +TS    K+   Y+      RN +S  +   + K+ A KE++ +  +Y       P+P
Sbjct: 127 LGRTSFHTIKNNRDYL------RNGQSA-SWMHLSKLAANKEYQFMTMLYDRN-FEVPQP 178

Query: 186 IEVKNNVLVMEFLSRGNGFASPKLKDYPYRDRGE---IFHYYYTMVAYMRLLYQVCRLVH 242
            +   + ++ME + RG          YP R  G+   +   Y  ++ ++  L     L+H
Sbjct: 179 FDNSRHCVLMEHI-RG----------YPMRRLGKHKNLPKLYSDLMCFIVKLANHG-LIH 226

Query: 243 ADLSEYNTIIHDD-------KLFMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEK 290
            D +E+N +I D+          +ID  Q +  +H  +  + + D+  +  +F+K
Sbjct: 227 CDFNEFNIMIKDEPEGEDDPGYVVIDFPQCISIQHQDAAYYFKRDVDCIRRFFKK 281

>ABL166W Chr2 (88546..89790) [1245 bp, 414 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YNL207W (RIO2)
          Length = 414

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 49/236 (20%), Positives = 96/236 (40%), Gaps = 50/236 (21%)

Query: 66  LKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGKYEVLETDGPRPEYAIK 125
           LKS++ +  I  +   +  GKE+++Y                       +D       +K
Sbjct: 85  LKSLLEKNAIYSVGNTIGVGKESDIYQV---------------------SDAASQSLVMK 123

Query: 126 IY---KTSILVFKDRERYVDGEFRFRNSRSQH-NPRKMIKIWAEKEFRNLKRIYQSGVIP 181
           I+   +TS    K +  Y+         R Q  N  ++  + AE+E+  +  +Y  G   
Sbjct: 124 IHRLGRTSFHTVKTKREYL--------KRGQSANWMRLSHLSAEREYAYMCLLYSKG-FS 174

Query: 182 APKPIEVKNNVLVMEFLSRGNGFASPKLKDYPYRDRGEIFHYYYTMVAYMRLLYQVCRLV 241
            PKP     + +VME++    G+   +L     R    +   Y  ++A++  L     ++
Sbjct: 175 VPKPYANSRHAIVMEYI---RGYPMRRL-----RSHSNVPKLYSDLMAFVVKLANHG-MI 225

Query: 242 HADLSEYNTIIHDD-------KLFMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEK 290
           H D +E+N +I DD          +ID  Q +  +H  +  + + D+  +  +F+K
Sbjct: 226 HCDFNEFNIMIKDDIDDPEDQGFVVIDFPQCISIQHQEAEYYFKRDVDCIRRFFKK 281

>KNAG0F01060 Chr6 (188811..190097) [1287 bp, 428 aa] {ON} Anc_2.44
           YNL207W
          Length = 428

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 46/234 (19%), Positives = 104/234 (44%), Gaps = 42/234 (17%)

Query: 66  LKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGKYEVLETDGPRPEYAIK 125
           LK+M+NR  +  +   +  GKE+++Y           + ++ G  +V++          +
Sbjct: 85  LKTMLNRDSLYSVGNTIGVGKESDIYK----------VSDKNGVEKVMKIH--------R 126

Query: 126 IYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVIPAPKP 185
           + +TS    ++   Y+      +NS++  N   + K+ A KE++ +  ++  G    P+P
Sbjct: 127 LGRTSFHTVRNNRDYLR-----KNSKNGANWMFLSKLAAAKEYQFMSLLHSRG-FRVPEP 180

Query: 186 IEVKNNVLVMEFLSRGNGFASPKLKDYPYRDRGEIFHYYYTMVAYMRLLYQVCRLVHADL 245
            +   ++++ME +    GF   +L     R    +   Y  ++ ++  L     L+H D 
Sbjct: 181 FDHSRHIIIMELIK---GFPMTRL-----RKHQNVPKLYSDLMKFILELGN-SGLIHCDF 231

Query: 246 SEYNTII---------HDDKLFMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEK 290
           +E+N +I         +D    +ID  Q +  +H  +  + + D+  +  +F+K
Sbjct: 232 NEFNIMIKDKLDGSDPNDTGFIVIDFPQCISIQHQDASFYFQRDVDCIRRFFKK 285

>KLTH0B07722g Chr2 complement(625231..626517) [1287 bp, 428 aa] {ON}
           similar to uniprot|P40160 Saccharomyces cerevisiae
           YNL207W RIO2 Protein required for cell viability
          Length = 428

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 47/236 (19%), Positives = 97/236 (41%), Gaps = 50/236 (21%)

Query: 66  LKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGKYEVLETDGPRPEYAIK 125
           L++M++R  I  +   +  GKE++VY   A  G A V+                     +
Sbjct: 85  LRAMLSRDTIYSVGNVIGVGKESDVYRVSAKDGSARVLKIH------------------R 126

Query: 126 IYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMI-KIWAEKEFRNLKRIYQSGVIPAPK 184
           + +TS    K+   Y+         R+Q      + ++ A KE++ +  ++  G    P+
Sbjct: 127 LGRTSFTTVKNNRDYL--------KRNQSGSWMFLSRLAANKEYQFMSLLHSKG-FTVPE 177

Query: 185 PIEVKNNVLVMEFLSRGNGFASPKLKDYPYRD---RGEIFHYYYTMVAYMRLLYQVCRLV 241
           P +   ++++ME +             YP R+      +   Y  ++ ++  L     L+
Sbjct: 178 PFDNSRHMILMELID-----------GYPMRNMRLHKNLPKLYSDLMLFIVKLANHG-LI 225

Query: 242 HADLSEYNTII-------HDDKLFMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEK 290
           H D +E+N +I        D+   +ID  Q +  +H  +  F + D+  +  +F+K
Sbjct: 226 HCDFNEFNIMIKNSVTGPEDNGFIVIDFPQCISIQHQDAEFFFKRDVDCIRRFFKK 281

>KLLA0F15576g Chr6 (1437595..1439133) [1539 bp, 512 aa] {ON} similar
           to uniprot|Q07950 Saccharomyces cerevisiae YLR020C YEH2
           Steryl ester hydrolase catalyzes steryl ester hydrolysis
           at the plasma membrane involved in sterol metabolism
          Length = 512

 Score = 35.0 bits (79), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 32/64 (50%), Gaps = 7/64 (10%)

Query: 118 PRPEYAIKIYKTSILVFKDRE-RYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQ 176
           P PE   KI     L+F  R+ R VDGE R  N    H P  + KIW   E+ +L  ++ 
Sbjct: 435 PLPENWPKI-----LLFTPRQDRLVDGE-RLINHFINHEPHSVYKIWYIDEYSHLDVLWA 488

Query: 177 SGVI 180
           S VI
Sbjct: 489 SDVI 492

>Ecym_1119 Chr1 complement(244327..246702) [2376 bp, 791 aa] {ON}
           similar to Ashbya gossypii AFR647C
          Length = 791

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 13/49 (26%), Positives = 32/49 (65%), Gaps = 3/49 (6%)

Query: 126 IYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRI 174
           +++T  + F+D++R+ +G    R   +QH+P +++K+    E+ ++KR+
Sbjct: 312 LFETKPMYFEDQKRFFNGVIEIR---TQHDPLELLKLCKRIEYEDMKRV 357

>TBLA0G00370 Chr7 (72205..73539) [1335 bp, 444 aa] {ON} Anc_2.44
           YNL207W
          Length = 444

 Score = 32.3 bits (72), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 35/187 (18%), Positives = 84/187 (44%), Gaps = 31/187 (16%)

Query: 66  LKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGKYEVLETDGPRPEYAIK 125
           + S++    I  +   +  GKE+++Y           + +++G   V++          +
Sbjct: 85  MNSLLLHDTIYSIGHMIGIGKESDIYK----------VSDKSGNTRVMKIH--------R 126

Query: 126 IYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVIPAPKP 185
           + +TS    K+   Y+      +NS+   N   +  + A KE++ +  +Y S     PKP
Sbjct: 127 LGRTSFQTVKNNRDYLK-----KNSKIGTNWMVLSGLAALKEYQFMSILY-SNDFKVPKP 180

Query: 186 IEVKNNVLVMEFLSRGNGFASPKLKDYPYRDRGEIFHYYYTMVAYMRLLYQVCRLVHADL 245
            +   ++++ME +    G+   +L+    +++ ++   Y  ++ ++  L     L+H D 
Sbjct: 181 FDNSRHIIIMELIE---GYPMRRLRS---KNQLKLAKLYNELMCFIVKLAD-HGLIHCDF 233

Query: 246 SEYNTII 252
           +E+N +I
Sbjct: 234 NEFNIMI 240

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.137    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 48,921,983
Number of extensions: 2192816
Number of successful extensions: 6680
Number of sequences better than 10.0: 57
Number of HSP's gapped: 6753
Number of HSP's successfully gapped: 66
Length of query: 486
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 372
Effective length of database: 40,409,475
Effective search space: 15032324700
Effective search space used: 15032324700
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)