Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_15.2965.431ON56656628800.0
YOR118W (RTC5)5.431ON56756725450.0
Suva_8.1715.431ON56756724190.0
Skud_15.2815.431ON56755523930.0
SAKL0G02464g5.431ON56355014880.0
NCAS0H020505.431ON57355314220.0
TDEL0E019405.431ON56756814000.0
NDAI0C016105.431ON58456813760.0
KLTH0F16126g5.431ON55454813470.0
Kwal_55.214375.431ON55454913301e-178
ZYRO0F09966g5.431ON55455013021e-174
Kpol_1016.75.431ON56254312771e-170
KLLA0E21143g5.431ON57255212711e-169
TPHA0H017905.431ON56555112201e-162
Ecym_47645.431ON56655411951e-158
KNAG0B042305.431ON57755211721e-154
CAGL0L11616g5.431ON55555111691e-154
AER258C5.431ON5575489031e-114
TBLA0A065305.431ON4925337242e-88
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_15.296
         (566 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_15.296 Chr15 (507990..509690) [1701 bp, 566 aa] {ON} YOR118...  1113   0.0  
YOR118W Chr15 (546857..548560) [1704 bp, 567 aa] {ON}  RTC5Prote...   984   0.0  
Suva_8.171 Chr8 (304635..306338) [1704 bp, 567 aa] {ON} YOR118W ...   936   0.0  
Skud_15.281 Chr15 (503290..504993) [1704 bp, 567 aa] {ON} YOR118...   926   0.0  
SAKL0G02464g Chr7 (204358..206049) [1692 bp, 563 aa] {ON} simila...   577   0.0  
NCAS0H02050 Chr8 (398606..400327) [1722 bp, 573 aa] {ON} Anc_5.4...   552   0.0  
TDEL0E01940 Chr5 complement(365414..367117) [1704 bp, 567 aa] {O...   543   0.0  
NDAI0C01610 Chr3 complement(343850..345604) [1755 bp, 584 aa] {O...   534   0.0  
KLTH0F16126g Chr6 complement(1308133..1309797) [1665 bp, 554 aa]...   523   0.0  
Kwal_55.21437 s55 complement(836842..838506) [1665 bp, 554 aa] {...   516   e-178
ZYRO0F09966g Chr6 (809604..811268) [1665 bp, 554 aa] {ON} simila...   506   e-174
Kpol_1016.7 s1016 complement(14315..16003) [1689 bp, 562 aa] {ON...   496   e-170
KLLA0E21143g Chr5 complement(1888085..1889803) [1719 bp, 572 aa]...   494   e-169
TPHA0H01790 Chr8 (412229..413926) [1698 bp, 565 aa] {ON} Anc_5.4...   474   e-162
Ecym_4764 Chr4 complement(1484832..1486532) [1701 bp, 566 aa] {O...   464   e-158
KNAG0B04230 Chr2 complement(803845..805578) [1734 bp, 577 aa] {O...   456   e-154
CAGL0L11616g Chr12 complement(1240790..1242457) [1668 bp, 555 aa...   454   e-154
AER258C Chr5 complement(1111936..1113609) [1674 bp, 557 aa] {ON}...   352   e-114
TBLA0A06530 Chr1 complement(1600111..1601589) [1479 bp, 492 aa] ...   283   2e-88

>Smik_15.296 Chr15 (507990..509690) [1701 bp, 566 aa] {ON} YOR118W
           (REAL)
          Length = 566

 Score = 1113 bits (2880), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 543/566 (95%), Positives = 543/566 (95%)

Query: 1   MGQXXXXXXXXXXXXXXXRKFANDRDVLTYFNTKAQRQITVPELVSLKGNLQIENLNTPI 60
           MGQ               RKFANDRDVLTYFNTKAQRQITVPELVSLKGNLQIENLNTPI
Sbjct: 1   MGQSSSISSNNEEGSSHSRKFANDRDVLTYFNTKAQRQITVPELVSLKGNLQIENLNTPI 60

Query: 61  SHKRLCNFLYFPQNHTIIVGIVTNMLRVLSNFPLVNSSYEPITGYGLLKCIVLLNKSRCE 120
           SHKRLCNFLYFPQNHTIIVGIVTNMLRVLSNFPLVNSSYEPITGYGLLKCIVLLNKSRCE
Sbjct: 61  SHKRLCNFLYFPQNHTIIVGIVTNMLRVLSNFPLVNSSYEPITGYGLLKCIVLLNKSRCE 120

Query: 121 KFLKIKSYDQLKLLFISLSLQKTDKEELSEDNENNGVKEKNIKQIITGFDDVDTEVLYLP 180
           KFLKIKSYDQLKLLFISLSLQKTDKEELSEDNENNGVKEKNIKQIITGFDDVDTEVLYLP
Sbjct: 121 KFLKIKSYDQLKLLFISLSLQKTDKEELSEDNENNGVKEKNIKQIITGFDDVDTEVLYLP 180

Query: 181 ADFMLQFLTWLLILSVECPTTNSTINNETNVQWDKFKIPAMNLLRTMNPDVVNNIESHFI 240
           ADFMLQFLTWLLILSVECPTTNSTINNETNVQWDKFKIPAMNLLRTMNPDVVNNIESHFI
Sbjct: 181 ADFMLQFLTWLLILSVECPTTNSTINNETNVQWDKFKIPAMNLLRTMNPDVVNNIESHFI 240

Query: 241 TYQQFSTAIRTVMPNLLKPLENLMEHFLYLQHDLVDYDTNLSSIQDSKIMTPALLAQLST 300
           TYQQFSTAIRTVMPNLLKPLENLMEHFLYLQHDLVDYDTNLSSIQDSKIMTPALLAQLST
Sbjct: 241 TYQQFSTAIRTVMPNLLKPLENLMEHFLYLQHDLVDYDTNLSSIQDSKIMTPALLAQLST 300

Query: 301 GLPKELFIQKLQSLYIGRKSGFSMRSLQAKVFKWMAPSILVVSGVRITNSEEYAANKNPR 360
           GLPKELFIQKLQSLYIGRKSGFSMRSLQAKVFKWMAPSILVVSGVRITNSEEYAANKNPR
Sbjct: 301 GLPKELFIQKLQSLYIGRKSGFSMRSLQAKVFKWMAPSILVVSGVRITNSEEYAANKNPR 360

Query: 361 YRHFLEEFPILKDSDQKMDASLMNKKKTTFAVYIDDPWKVTNKDYFGDLNTRIIQISPRQ 420
           YRHFLEEFPILKDSDQKMDASLMNKKKTTFAVYIDDPWKVTNKDYFGDLNTRIIQISPRQ
Sbjct: 361 YRHFLEEFPILKDSDQKMDASLMNKKKTTFAVYIDDPWKVTNKDYFGDLNTRIIQISPRQ 420

Query: 421 DIYKVNKKGTVYFNTXXXXXXXXNKQPLIKSASKRYVPGNVSLTFDSTLEFAVFRNTGYG 480
           DIYKVNKKGTVYFNT        NKQPLIKSASKRYVPGNVSLTFDSTLEFAVFRNTGYG
Sbjct: 421 DIYKVNKKGTVYFNTIGGGIGIGNKQPLIKSASKRYVPGNVSLTFDSTLEFAVFRNTGYG 480

Query: 481 GSLDPGLLSMERKEENSSFELHILIQDVEVWGCGGEKELEEQIKQLAWEEAESKRRQQIN 540
           GSLDPGLLSMERKEENSSFELHILIQDVEVWGCGGEKELEEQIKQLAWEEAESKRRQQIN
Sbjct: 481 GSLDPGLLSMERKEENSSFELHILIQDVEVWGCGGEKELEEQIKQLAWEEAESKRRQQIN 540

Query: 541 LRSLGEDRALLEMAGLVGQHQGGGSM 566
           LRSLGEDRALLEMAGLVGQHQGGGSM
Sbjct: 541 LRSLGEDRALLEMAGLVGQHQGGGSM 566

>YOR118W Chr15 (546857..548560) [1704 bp, 567 aa] {ON}  RTC5Protein
           of unknown function; green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm; null
           mutation suppresses cdc13-1 temperature sensitivity
          Length = 567

 Score =  984 bits (2545), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 473/567 (83%), Positives = 511/567 (90%), Gaps = 1/567 (0%)

Query: 1   MGQXXXXXXXXXXXXXXXRKFANDRDVLTYFNTKAQRQITVPELVSLKGNLQIENLNTPI 60
           MGQ               +KF N +D+L YFN KAQ+Q+T+PELVS KGNLQIE+LNTPI
Sbjct: 1   MGQSSSISSSNEEGSSHSKKFTNSKDILAYFNNKAQQQVTIPELVSFKGNLQIEDLNTPI 60

Query: 61  SHKRLCNFLYFPQNHTIIVGIVTNMLRVLSNFPLVNSSYEPITGYGLLKCIVLLNKSRCE 120
           SHK LCN LYFPQNH +IVGIVTNMLRVLSNFPL+ SSYEPITGYGLLKCI+LLN++RC 
Sbjct: 61  SHKALCNSLYFPQNHAMIVGIVTNMLRVLSNFPLMKSSYEPITGYGLLKCILLLNRARCA 120

Query: 121 KFLKIKSYDQLKLLFISLSLQKTDKEELSEDNENNGVKEKNIKQIITGFDDVDTEVLYLP 180
           KFLK KSYDQLKLLFISLSLQKTDKEELSE++EN+G KE  IKQIITGFDDVDTE+L +P
Sbjct: 121 KFLKTKSYDQLKLLFISLSLQKTDKEELSEESENDGNKELTIKQIITGFDDVDTEMLCIP 180

Query: 181 ADFMLQFLTWLLILSVECPTTNSTINN-ETNVQWDKFKIPAMNLLRTMNPDVVNNIESHF 239
           ADFMLQFLTWLLIL+V+CPTTNS ++N ET+ QW  FK+ A+NLLRTMNPDVV +IESH 
Sbjct: 181 ADFMLQFLTWLLILTVDCPTTNSKLDNTETHDQWGNFKVSALNLLRTMNPDVVGDIESHS 240

Query: 240 ITYQQFSTAIRTVMPNLLKPLENLMEHFLYLQHDLVDYDTNLSSIQDSKIMTPALLAQLS 299
           IT+QQFSTAIRTVMPNLLKPLENLMEHF YLQHDLVD+DTNLSSIQDSK+MTPALLAQLS
Sbjct: 241 ITFQQFSTAIRTVMPNLLKPLENLMEHFFYLQHDLVDHDTNLSSIQDSKVMTPALLAQLS 300

Query: 300 TGLPKELFIQKLQSLYIGRKSGFSMRSLQAKVFKWMAPSILVVSGVRITNSEEYAANKNP 359
           TGLPKELFI KLQSLYIGRKSGFSMRSLQAKVFKWMAPSILVVSG+RITNSEEYAA KNP
Sbjct: 301 TGLPKELFIHKLQSLYIGRKSGFSMRSLQAKVFKWMAPSILVVSGMRITNSEEYAAEKNP 360

Query: 360 RYRHFLEEFPILKDSDQKMDASLMNKKKTTFAVYIDDPWKVTNKDYFGDLNTRIIQISPR 419
           RYRHFLEEFP LK+SDQ MDAS +NK+KTTFAVYIDDPWKVTNKDYFGDLNTRII+ISPR
Sbjct: 361 RYRHFLEEFPKLKESDQMMDASHLNKRKTTFAVYIDDPWKVTNKDYFGDLNTRIIEISPR 420

Query: 420 QDIYKVNKKGTVYFNTXXXXXXXXNKQPLIKSASKRYVPGNVSLTFDSTLEFAVFRNTGY 479
           QDIYKVN+KGT+YFNT        +KQPLIK ASKRY+PGNVSLTFDSTLEFAVFRNTGY
Sbjct: 421 QDIYKVNQKGTIYFNTIGGGIGIGDKQPLIKPASKRYIPGNVSLTFDSTLEFAVFRNTGY 480

Query: 480 GGSLDPGLLSMERKEENSSFELHILIQDVEVWGCGGEKELEEQIKQLAWEEAESKRRQQI 539
           GGSLDPGLLSMERKEENS +ELH LIQDVEVWGCGGEKELEEQIKQL WEEAESKRRQQI
Sbjct: 481 GGSLDPGLLSMERKEENSPYELHFLIQDVEVWGCGGEKELEEQIKQLEWEEAESKRRQQI 540

Query: 540 NLRSLGEDRALLEMAGLVGQHQGGGSM 566
           NLRSLGEDRALLEMAGLVGQHQGGGSM
Sbjct: 541 NLRSLGEDRALLEMAGLVGQHQGGGSM 567

>Suva_8.171 Chr8 (304635..306338) [1704 bp, 567 aa] {ON} YOR118W
           (REAL)
          Length = 567

 Score =  936 bits (2419), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/567 (80%), Positives = 507/567 (89%), Gaps = 1/567 (0%)

Query: 1   MGQXXXXXXXXXXXXXXXRKFANDRDVLTYFNTKAQRQITVPELVSLKGNLQIENLNTPI 60
           MGQ               RKF N+ DVL YFN KAQ+Q+TVPELVSLKGNLQIE++NTPI
Sbjct: 1   MGQSSSTPSSNEEKSSNLRKFTNNGDVLAYFNHKAQQQVTVPELVSLKGNLQIEDMNTPI 60

Query: 61  SHKRLCNFLYFPQNHTIIVGIVTNMLRVLSNFPLVNSSYEPITGYGLLKCIVLLNKSRCE 120
           SHK LC+ L+FPQ HT++ GIVTNMLRVLSNFPL+NSSYEPITGYGLLKCI+LLNK RC 
Sbjct: 61  SHKSLCSVLHFPQKHTLLSGIVTNMLRVLSNFPLMNSSYEPITGYGLLKCILLLNKGRCG 120

Query: 121 KFLKIKSYDQLKLLFISLSLQKTDKEELSEDNENNGVKEKNIKQIITGFDDVDTEVLYLP 180
           K+LK KSYDQLKLLFISLSLQKTDKEELSE+NENN  KE+NIKQII  FDDVD+EVLY+P
Sbjct: 121 KYLKFKSYDQLKLLFISLSLQKTDKEELSEENENNVKKERNIKQIIANFDDVDSEVLYVP 180

Query: 181 ADFMLQFLTWLLILSVECPTTNSTI-NNETNVQWDKFKIPAMNLLRTMNPDVVNNIESHF 239
           ADFMLQFL+WLLILSVECPT+NS + N++   QWD FKI AMNLLRTMNPDVV+N ESH 
Sbjct: 181 ADFMLQFLSWLLILSVECPTSNSKMGNSKIYDQWDSFKISAMNLLRTMNPDVVSNTESHL 240

Query: 240 ITYQQFSTAIRTVMPNLLKPLENLMEHFLYLQHDLVDYDTNLSSIQDSKIMTPALLAQLS 299
           IT+ QFST+IRTVMPNLLKPLENLMEHF YL++DLV+YDT+LSS++DS+IMTPALL QLS
Sbjct: 241 ITFDQFSTSIRTVMPNLLKPLENLMEHFFYLENDLVNYDTSLSSVRDSRIMTPALLTQLS 300

Query: 300 TGLPKELFIQKLQSLYIGRKSGFSMRSLQAKVFKWMAPSILVVSGVRITNSEEYAANKNP 359
           T LP+ELFIQKLQSLYIGRKSGFSMRSLQAKVFKWMAPSIL+VSG RITNS+EYAA KNP
Sbjct: 301 TVLPRELFIQKLQSLYIGRKSGFSMRSLQAKVFKWMAPSILIVSGTRITNSDEYAAQKNP 360

Query: 360 RYRHFLEEFPILKDSDQKMDASLMNKKKTTFAVYIDDPWKVTNKDYFGDLNTRIIQISPR 419
           RYRHFLEEFP LKDSDQKMDAS  NKKKTTFAVYIDDPWKVTNKDYFGD+NTRIIQISPR
Sbjct: 361 RYRHFLEEFPKLKDSDQKMDASYTNKKKTTFAVYIDDPWKVTNKDYFGDMNTRIIQISPR 420

Query: 420 QDIYKVNKKGTVYFNTXXXXXXXXNKQPLIKSASKRYVPGNVSLTFDSTLEFAVFRNTGY 479
           QDIYKVN+KGT+YFNT        +KQPLIK ASKR++PGNVSLTFDSTLEFAVFR+TGY
Sbjct: 421 QDIYKVNRKGTIYFNTIGGGIGIGDKQPLIKPASKRFIPGNVSLTFDSTLEFAVFRHTGY 480

Query: 480 GGSLDPGLLSMERKEENSSFELHILIQDVEVWGCGGEKELEEQIKQLAWEEAESKRRQQI 539
           GGSL+PG LS+ERKEE+S FELH LIQDVEVWGCGGEKELEEQ+KQ+AWEEAESKRRQQI
Sbjct: 481 GGSLEPGSLSVERKEEDSFFELHFLIQDVEVWGCGGEKELEEQMKQMAWEEAESKRRQQI 540

Query: 540 NLRSLGEDRALLEMAGLVGQHQGGGSM 566
           NLRSLGEDRALLEMAGLVGQ++GGGSM
Sbjct: 541 NLRSLGEDRALLEMAGLVGQNRGGGSM 567

>Skud_15.281 Chr15 (503290..504993) [1704 bp, 567 aa] {ON} YOR118W
           (REAL)
          Length = 567

 Score =  926 bits (2393), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/555 (82%), Positives = 499/555 (89%), Gaps = 1/555 (0%)

Query: 1   MGQXXXXXXXXXXXXXXXRKFANDRDVLTYFNTKAQRQITVPELVSLKGNLQIENLNTPI 60
           MGQ               +KF N+RDVL+YFN KAQ+Q+T+PELVS KGNLQIENLNTPI
Sbjct: 1   MGQSSSVSSRNEEGSSSSKKFTNNRDVLSYFNNKAQQQVTIPELVSFKGNLQIENLNTPI 60

Query: 61  SHKRLCNFLYFPQNHTIIVGIVTNMLRVLSNFPLVNSSYEPITGYGLLKCIVLLNKSRCE 120
           SHK L N L+FP NHTI+VGIVTNMLRVLSNFPL+NSSYEPITG+GLLKCI+LLN++RCE
Sbjct: 61  SHKPLFNVLHFPPNHTIVVGIVTNMLRVLSNFPLINSSYEPITGFGLLKCILLLNRTRCE 120

Query: 121 KFLKIKSYDQLKLLFISLSLQKTDKEELSEDNENNGVKEKNIKQIITGFDDVDTEVLYLP 180
           KFLKIKSYDQLKLLFISLSLQKTDKEELSE+NE N  +E+++KQIIT FDDVDTE+L LP
Sbjct: 121 KFLKIKSYDQLKLLFISLSLQKTDKEELSEENEENINRERHVKQIITDFDDVDTEMLCLP 180

Query: 181 ADFMLQFLTWLLILSVECPTTNS-TINNETNVQWDKFKIPAMNLLRTMNPDVVNNIESHF 239
           ADFMLQFL+WLLILSV+ PTTNS T N++T  QWD FKI AMNLLRTMNPDVV+N+ESHF
Sbjct: 181 ADFMLQFLSWLLILSVKFPTTNSKTDNDKTYEQWDTFKISAMNLLRTMNPDVVSNVESHF 240

Query: 240 ITYQQFSTAIRTVMPNLLKPLENLMEHFLYLQHDLVDYDTNLSSIQDSKIMTPALLAQLS 299
           IT++QFSTAIRTVMPNL KPLENLMEHF YL +DLV  D NLSSIQDS+IMTPALLAQLS
Sbjct: 241 ITFEQFSTAIRTVMPNLFKPLENLMEHFFYLDNDLVSRDANLSSIQDSRIMTPALLAQLS 300

Query: 300 TGLPKELFIQKLQSLYIGRKSGFSMRSLQAKVFKWMAPSILVVSGVRITNSEEYAANKNP 359
           TGLPKELFIQKLQSLYIGRKSGFSMRSLQAKVFKWMAPSILVVSG+RITNS+EYAA KNP
Sbjct: 301 TGLPKELFIQKLQSLYIGRKSGFSMRSLQAKVFKWMAPSILVVSGMRITNSDEYAAEKNP 360

Query: 360 RYRHFLEEFPILKDSDQKMDASLMNKKKTTFAVYIDDPWKVTNKDYFGDLNTRIIQISPR 419
           RYRHFL+EFP LKDSDQKMDAS ++KKKTTFAVYIDDPWKVTNKDYFGDLNTRIIQISPR
Sbjct: 361 RYRHFLDEFPKLKDSDQKMDASHLSKKKTTFAVYIDDPWKVTNKDYFGDLNTRIIQISPR 420

Query: 420 QDIYKVNKKGTVYFNTXXXXXXXXNKQPLIKSASKRYVPGNVSLTFDSTLEFAVFRNTGY 479
           QDIYKVN+KGT+YFNT        +KQP IK+ASKRY+PGNVSLTFDSTLEFAVFR+TGY
Sbjct: 421 QDIYKVNQKGTIYFNTIGGGIGIGDKQPFIKAASKRYIPGNVSLTFDSTLEFAVFRHTGY 480

Query: 480 GGSLDPGLLSMERKEENSSFELHILIQDVEVWGCGGEKELEEQIKQLAWEEAESKRRQQI 539
           GG LDPGLLSMERKEENS FELH LIQDVEVWGCGGEKELEEQIKQ+AWEEAESKRRQQI
Sbjct: 481 GGLLDPGLLSMERKEENSFFELHFLIQDVEVWGCGGEKELEEQIKQMAWEEAESKRRQQI 540

Query: 540 NLRSLGEDRALLEMA 554
           N RSLGEDRALLEMA
Sbjct: 541 NFRSLGEDRALLEMA 555

>SAKL0G02464g Chr7 (204358..206049) [1692 bp, 563 aa] {ON} similar
           to uniprot|Q12108 YOR118W Saccharomyces cerevisiae
           Hypothetical ORF
          Length = 563

 Score =  577 bits (1488), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/550 (52%), Positives = 386/550 (70%), Gaps = 6/550 (1%)

Query: 20  KFANDRDVLTYFNTKAQRQITVPELVSLKGNLQIENLNTPISHKRLCNFLYFPQNHTIIV 79
           +F +  D+L YF  +A +Q T PELV+ K NL+ ++ N  +S + +   L  P  + ++ 
Sbjct: 17  QFESQHDLLGYFAARATKQFTTPELVAFKSNLKGKDQNDKVSVEEMLQLLKIPLGNELLA 76

Query: 80  GIVTNMLRVLSNFPLVNSSYEPITGYGLLKCIVLLNKSRCEKFLKIKSYDQLKLLFISLS 139
            ++ N ++ LSNFPL+  SY+ IT  GLLK  +LL+  RC K++  K+YDQLKL++I+L+
Sbjct: 77  DLLHNCIKTLSNFPLIRESYDDITVAGLLKSCILLSHDRCIKYVGFKNYDQLKLIYIALA 136

Query: 140 LQKTDKEELSEDNENNGVKEKNIKQIITGFDDVDTEVLYLPADFMLQFLTWLLILSVECP 199
           L+KT KE  S  +     K  + K II  ++ VD + LY+PAD MLQ LT  L+LS  C 
Sbjct: 137 LRKTVKELPSSPDP---AKPWDAKSIIRNYNSVDIDDLYVPADSMLQLLTLSLVLSRHCT 193

Query: 200 TTNSTINNETNVQWDKFKIPAMNLLRTMNPDVVNNIES--HFITYQQFSTAIRTVMPNLL 257
             N+ I       WD +K  AMNLLRTMNPD+VN  ++    I+++QFS AI  V P +L
Sbjct: 194 VNNAKIRESVFQHWDDYKANAMNLLRTMNPDIVNTQDTVQCVISFEQFSNAIAAVFPQVL 253

Query: 258 KPLENLMEHFLYLQHDLVDYDTNLSSIQDSKIMTPALLAQLSTGLPKELFIQKLQSLYIG 317
           KPLE L+EH LYL  DL D   + S    SK++T  LLAQLST LPKEL   KL+ LY+G
Sbjct: 254 KPLEILVEHMLYLDRDLTDELNSTSMPSTSKLVTEPLLAQLSTMLPKELVYSKLRKLYVG 313

Query: 318 RKSGFSMRSLQAKVFKWMAPSILVVSGVRITNSEEYAANKNPRYRHFLEEFPILKDSDQK 377
           R+SGFSMRS Q+K FKWMAPSIL++ G+RIT+ +EYA  KNPRY+ FLEE+P LKD DQ 
Sbjct: 314 RESGFSMRSFQSKAFKWMAPSILLIGGMRITDDQEYATTKNPRYKKFLEEYPRLKDKDQH 373

Query: 378 M-DASLMNKKKTTFAVYIDDPWKVTNKDYFGDLNTRIIQISPRQDIYKVNKKGTVYFNTX 436
           + D   +N++K  FAVY+++PWKVTNK+ FGDL T ++Q+SP+Q+++K  + G VYFNT 
Sbjct: 374 IIDPCSLNRRKLLFAVYVNEPWKVTNKELFGDLKTTVVQLSPKQELFKAVRTGNVYFNTL 433

Query: 437 XXXXXXXNKQPLIKSASKRYVPGNVSLTFDSTLEFAVFRNTGYGGSLDPGLLSMERKEEN 496
                    QP+IK   K+Y PGNVSLT DS+LEFA FR+ GYGG++ PG L  + +EE 
Sbjct: 434 GGGIGVGCAQPVIKPNGKKYFPGNVSLTIDSSLEFASFRHVGYGGAISPGTLMTKLEEEK 493

Query: 497 SSFELHILIQDVEVWGCGGEKELEEQIKQLAWEEAESKRRQQINLRSLGEDRALLEMAGL 556
           ++FE   ++QDVEVWGCGGEKEL+EQIKQ  WEEAE+KRRQ+INL+S+GEDRALLEMAGL
Sbjct: 494 TTFEYKFIVQDVEVWGCGGEKELQEQIKQWEWEEAEAKRRQRINLQSIGEDRALLEMAGL 553

Query: 557 VGQHQGGGSM 566
           VGQHQ GGSM
Sbjct: 554 VGQHQSGGSM 563

>NCAS0H02050 Chr8 (398606..400327) [1722 bp, 573 aa] {ON} Anc_5.431
           YOR118W
          Length = 573

 Score =  552 bits (1422), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/553 (49%), Positives = 376/553 (67%), Gaps = 13/553 (2%)

Query: 21  FANDRDVLTYFNTKAQRQITVPELVSLKGNLQIENLNTP-----ISHKRLCNFLYFPQNH 75
           F ++ ++   F  +     T  ELV+ K  +  E  ++      IS   L N L+ P+ +
Sbjct: 27  FNSEEELRESFKRRILCHFTPLELVAFKKKIGHEQTDSEAGVEYISKNELTNLLHLPREN 86

Query: 76  TIIVGIVTNMLRVLSNFPLVNSSYEPITGYGLLKCIVLLNKSRCEKFLKIKSYDQLKLLF 135
            ++V +   ++ +LSNFPL+      +T  GLL CI+LL+K RC +F+   +YDQL L+F
Sbjct: 87  VLLVDLTYKLIAILSNFPLLREPQTEVTEIGLLMCIILLSKERCHRFIGSNTYDQLGLIF 146

Query: 136 ISLSLQKTDKEELSEDNENNGVKEKNIKQIITGFDDVDTEVLYLPADFMLQFLTWLLILS 195
           I++SL   DK            K+ N+++++  FD++  + L +PA  +LQFL+W L+L 
Sbjct: 147 IAMSLDYADKLLPYARTP----KKLNVEELLRTFDNIPIDELEIPAPVLLQFLSWGLLLL 202

Query: 196 VECPTTNSTIN--NETNVQWDKFKIPAMNLLRTMNPDVVNNIESHFITYQQFSTAIRTVM 253
           ++CPT+N  +   NE    W  ++  A N++R+M+  ++ N+    I Y QFS   + V+
Sbjct: 203 IKCPTSNCQLKPINEFYQNWSSYEKAAKNIIRSMDQSIIRNLTDVRINYTQFSDVFKAVL 262

Query: 254 PNLLKPLENLMEHFLYLQHDLVDYDTNLSSIQDSKIMTPALLAQLSTGLPKELFIQKLQS 313
           PN   PLE+LM H LY+  DL+D++T    + +SK+M+  LLAQL+T LPKELF+ KLQ 
Sbjct: 263 PNFTTPLESLMGHLLYMDSDLIDHET--MPMNNSKLMSEPLLAQLATVLPKELFLSKLQK 320

Query: 314 LYIGRKSGFSMRSLQAKVFKWMAPSILVVSGVRITNSEEYAANKNPRYRHFLEEFPILKD 373
           LY+GR+SGFSMRSLQ+K F W APSIL+VSG+ I++  +YA  KNPRY  FLE++P LK+
Sbjct: 321 LYVGRESGFSMRSLQSKCFNWEAPSILLVSGMLISDDLQYAKEKNPRYGKFLEQYPKLKE 380

Query: 374 SDQKMDASLMNKKKTTFAVYIDDPWKVTNKDYFGDLNTRIIQISPRQDIYKVNKKGTVYF 433
             Q +DA    +KK TFAVYIDDPW+VTNK++FG +N+ IIQ++PRQD++  +K   +YF
Sbjct: 381 EQQHLDACHSQRKKATFAVYIDDPWRVTNKEFFGSMNSMIIQLAPRQDVFHASKPNMIYF 440

Query: 434 NTXXXXXXXXNKQPLIKSASKRYVPGNVSLTFDSTLEFAVFRNTGYGGSLDPGLLSMERK 493
           NT        NKQPLI +A K+Y+PGNVSLT DSTLEFAVFR+ GYGG+  P  L  +R 
Sbjct: 441 NTVGGGIGFGNKQPLISNAHKKYIPGNVSLTIDSTLEFAVFRHIGYGGAFKPSALLTKRG 500

Query: 494 EENSSFELHILIQDVEVWGCGGEKELEEQIKQLAWEEAESKRRQQINLRSLGEDRALLEM 553
           +E+ SFE+  +IQDVEVWGCGGEKEL+EQIK+L WEEAE+KRRQ INL+SLGEDRALLEM
Sbjct: 501 KEDESFEIKFIIQDVEVWGCGGEKELQEQIKKLEWEEAEAKRRQHINLKSLGEDRALLEM 560

Query: 554 AGLVGQHQGGGSM 566
           AGLVGQ Q GGSM
Sbjct: 561 AGLVGQSQSGGSM 573

>TDEL0E01940 Chr5 complement(365414..367117) [1704 bp, 567 aa] {ON}
           Anc_5.431 YOR118W
          Length = 567

 Score =  543 bits (1400), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/568 (47%), Positives = 371/568 (65%), Gaps = 3/568 (0%)

Query: 1   MGQXXXXXXXXXXXXXXXRKFANDRDVLTYFNTKAQRQITVPELVSLKGNLQIENLNTPI 60
           MGQ               R+F ++ +++ +F+ +A    T  EL + K  L+ + L  P+
Sbjct: 1   MGQNASVQQDHAEIGHEKRQFTSNSELMEFFDKRAVHMFTATELAAFKSKLEGKTLKDPV 60

Query: 61  SHKRLCNFLYFPQNHTIIVGIVTNMLRVLSNFPLVNSSYEPITGYGLLKCIVLLNKSRCE 120
             + L  +L  P  + ++   V   +RVLSNFPL+  S++ +TG GLLK ++L N S+C 
Sbjct: 61  RSEELTRWLRIPCENVLLCEAVYEFVRVLSNFPLMKDSFDDVTGVGLLKSVLLTNPSKCH 120

Query: 121 KFLKIKSYDQLKLLFISLSLQKTDKEELSEDNENNGVKEKNIKQIITGFDDVDTEVLYLP 180
           K++ +K+YD +KLLFI+LS++K+ KEE S  +  +         ++  ++++  + L +P
Sbjct: 121 KYVGVKNYDHMKLLFIALSMRKSVKEEPSCSSSTSLEDGGGSINLLRTYNNIVVDDLAIP 180

Query: 181 ADFMLQFLTWLLILSVECPTTNSTINNET-NVQWDKFKIPAMNLLRTMNPDVVNNIESHF 239
           A  ++Q L WLLIL+  CPT+N     +    +W  FK+ A NLLRTMN ++V N+ES+ 
Sbjct: 181 ATSLVQLLAWLLILTSYCPTSNCQFPEDVVYAEWGSFKLAATNLLRTMNNNIVTNLESYS 240

Query: 240 ITYQQFSTAIRTVMPNLLKPLENLMEHFLYLQHDLVDYDTNLSS-IQDSKIMTPALLAQL 298
           + ++QFS AI TVMPN+ + L+N+MEH LY   DLV + +N +  I  SK  T A+LAQL
Sbjct: 241 VKFEQFSKAISTVMPNIFRALQNVMEHLLYQDSDLVSFPSNSAGPILTSKPTTQAVLAQL 300

Query: 299 STGLPKELFIQKLQSLYIGRKSGFSMRSLQAKVFKWMAPSILVVSGVRITNSEEYAANKN 358
            T L  E+   K Q+LY+GR+SGFSMRSLQAKVFKWMAP+++++SG  + + E+++  KN
Sbjct: 301 ITALSNEMTFAKFQNLYVGRESGFSMRSLQAKVFKWMAPTVMLLSGKCVLDDEDFS-KKN 359

Query: 359 PRYRHFLEEFPILKDSDQKMDASLMNKKKTTFAVYIDDPWKVTNKDYFGDLNTRIIQISP 418
            RYR FL ++P LKD DQ +     NK K  FAVYI +PWK TNKDYFG   T I+Q+SP
Sbjct: 360 SRYRDFLSKYPKLKDRDQHLSDLQKNKTKVVFAVYIPEPWKTTNKDYFGGSGTTIVQLSP 419

Query: 419 RQDIYKVNKKGTVYFNTXXXXXXXXNKQPLIKSASKRYVPGNVSLTFDSTLEFAVFRNTG 478
            QD++K      +YFNT        N QP IK+  K Y PGNVSLT DSTLEFA FR+ G
Sbjct: 420 TQDVFKAASNEVMYFNTLGGGIGIGNNQPHIKNGVKSYSPGNVSLTIDSTLEFAAFRHVG 479

Query: 479 YGGSLDPGLLSMERKEENSSFELHILIQDVEVWGCGGEKELEEQIKQLAWEEAESKRRQQ 538
           YGG+ +PGLL  +   E+  FE+  LIQDVEVWGCGG++ELEEQ K+  WEEAE+KRRQ 
Sbjct: 480 YGGTFNPGLLLTQFNREDDPFEIKFLIQDVEVWGCGGKEELEEQYKKWQWEEAEAKRRQN 539

Query: 539 INLRSLGEDRALLEMAGLVGQHQGGGSM 566
           INLRS GEDRALLEMAGLVG  Q GGSM
Sbjct: 540 INLRSFGEDRALLEMAGLVGHSQNGGSM 567

>NDAI0C01610 Chr3 complement(343850..345604) [1755 bp, 584 aa] {ON}
           Anc_5.431 YOR118W
          Length = 584

 Score =  534 bits (1376), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/568 (47%), Positives = 376/568 (66%), Gaps = 26/568 (4%)

Query: 20  KFANDRDVLTYFNTKAQRQITVPELVSLKGNLQIENLNTPISHKRLCNFLYFPQNHTIIV 79
           +F N  +V  YF  +     T  EL+S K  L  ++L+  I+ + +   L+ P ++ I+ 
Sbjct: 22  QFGNALEVQKYFQKRTIGHFTPLELISYKNKLNHDHLDDMITKEEIIQLLHLPDDNVILS 81

Query: 80  GIVTNMLRVLSNFPLVNSSYEPITGYGLLKCIVLLNKSRCEKFLKIKSYDQLKLLFISLS 139
            ++ NM+  L NFP +      IT   LL CI+LL+  RC++F+  KSYDQ+KLLFI L 
Sbjct: 82  NMIFNMVHSLCNFPFLGERIWDITAGNLLTCIILLDNDRCQRFIGSKSYDQIKLLFILLC 141

Query: 140 LQKTDKEELSEDNENNGVKEK----------------NIKQIITGFDDVDTEVLYLPADF 183
           L   +         N+ ++EK                N+  I+  ++ +  + L +PA  
Sbjct: 142 LSTNNSSGKPLSASNSKLREKSENISTTSIYSQEIGYNLTDILQSYNGISIDDLSVPALS 201

Query: 184 MLQFLTWLLILSVECPTTNSTI--NNETNVQWDKFKIPAMNLLRTMNPDVVNNIESHFIT 241
           + +  TW LI+S++CPT N  I  N      W++++  ++N+LR+M+  +V+N++ + I+
Sbjct: 202 LSECFTWTLIMSIKCPTANCKILPNETIYNSWNEYQKASLNILRSMDSSIVSNLDDYRIS 261

Query: 242 YQQFSTAIRTVMPNLLKPLENLMEHFLYLQHDLVDYDTNLSSIQDSKIMTPALLAQLSTG 301
           + QF     +V+PN   PLEN+M H LY+  DL+++   +  I  SK+M+ +LLAQLST 
Sbjct: 262 FTQFENVFTSVVPNFTHPLENIMNHLLYMDKDLINHP--VMEIPKSKLMSESLLAQLSTT 319

Query: 302 LPKELFIQKLQSLYIGRKSGFSMRSLQAKVFKWMAPSILVVSGVRITNSEEYAANKNPRY 361
           LPKELFI KLQ LYIGR+SGFSMRSLQ+K FKW+AP+IL+VSG+ I N EEY    NPR+
Sbjct: 320 LPKELFISKLQKLYIGRQSGFSMRSLQSKCFKWLAPTILLVSGLIIPNDEEY---NNPRF 376

Query: 362 RHFLEEFPILKDSDQKMDASLMNKKKTTFAVYIDDPWKVTNKDYFGDLNTRIIQISPRQD 421
           + FL+EFP L D++Q ++     KKK +FAVYID+PW+VTNK++FGDLN+RII++SPRQD
Sbjct: 377 KRFLQEFPKLNDNEQSLEPCHSYKKKISFAVYIDEPWRVTNKEFFGDLNSRIIELSPRQD 436

Query: 422 IYKVNKKGT-VYFNTXXXXXXXXNKQPLIKSA--SKRYVPGNVSLTFDSTLEFAVFRNTG 478
           I+K  K    +YFNT        +KQP + +   S++Y PGNVSLT +STLEFAVFR+ G
Sbjct: 437 IFKSLKSHELIYFNTIGCGIGIGDKQPHVSNGANSRKYQPGNVSLTLESTLEFAVFRHVG 496

Query: 479 YGGSLDPGLLSMERKEENSSFELHILIQDVEVWGCGGEKELEEQIKQLAWEEAESKRRQQ 538
           +GG+  P  L  +R  E  SFE+  +IQDVEVWGCGGEKELEEQ+KQLAWEEAE+KRRQQ
Sbjct: 497 HGGAFSPSELLTKRGTEEESFEIKFIIQDVEVWGCGGEKELEEQMKQLAWEEAEAKRRQQ 556

Query: 539 INLRSLGEDRALLEMAGLVGQHQGGGSM 566
           +NL+S+ EDRALLEM GLVGQHQ GGSM
Sbjct: 557 VNLKSISEDRALLEMVGLVGQHQSGGSM 584

>KLTH0F16126g Chr6 complement(1308133..1309797) [1665 bp, 554 aa]
           {ON} similar to uniprot|Q12108 YOR118W Saccharomyces
           cerevisiae Hypothetical ORF
          Length = 554

 Score =  523 bits (1347), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/548 (47%), Positives = 371/548 (67%), Gaps = 13/548 (2%)

Query: 21  FANDRDVLTYFNTKAQRQITVPELVSLKGNLQIENLNTPISHKRLCNFLYFPQNHTIIVG 80
           F ++ D+L++++ KA + ++ PELVS KGN+  + L+  ++ K L   L     +  + G
Sbjct: 18  FESENDLLSWYDKKALKLVSTPELVSYKGNIDGKPLDAALNRKELMRVLRLQNANEAVEG 77

Query: 81  IVTNMLRVLSNFPLVNSSYEPITGYGLLKCIVLLNKSRCEKFLKIKSYDQLKLLFISLSL 140
           ++ N ++ L+NFPL+   YE +T  G+LK  VLLNK+RC ++++ K Y+  KL++ISL+L
Sbjct: 78  LLFNCVQTLANFPLIKDCYENVTYMGVLKSCVLLNKNRCLEYVQDKRYNHTKLVYISLAL 137

Query: 141 QKTDKEELSEDNENNGVKEKNIKQIITGFDDVDTEVLYLPADFMLQFLTWLLILSVECPT 200
            K  KE  S  N N+ +   +  ++I  F++V  E L +PA+ ML+FLT +L +S     
Sbjct: 138 NKAVKEMSSLPNSNDSL---DAPKVIATFNNVAEEELVVPAETMLEFLTLMLTMSKATVI 194

Query: 201 TNSTINNETNVQWDKFKIPAMNLLRTMNPDVVNNIES--HFITYQQFSTAIRTVMPNLLK 258
            NS ++   + +WD FK  A+++LRTMN D++ + ++  + I+Y QF   I +V PNLL 
Sbjct: 195 KNSRLDVNISEKWDSFKTCALSILRTMNTDILTSQDALKNVISYTQFQNVISSVCPNLLV 254

Query: 259 PLENLMEHFLYLQHDLVDYDTNLSSIQDSKIMTPALLAQLSTGLPKELFIQKLQSLYIGR 318
           PLE LMEH L+L  DLVD + +   I  SK++T  LLAQL+T  P+EL   +LQ LY+GR
Sbjct: 255 PLECLMEHVLFLNRDLVDLEASKPLIPQSKLVTEPLLAQLATVWPRELVFSRLQKLYVGR 314

Query: 319 KSGFSMRSLQAKVFKWMAPSILVVSGVRITNSEEYAANKNPRYRHFLEEFPILKDSDQKM 378
            SGFSMRS QAK FKWMAPSIL+V G RI + ++YA NKN RY+ FL+E+P LKD DQ +
Sbjct: 315 DSGFSMRSFQAKAFKWMAPSILLVQGSRIPDDQDYAKNKNQRYKKFLDEYPRLKDEDQHI 374

Query: 379 DASLMNKKKTTFAVYIDDPWKVTNKDYFGDLNTRIIQISPRQDIYKVNKKGTVYFNTXXX 438
             +L  K+K  FA+ I++PWKVTN + FGD+ T I+Q+SP Q++YK +K G VYFNT   
Sbjct: 375 LPALSGKRKLLFAILINEPWKVTNSELFGDIKTTIVQLSPIQEVYKASKPGNVYFNTLGG 434

Query: 439 XXXXXNKQPLIKSASKRYVPGNVSLTFDSTLEFAVFRNTGYGGSLDPGLLSMERKEENSS 498
                + QP+IKS+  ++VPGNVSLT D  LEFA FRN G+GGS+ P            +
Sbjct: 435 GIGIGSPQPIIKSSGVKFVPGNVSLTIDPNLEFAAFRNVGFGGSIAPS--------NTPT 486

Query: 499 FELHILIQDVEVWGCGGEKELEEQIKQLAWEEAESKRRQQINLRSLGEDRALLEMAGLVG 558
            E   LIQD+E WGCGGEKELEEQ+K   WEEAE++RRQ+INL+S+ +DRALLE+AGLVG
Sbjct: 487 SEHKFLIQDIETWGCGGEKELEEQMKNWEWEEAEAQRRQRINLKSVNDDRALLELAGLVG 546

Query: 559 QHQGGGSM 566
           Q+Q GGS+
Sbjct: 547 QNQSGGSV 554

>Kwal_55.21437 s55 complement(836842..838506) [1665 bp, 554 aa] {ON}
           YOR118W - Hypothetical ORF [contig 130] FULL
          Length = 554

 Score =  516 bits (1330), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 264/549 (48%), Positives = 367/549 (66%), Gaps = 13/549 (2%)

Query: 20  KFANDRDVLTYFNTKAQRQITVPELVSLKGNLQIENLNTPISHKRLCNFLYFPQNHTIIV 79
           +F +++DV+ +F+ KA + +T PELVS K N+  ++L+  ++   L   L     +  + 
Sbjct: 17  QFNSEKDVIIWFDKKAIKSLTSPELVSFKANINGKDLSDVVTSDELLKVLRLDGVNETVS 76

Query: 80  GIVTNMLRVLSNFPLVNSSYEPITGYGLLKCIVLLNKSRCEKFLKIKSYDQLKLLFISLS 139
            ++ N ++ LSNFP +   YE IT  GLLK  VLLNK+RC  ++K K YD  KL++ISL+
Sbjct: 77  SLIFNCVQTLSNFPFIRDCYENITYSGLLKSCVLLNKARCLSYVKNKRYDHTKLVYISLA 136

Query: 140 LQKTDKEELSEDNENNGVKEKNIKQIITGFDDVDTEVLYLPADFMLQFLTWLLILSVECP 199
           L KT KE  S  N    +   +  +II  F+ V  E L +P++ ML+F+T +L +S    
Sbjct: 137 LNKTVKEVSSSSNSQESL---DAPRIIATFNSVCVEELTVPSEVMLEFITLMLKMSKSTI 193

Query: 200 TTNSTINNETNVQWDKFKIPAMNLLRTMNPDVV--NNIESHFITYQQFSTAIRTVMPNLL 257
             NS ++   +  W+ F+  A+++LRTMN ++   N++  + IT+ QF + I TV PNLL
Sbjct: 194 IKNSKLDPNVSEGWESFRPFALSILRTMNTNIATQNDLLKYGITFSQFQSTISTVCPNLL 253

Query: 258 KPLENLMEHFLYLQHDLVDYDTNLSSIQDSKIMTPALLAQLSTGLPKELFIQKLQSLYIG 317
            P E+LMEH L+L  DLVD D +   + +SK+++  LLAQL+T  P+EL   +LQ LY+G
Sbjct: 254 LPFESLMEHVLFLGRDLVDIDASQPPLLESKLVSEPLLAQLATVWPRELVFSRLQKLYVG 313

Query: 318 RKSGFSMRSLQAKVFKWMAPSILVVSGVRITNSEEYAANKNPRYRHFLEEFPILKDSDQK 377
           R SGFSMRS QAK FKWMAPSIL++ GVRI N EEYA +KN RY++FLEE+P LK+ DQ 
Sbjct: 314 RDSGFSMRSFQAKAFKWMAPSILLIHGVRIPNDEEYAKSKNHRYKNFLEEYPRLKEEDQV 373

Query: 378 MDASLMNKKKTTFAVYIDDPWKVTNKDYFGDLNTRIIQISPRQDIYKVNKKGTVYFNTXX 437
           +      KKK  FAVY++ PWKVTN + FGDL T IIQ+SP Q++YK ++ G +YFNT  
Sbjct: 374 LLPPFSGKKKLLFAVYVNVPWKVTNSELFGDLKTTIIQLSPIQEVYKASRPGNIYFNTLG 433

Query: 438 XXXXXXNKQPLIKSASKRYVPGNVSLTFDSTLEFAVFRNTGYGGSLDPGLLSMERKEENS 497
                 + QP++K  S++Y+PGNVSLT D  LEFAVFR+ G+GGS+ P    +       
Sbjct: 434 GGIGVGSPQPIVKPTSRKYLPGNVSLTIDPNLEFAVFRSAGFGGSIKPSSTIVN------ 487

Query: 498 SFELHILIQDVEVWGCGGEKELEEQIKQLAWEEAESKRRQQINLRSLGEDRALLEMAGLV 557
             E   LIQD+E WGCGGEKELEEQ+K   WEEAE++RRQ+INL+S+ +DRALLEMAGLV
Sbjct: 488 --EHKFLIQDIEAWGCGGEKELEEQMKNWEWEEAEAQRRQRINLKSINDDRALLEMAGLV 545

Query: 558 GQHQGGGSM 566
           GQ+Q GGS+
Sbjct: 546 GQNQSGGSI 554

>ZYRO0F09966g Chr6 (809604..811268) [1665 bp, 554 aa] {ON} similar
           to uniprot|Q12108 YOR118W Saccharomyces cerevisiae
           Hypothetical ORF
          Length = 554

 Score =  506 bits (1302), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 260/550 (47%), Positives = 368/550 (66%), Gaps = 15/550 (2%)

Query: 21  FANDRDVLTYFNTKAQRQITVPELVSLKGNLQIENLNTPISHKRLCNFLYFPQNHTIIVG 80
           F ++ D+L  FN +A +Q TV ELVS K  L  ++LN  ++++ L  +L  PQ+  ++  
Sbjct: 16  FTSNSDILKSFNDRALKQFTVTELVSFKNKLG-KDLNERLTNEELTKWLSVPQDEILLRE 74

Query: 81  IVTNMLRVLSNFPLVNSSYEPITGYGLLKCIVLLNKSRCEKFLKIKSYDQLKLLFISLSL 140
           ++ N ++VL NFPL+ +SYE +TG G+LK I+L N  RC+K++K ++YDQLKL FI+LS+
Sbjct: 75  LLYNFVQVLGNFPLMKNSYENVTGIGVLKAIILTNPERCKKYVKSRNYDQLKLWFIALSI 134

Query: 141 QKTDKEELSEDNENNGVKEKNIKQIITGFDDVDTEVLYLPADFMLQFLTWLLILSVECPT 200
           +KT KE+ +  + ++  +  ++ +I+  FD +    L +P  +M+ F++WLLIL+  CP 
Sbjct: 135 RKTVKEDPNLSSSSSSEESFDVTRILKTFDGLHVNELSVPFAYMVPFISWLLILTTYCPI 194

Query: 201 TNSTINNETNVQ-WDKFKIPAMNLLRTMNPDVVNNIESHFITYQQFSTAIRTVMPNLLKP 259
            N  + N      W+ +   A  +LR+M P      ES +I Y+ F+  +R++ P++  P
Sbjct: 195 NNCKLENVAMFDNWNSYIKSAHTILRSMRP----MDESSWIEYEPFAHTMRSIAPHIFDP 250

Query: 260 LENLMEHFLYLQHDLVD-YDTNLSSIQDSKIMTPALLAQLSTGLPKELFIQKLQSLYIGR 318
           L  +MEH L+   +LVD    N   I  SK++  ALLAQ+S+ L K+L I  LQ LY+GR
Sbjct: 251 LTRVMEHLLFKDDELVDPLSENRGEIASSKLLNSALLAQISSALSKQLPIYHLQRLYLGR 310

Query: 319 KSGFSMRSLQAKVFKWMAPSILVVSGVRITNSEEYAANKNPRYRHFLEEFPILKDSDQKM 378
             GFSMRS QAKVFKW AP+I+++ G RI + EEY+  KN R+R FL E+P LK SD   
Sbjct: 311 DHGFSMRSFQAKVFKWSAPTIMLLRGKRILDDEEYSV-KNTRFRKFLHEYPKLKPSDMDT 369

Query: 379 DASLM--NKKKTTFAVYIDDPWKVTNKDYFGDLNTRIIQISPRQDIYKVNKKGTVYFNTX 436
           +   M   K K   AVY+ DPWK+TNK++FG  +T I+Q+SP Q+++  +++  +YFNT 
Sbjct: 370 EVEEMYPAKSKIILAVYVSDPWKITNKEFFGGPHTTIVQLSPFQEVFGSSRENALYFNTI 429

Query: 437 XXXXXXXNKQPLIKSASKRYVPGNVSLTFDSTLEFAVFRNTGYGGSLDPGLLSMERKEEN 496
                  NKQP+IKS +K Y PGNVSLT DS LEFAV R+ G GG L PGL+  ++    
Sbjct: 430 GGGIGIGNKQPVIKSTAKSYSPGNVSLTMDSALEFAVLRHAGQGGVLKPGLVVGDK---- 485

Query: 497 SSFELHILIQDVEVWGCGGEKELEEQIKQLAWEEAESKRRQQINLRSLGEDRALLEMAGL 556
             FE+ +L+QDVEVWGCGGEKELEEQ+KQ  WEE+E+KRRQQINLRS+GEDRALLEMAGL
Sbjct: 486 -DFEVKMLLQDVEVWGCGGEKELEEQLKQWEWEESEAKRRQQINLRSIGEDRALLEMAGL 544

Query: 557 VGQHQGGGSM 566
           VGQ Q GGS+
Sbjct: 545 VGQAQSGGSV 554

>Kpol_1016.7 s1016 complement(14315..16003) [1689 bp, 562 aa] {ON}
           complement(14315..16003) [1689 nt, 563 aa]
          Length = 562

 Score =  496 bits (1277), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 250/543 (46%), Positives = 362/543 (66%), Gaps = 9/543 (1%)

Query: 26  DVLTYFNTKAQRQITVPELVSLKGNLQIENLNTPISHKRLCNFLYFPQNHTIIVGIVTNM 85
           D+L +FN ++   +   E+   K  L  ++L+ P++       L    +++ +  ++ N 
Sbjct: 27  DILDFFNNRSLSILLPMEIECFKSRLGDKDLSDPLTKDEFNTLLRIADSNSQLQILLWNF 86

Query: 86  LRVLSNFPLVNSSYEPITGYGLLKCIVLLNKSRCEKFLKIKSYDQLKLLFISLSLQKTDK 145
              +S FP +++  E +TG+G+LK I+LL + R +K+L   +   +KL+FI L    T +
Sbjct: 87  FLKISAFPFLSNRSESMTGFGILKGIILLTRERIKKYLGWSNAKLIKLIFIGL----TSQ 142

Query: 146 EELSEDNENNGVKEKNIKQIITGFDDVDTEVLYLPADFMLQFLTWLLILSVECPTTNSTI 205
           E++    E +  K   I+ ++   D +D     +    ML F+TWLL+LSV CPT+N  +
Sbjct: 143 EKVGVKTEASVFK---IQHVLDTLDGIDLASSTVKDTDMLSFITWLLLLSVHCPTSNCKL 199

Query: 206 NNETNV-QWDKFKIPAMNLLRTMNPDVVNNIESHFITYQQFSTAIRTVMPNLLKPLENLM 264
           N ++   +W  ++I A +++R+MN  +    +   I+Y  FS  I  V  N++ PLEN++
Sbjct: 200 NEKSLYDKWKDYEIVASSMVRSMNKKITTTGKGIGISYSDFSHTIVAVSKNVMSPLENIV 259

Query: 265 EHFLYLQHDLVDYDTNLSSIQDSKIMTPALLAQLSTGLPKELFIQKLQSLYIGRKSGFSM 324
           EH LY Q DL+++    + ++++K+MT  L+AQL T LP E+ + +LQ LY+GR+SG+SM
Sbjct: 260 EHMLYKQDDLLEFPCLDTFLKETKLMTYPLVAQLCTVLPNEIVMSQLQKLYVGRESGYSM 319

Query: 325 RSLQAKVFKWMAPSILVVSGVRITNSEEYAANKNPRYRHFLEEFPILKDSDQKMDASLMN 384
           RSLQ+KVF W A +IL+VSG RI +  EY+ NKNPRY+ FLEE+P LKD DQ+MD     
Sbjct: 320 RSLQSKVFNWKAATILLVSGTRIVDDIEYSENKNPRYKRFLEEYPKLKDEDQEMDDCHNL 379

Query: 385 KKKTTFAVYIDDPWKVTNKDYFGDLNTRIIQISPRQDIYKVNKKGTVYFNTXXXXXXXXN 444
           KKK TFAVYID+PW+VTNK+YFG+  T II++SPRQD +   K G+VYFNT        N
Sbjct: 380 KKKVTFAVYIDEPWRVTNKNYFGEKRTSIIELSPRQDKFNSLKVGSVYFNTIGGGIGIGN 439

Query: 445 KQPLIKSASKRYVPGNVSLTFDSTLEFAVFRNTGYGGSLDPGLLSMERKEENSSFELHIL 504
            QP+ K  S RY PGNVSLT D+TLEF VFR+TGYGG++ P  L  +  EEN +FE+  L
Sbjct: 440 NQPVTKLNSVRYAPGNVSLTLDNTLEFGVFRHTGYGGTIGPSELLKKNNEENKAFEIRFL 499

Query: 505 IQDVEVWGCGGEKELEEQIKQLAWEEAESKRRQQINLRSLGEDRALLEMAGLVGQH-QGG 563
           I+DVEVWGCGGEKELEEQ+++  WEEAE+KRRQ+INL+++GEDRALLEMAG++GQH Q G
Sbjct: 500 IRDVEVWGCGGEKELEEQLREWKWEEAEAKRRQEINLKTMGEDRALLEMAGIIGQHGQSG 559

Query: 564 GSM 566
           GS+
Sbjct: 560 GSI 562

>KLLA0E21143g Chr5 complement(1888085..1889803) [1719 bp, 572 aa]
           {ON} similar to uniprot|Q12108 YOR118W Saccharomyces
           cerevisiae Hypothetical ORF
          Length = 572

 Score =  494 bits (1271), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 267/552 (48%), Positives = 364/552 (65%), Gaps = 15/552 (2%)

Query: 27  VLTYFNTKAQRQITVPELVSLKGNL-QIENLNTPISHKRLCNFLYFPQNHTIIVGIVTNM 85
           ++ +FN +  +Q+T  EL+S K N+ + + LN  +    +    Y P++  +++ +  NM
Sbjct: 24  LMDFFNDRCLKQLTTAELISFKNNIPEGKELNDYVEVSDISRMYYIPKDSAVMLSVFMNM 83

Query: 86  LRVLSNFPLVNSSYEPITGYGLLKCIVLLNKSRCEKFLKIKSYDQLKLLFISLSLQKTDK 145
              L+NFPL+  SYE +T   LLK  +LL K R  K+   K Y+ LK+LFI+LSL+K  K
Sbjct: 84  FHTLANFPLLQDSYEKVTFKTLLKATLLLVKERAIKYTDWKKYNDLKMLFITLSLEKNIK 143

Query: 146 EELSEDNENNGVKE-KNIKQIITGFDDVDTEVLYLPADFMLQFLTWLLILSVECPTTNST 204
            E   D+  + + + K+ K +I  ++  D + L + A+ +L FL  +L LS  C   N  
Sbjct: 144 AEPLMDS--SALSDCKDWKGVIRSYNGTDFDELKVNANNLLHFLALILALSRCCILNNCK 201

Query: 205 INNETNVQ-WDKFKIPAMNLLRTMNPDVVN--NIESHFITYQQFSTAIRTVMPNLLKPLE 261
           I+N+   +  + FK  A+N++RTMNP++++  +     ITY QFS A+  V PNLL PL+
Sbjct: 202 IDNDVLAKSLEDFKHQALNIVRTMNPEIISMSDCLDSSITYTQFSMAVNDVAPNLLNPLK 261

Query: 262 NLMEHFLYLQHDLVDYDTNLSSIQDSKIMTPALLAQLSTGLPKELFIQKLQSLYIGRKSG 321
            LMEH LY+  DLVD D        +KI+  + L+QL+T LPKE+   + Q LY+GR+SG
Sbjct: 262 MLMEHVLYMDRDLVDADVLQPISNPTKIVNESELSQLATFLPKEIVFSRFQKLYVGRESG 321

Query: 322 FSMRSLQAKVFKWMAPSILVVSGVRITNSEE-----YAANKNPRYRHFLEEFPILKDSDQ 376
           FSMRS Q+KVFKWMAP+IL V G+RI + ++     YA  KNPRYR+FL+E+  LK  DQ
Sbjct: 322 FSMRSFQSKVFKWMAPTILFVEGMRIRDEDDEDGDAYAV-KNPRYRNFLQEYGKLKSEDQ 380

Query: 377 KMDASLMNKKKTTFAVYIDDPWKVTNKDYFGDLNTRIIQISPRQDIYKVN--KKGTVYFN 434
            +D     K+K  FAV I DPWKV+NKD FGD +T+IIQ+ PRQ+I+  +  K G VYFN
Sbjct: 381 HLDTLSKKKRKLLFAVCIRDPWKVSNKDLFGDSSTKIIQLHPRQEIFDADPFKTGNVYFN 440

Query: 435 TXXXXXXXXNKQPLIKSASKRYVPGNVSLTFDSTLEFAVFRNTGYGGSLDPGLLSMERKE 494
           T        + QP+IK+  K+Y PGNVSLT DS+LEF +FR+ G GGS  PG L   R E
Sbjct: 441 TVGGGIGIGSSQPIIKANGKKYFPGNVSLTIDSSLEFGIFRHLGAGGSFKPGRLISGRGE 500

Query: 495 ENSSFELHILIQDVEVWGCGGEKELEEQIKQLAWEEAESKRRQQINLRSLGEDRALLEMA 554
           E +SFE   +IQDVEVWGCGGEKELEEQ+KQ  WEEAE+KRRQ+INL+S+GEDRALLEMA
Sbjct: 501 ERNSFEYRFIIQDVEVWGCGGEKELEEQVKQWQWEEAEAKRRQKINLQSMGEDRALLEMA 560

Query: 555 GLVGQHQGGGSM 566
           GLVGQHQ GGS+
Sbjct: 561 GLVGQHQSGGSI 572

>TPHA0H01790 Chr8 (412229..413926) [1698 bp, 565 aa] {ON} Anc_5.431
           YOR118W
          Length = 565

 Score =  474 bits (1220), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 234/551 (42%), Positives = 361/551 (65%), Gaps = 8/551 (1%)

Query: 19  RKFANDRDVLTYFNTKAQRQITVPELVSLKGNLQIENLNTPISHKRLCNFLYFPQNHTII 78
           +   ++ +++ YFN +   Q +  EL+  K  L+I++ +T I    +   L        +
Sbjct: 20  KDLTSELEIVDYFNKRVISQFSNIELLCFKHLLEIDDYSTIIDDAVVYKLLQIQDVSDRL 79

Query: 79  VGIVTNMLRVLSNFPLVNSSYEPITGYGLLKCIVLLNKSRCEKFLKIKSYDQLKLLFISL 138
             ++ N ++ L+NFP +++  + +T YGLLK IV+L K +  K+      + LK+LFI+L
Sbjct: 80  RNLILNFIKRLTNFPFISTVADNVTAYGLLKTIVILQKQKFIKYTNNNQLNMLKILFIAL 139

Query: 139 SLQKTDKEELSEDNENN-GVKEKNIKQIITGFDDVDTEVLYLPADFMLQFLTWLLILSVE 197
                D+EE   DN+        +I  I+T +D +    + + +  M+ FLTW+L LS  
Sbjct: 140 G--DYDREE---DNKKILDCHNISISTILTTYDGIPIHDISVSSSNMISFLTWILALSNV 194

Query: 198 CPTTNSTINNETNVQ-WDKFKIPAMNLLRTMNPDVVNNIESHFITYQQFSTAIRTVMPNL 256
           CPT NS ++ +   + W+K++  A++L+R+MNPD++   ++  I + QF TA+ T+MP++
Sbjct: 195 CPTNNSIVDTKHMFKYWEKYETSAISLVRSMNPDIIKPDDNQNILFIQFKTALETIMPHV 254

Query: 257 LKPLENLMEHFLYLQHDLVDYDTNLSSIQDSKIMTPALLAQLSTGLPKELFIQKLQSLYI 316
             PLE+L+ H L+++  L+       S Q+SK+MT A+ +QLST L  ++ I KL  LY 
Sbjct: 255 YLPLEHLLNHLLFMESSLIKSQEIEISFQESKLMTFAVASQLSTLLRNDVVISKLHKLYS 314

Query: 317 GRKSGFSMRSLQAKVFKWMAPSILVVSGVRITNSEEYAANKNPRYRHFLEEFPILKDSDQ 376
           GR+SGFSMRS Q+K FKW AP+IL++SG+R+T+  EYA  KNPRY+ F++++P L+D DQ
Sbjct: 315 GRESGFSMRSFQSKAFKWNAPTILLISGMRVTDDVEYATKKNPRYKKFIDQYPRLRDLDQ 374

Query: 377 KMDASLMNKKKTTFAVYIDDPWKVTNKDYFGDLNTRIIQISPRQDIYKVNKKGTVYFNTX 436
            ++      +K TFAVY+D+PWKV+NK  FG L T I+++SPRQD ++  K G +YFNT 
Sbjct: 375 NLEPCHSKLRKVTFAVYVDEPWKVSNKLQFGGLKTLIVELSPRQDCFRAAKPGVIYFNTV 434

Query: 437 XXXXXXXNKQPLIKSASKRYVPGNVSLTFDSTLEFAVFRNTGYGGSLDPGLLSMERKEEN 496
                  + QP+ K  S  Y PGNVSLT D++LEF  FR+TGYGGS++P  +  ++++  
Sbjct: 435 GGGIGIGSSQPVQKKNSLSYTPGNVSLTIDNSLEFGAFRHTGYGGSIEPSSILQKKEDAT 494

Query: 497 SSFELHILIQDVEVWGCGGEKELEEQIKQLAWEEAESKRRQQINLRSLGEDRALLEMAGL 556
            +FE+  LIQD+EVWGCGGEKE++EQ+KQ AWEE E+K+RQ++NL+S+GEDRALLEMAG+
Sbjct: 495 RTFEIRFLIQDIEVWGCGGEKEIDEQLKQWAWEEEEAKKRQRVNLKSMGEDRALLEMAGI 554

Query: 557 VGQH-QGGGSM 566
           +G H   GGS+
Sbjct: 555 IGNHAHSGGSL 565

>Ecym_4764 Chr4 complement(1484832..1486532) [1701 bp, 566 aa] {ON}
           similar to Ashbya gossypii AER258C
          Length = 566

 Score =  464 bits (1195), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 241/554 (43%), Positives = 352/554 (63%), Gaps = 14/554 (2%)

Query: 21  FANDRDVLTYFNTKAQRQITVPELVSLKGNLQIE-NLNTPISHKRLCNFLYFPQNHTIIV 79
           F +++++L +F+ +A RQ+   ELV+ + N+ ++ +L   +S + L      P++    V
Sbjct: 19  FRDEKEILEFFDNQAVRQLHGLELVAFQNNIGLDADLKDYLSCEFLVQLCKLPRHKYGFV 78

Query: 80  GIVTNMLRVLSNFPLVN--SSYEPITGYGLLKCIVLLNKSRCEKFLKIKSYDQLKLLFIS 137
            +   M+   S FPL+   +  +  T  GL+K  +L +  +  K+ + K+YDQ+ L+FI 
Sbjct: 79  KVFYQMIGNASKFPLMGGGAGEDVPTFVGLVKACLLFDYKKLLKYAQCKTYDQVSLIFIL 138

Query: 138 LSLQ---KTDKEELSEDNENNGVKEKNIKQIITGFDDVDTEVLYLPADFMLQFLTWLLIL 194
           L+L+   K  K+EL     +      + ++I+  F+D++ E + + AD +LQF+T+LL++
Sbjct: 139 LALEPHAKVSKKELGRPPSS-----YDARKIMESFNDINLETIEVSADDLLQFMTFLLVI 193

Query: 195 SVECPTTNSTINNETNVQWDKFKIPAMNLLRTMNPDVVN--NIESHFITYQQFSTAIRTV 252
           +  C   N  +N      W  ++  A+N+LRTMNP +V+  +   + +T  QF   I  V
Sbjct: 194 TKYCIFENVEVNPSIYENWKDYESQALNILRTMNPCIVSYSDAAKNVVTLAQFKDCITAV 253

Query: 253 MPNLLKPLENLMEHFLYLQHDLVDYDTNLSSIQDSKIMTPALLAQLSTGLPKELFIQKLQ 312
            PNLL PL   M+H LY    LV       + + S +MT  LLAQL T  PK +  Q L+
Sbjct: 254 CPNLLTPLGVFMKHVLYKSEHLVSDSGATINDRSSTVMTDPLLAQLCTLWPKHIIYQNLK 313

Query: 313 SLYIGRKSGFSMRSLQAKVFKWMAPSILVVSGVRITNSEEYAANKNPRYRHFLEEFPILK 372
            L+I ++SGFS+RS QAKV  WMAPSIL+VSG++I +  +  A KN RY+ FL+E+P LK
Sbjct: 314 KLFIAKQSGFSIRSFQAKVVNWMAPSILLVSGMKIMDDSKLLA-KNQRYKSFLQEYPKLK 372

Query: 373 DSDQKMDASLMNKKKTTFAVYIDDPWKVTNKDYFGDLNTRIIQISPRQDIYKVNKKGTVY 432
           D DQK D+ +  K+K TFAV++ + WKVTNK+ FG+L T I+Q+SPRQ++++ +K G +Y
Sbjct: 373 DEDQKADSIVGGKRKVTFAVFVHEAWKVTNKEQFGNLKTLILQLSPRQEVFQASKNGNIY 432

Query: 433 FNTXXXXXXXXNKQPLIKSASKRYVPGNVSLTFDSTLEFAVFRNTGYGGSLDPGLLSMER 492
           FNT        N QP+IKS+ K+Y PGNVSLT D + EF VFRN G+GGS+ PG L +ER
Sbjct: 433 FNTVGGGIGIGNSQPVIKSSGKKYFPGNVSLTIDPSFEFGVFRNVGHGGSISPGKLFLER 492

Query: 493 KEENSSFELHILIQDVEVWGCGGEKELEEQIKQLAWEEAESKRRQQINLRSLGEDRALLE 552
            +   S E   +IQDVEVWGCGG+KE E Q+KQ  WEEAES+RRQ INL S+GED+ALLE
Sbjct: 493 PDVEQSLECRFIIQDVEVWGCGGDKEFEAQLKQWEWEEAESERRQYINLSSIGEDKALLE 552

Query: 553 MAGLVGQHQGGGSM 566
           M GLVG HQ GGS+
Sbjct: 553 MVGLVGHHQSGGSL 566

>KNAG0B04230 Chr2 complement(803845..805578) [1734 bp, 577 aa] {ON}
           Anc_5.431 YOR118W
          Length = 577

 Score =  456 bits (1172), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 237/552 (42%), Positives = 345/552 (62%), Gaps = 22/552 (3%)

Query: 31  FNTKAQRQITVPELVSLKGNLQI-ENLNTPISHKRLCNFLYFP------QNHTIIVGIVT 83
           +N +  RQ    EL + K  + +   LN  +  + L  +L  P      Q   ++VG++ 
Sbjct: 32  YNDRVLRQFNASELYTFKCRVGMTRQLNDVVLEQELLEWLCLPLEGHLQQPSKLLVGVI- 90

Query: 84  NMLRVLSNFPLVNSSYEPITGYGLLKCIVLLNKSRCEKFLKIKSYDQLKLLFISLSLQKT 143
              +VL  FP ++++   +T   LLK ++L+N+ +C K++  KSY+ L+L+F++L L + 
Sbjct: 91  ---KVLGQFPFISNTGGNLTAVSLLKAVILINRGKCLKYIGNKSYNHLELIFMALYLAQ- 146

Query: 144 DKEELSEDNENNGVKEKNIKQIITGFD---DVDTEVLYLPADFMLQFLTWLLILSVECPT 200
           D  + ++    +  +  NI+++I+ +D   D  +E+  + AD +LQF T LL+LS   P 
Sbjct: 147 DSHDSTKKESYDPKEPHNIEKVISSYDGNSDCVSEIT-VQADNLLQFTTMLLLLSARIPR 205

Query: 201 TNSTINNET-NVQWDKFKIPAMNLLRTMNPDVVNNIESHFITYQQFSTAIRTVMPNLLKP 259
            NS I+ +T +  W K++  A N++RTMN  ++++ ++H I++ QF   I  ++P +L  
Sbjct: 206 PNSQIDLKTADNDWAKYEKSAYNVIRTMNSSIISSCQTHTISFHQFYDVISILLPTILTT 265

Query: 260 LENLMEHFLYLQHDLVDYDTNLSSIQDSKIMTPALLAQLSTGLPKELF-IQKLQSLYIGR 318
           L+NL++H LY    LVD+     +  ++K+M     A L   L  + + I KLQ LY+GR
Sbjct: 266 LDNLLQHLLYTPDQLVDHTALGPTFTETKVMNHGSFALLQFALADKGYPISKLQKLYVGR 325

Query: 319 KSGFSMRSLQAKVFKWMAPSILVVSGVRITNSEEYAANKNPRYRHFLEEFPILKDSDQKM 378
            SGFSMRS Q KVF W AP++L VSG RI + ++Y+ NKNPRY  FLE+F  L+D+DQ++
Sbjct: 326 DSGFSMRSFQGKVFHWHAPTLLFVSGSRIQDDDDYSKNKNPRYSKFLEDFRKLRDTDQQL 385

Query: 379 DASLMNKKKTTFAVYIDDPWKVTNKDYFGDLNTRIIQISPRQDIYKVNKKGTVYFNTXXX 438
              L+ K+K  F +YI+ PW+VTNKDYF    T I Q+SP  DI+K N+   VYFNT   
Sbjct: 386 SPCLLKKRKVMFVIYIESPWRVTNKDYFSAGRTTIFQLSPELDIFKANRDDVVYFNTMGG 445

Query: 439 XXXXXNKQPLIKSASKRYVPGNVSLTFDSTLEFAVFRNTGYGGSLDPGLLSMERKEE--- 495
                + QP  K   + Y PGN+SLT DS+LEF  FRN G GG  +PG L   R  +   
Sbjct: 446 GIGIGDTQPYTKVNYREYRPGNISLTLDSSLEFGAFRNVGPGGMFEPGALFTRRNGDGVV 505

Query: 496 -NSSFELHILIQDVEVWGCGGEKELEEQIKQLAWEEAESKRRQQINLRSLGEDRALLEMA 554
            ++S+EL  LIQDVEVWGCGGEKEL EQ+KQL WEE E+KRRQ +NL+SL EDRALLEMA
Sbjct: 506 TSNSYELRFLIQDVEVWGCGGEKELSEQMKQLQWEETEAKRRQHVNLKSLSEDRALLEMA 565

Query: 555 GLVGQHQGGGSM 566
           GLVGQHQ GGS+
Sbjct: 566 GLVGQHQSGGSI 577

>CAGL0L11616g Chr12 complement(1240790..1242457) [1668 bp, 555 aa]
           {ON} similar to uniprot|Q12108 Saccharomyces cerevisiae
           YOR118w
          Length = 555

 Score =  454 bits (1169), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 233/551 (42%), Positives = 343/551 (62%), Gaps = 18/551 (3%)

Query: 20  KFANDRDVLTYFNTKAQRQITVPELVSLKGNLQIENLNTPISHKRLCNFLYFPQNHTIIV 79
           +F    ++L YFNT+  +  TV E+ + K      +LN PI    +   LY      +  
Sbjct: 19  QFKTRDEILQYFNTRVVKLFTVTEIAAFKKRFNAIDLNEPIDDTLIKEALYLDAQPNVWS 78

Query: 80  GIVTNMLRVLSNFPLVNSSY-EPITGYGLLKCIVLLNKSRCEKFLK--IKSYDQLKLLFI 136
             V+  +R+L NFPL +    + ITG+GLLK I ++N  R EK +   I  YD    + +
Sbjct: 79  A-VSETIRLLQNFPLFHQPIADSITGFGLLKVIAIINVKRFEKLVNTTITRYD----ITV 133

Query: 137 SLSLQKTDKEELSEDNENNGVKEKNIKQIITGFDDVDTEVLYLPADFMLQFLTWLLILSV 196
           +L L    KE        N +K  N+  I+  +D ++ E +++P D ++  + WLL L  
Sbjct: 134 TLGLCGQAKES------ENKIKSTNLGDILKTYDHIEIESIHIPYDKLILLVAWLLTLVT 187

Query: 197 ECPTTNSTIN-NETNVQWDKFKIPAMNLLRTMNPDVVNNIESHFITYQQFSTAIRTVMPN 255
              TTN  +  ++T   W+ FK  A+++  T++   + N     I       A  T+M +
Sbjct: 188 GVATTNCKVELSDTIANWNNFKSSAISIANTISTSALGNANDIGIPATDILNAFNTIMIS 247

Query: 256 LLKPLENLMEHFLYLQHDLVDYDTNLSSIQDSKIMTPALLAQLSTGLPKELFIQKLQSLY 315
           L+  + NL EH L+   DL+D+  +L+++    ++TP+L AQ+  GLP  + I KLQ LY
Sbjct: 248 LVPYMSNLFEHLLFGVDDLIDHVNDLANLSHQDVLTPSLYAQVIIGLPNSITITKLQKLY 307

Query: 316 IGRKSGFSMRSLQAKVFKWMAPSILVVSGVRITNSEEYAANKNPRYRHFLEEFPILKDSD 375
           +G++SGFSMRSLQ+KVF+W AP++++VSG RI++ E YA +KNPRYR FL  FP L+++D
Sbjct: 308 VGKESGFSMRSLQSKVFRWKAPTLMIVSGTRISDDESYADSKNPRYRSFLYSFPKLREND 367

Query: 376 QKMDASLMNKKKTTFAVYIDDPWKVTNKDYFGDLNTRIIQISPRQDIYKVNKKGTVYFNT 435
           Q +DA  + KKK T+AVYID+PWKV+NK+ FG  N  I++++P+Q  Y+   + T+YFNT
Sbjct: 368 QNLDAIHLTKKKVTYAVYIDEPWKVSNKEKFGATNMTIMELTPQQKTYQSCMERTMYFNT 427

Query: 436 XXXXXXXXNKQPLIKSASKRYVPGNVSLTFDSTLEFAVFRNTGYGGSLDPGLLSMERKEE 495
                   ++QP++K    +++PGN+SLT DS+LEF VFR+ G GG     LL     ++
Sbjct: 428 IGGGIGVGSEQPIVKQNDIKFIPGNISLTMDSSLEFGVFRHVGAGGGFKTSLLD---NDD 484

Query: 496 NSSFELHILIQDVEVWGCGGEKELEEQIKQLAWEEAESKRRQQINLRSLGEDRALLEMAG 555
           + SFE+  +IQ+VEVWGCGGEKEL EQ+KQL WEEAE+KRRQ INL+SL ED+ALLEM G
Sbjct: 485 SKSFEIRFIIQNVEVWGCGGEKELAEQLKQLEWEEAEAKRRQTINLQSLSEDKALLEMVG 544

Query: 556 LVGQHQGGGSM 566
           LVGQHQ GGS+
Sbjct: 545 LVGQHQSGGSV 555

>AER258C Chr5 complement(1111936..1113609) [1674 bp, 557 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR118W
          Length = 557

 Score =  352 bits (903), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 198/548 (36%), Positives = 305/548 (55%), Gaps = 16/548 (2%)

Query: 24  DRDVL-TYFNTKAQRQITVPELVSLKGNL--QIENLNTPISHKRLCNFLYFPQNHTIIVG 80
           DRD L  +FN +A RQ++  E  +   N+   IE     +  + L      P +      
Sbjct: 21  DRDALIAFFNARALRQLSAVEQWAFHQNIGKNIEPTEE-LDLQALATLYGVPADVPWFTE 79

Query: 81  IVTNMLRVLSNFPLVNSSYEPITGYGLLKCIVLLNKSRCEKFLKIKSYDQLKLLFISLSL 140
           +    +  L++FPL+N    P T  GLLK  +L NK R  ++   KSYD   L+   L+ 
Sbjct: 80  VFYTFVCRLTSFPLMNDC-SPPTYMGLLKVCLLFNKKRAARYTARKSYDVASLVLALLAP 138

Query: 141 QKTDKEELSEDNENNGVKEKNIKQIITGFDDVDTEVLYLPADFMLQFLTWLLILSVECPT 200
            +        D  +  V + +  ++I   D      L +  + ++++  ++  +S  C  
Sbjct: 139 PR--------DACDENVDQFDGDKLIDTLDGTFIAELEVRPNKLVRYSPFIAQISQVCNG 190

Query: 201 TNSTINNETNVQWDKFKIPAMNLLRTMNPDVVN--NIESHFITYQQFSTAIRTVMPNLLK 258
           +N  ++      W++     + LLR+++  +V+  +  S  ITYQQF+  +R+V PN+  
Sbjct: 191 SNEPLSRSMFPAWNRNNQIPLALLRSLDSTIVSRSDARSRSITYQQFAGGLRSVFPNVFD 250

Query: 259 PLENLMEHFLYLQHDLVDYDTNLSSIQDSKIMTPALLAQLSTGLPKELFIQKLQSLYIGR 318
            L   +E   Y++ D  +      + + S I+T  LL QLST  P+      +Q L++  
Sbjct: 251 ALGLFLERLFYVKRDTTNKLLYTPTKETSTIVTNLLLTQLSTLYPRINLFTSMQRLFVAG 310

Query: 319 KSGFSMRSLQAKVFKWMAPSILVVSGVRITNSEEYAANKNPRYRHFLEEFPILKDSDQKM 378
            +GFSM   QAKVFKWMAP+IL VSG RI + +E    KN RY+ FL+++P LKD++Q++
Sbjct: 311 DAGFSMSVFQAKVFKWMAPTILFVSGTRIQD-DEIVCTKNKRYKAFLQDYPALKDAEQQL 369

Query: 379 DASLMNKKKTTFAVYIDDPWKVTNKDYFGDLNTRIIQISPRQDIYKVNKKGTVYFNTXXX 438
                 K+   +A+++ DPWK+TNKD FGD++T IIQ++PRQ I+K  +   +YFN    
Sbjct: 370 ALCDRKKRNLIYAIFVRDPWKITNKDLFGDMDTTIIQLAPRQKIFKAQEAPNIYFNAVGG 429

Query: 439 XXXXXNKQPLIKSASKRYVPGNVSLTFDSTLEFAVFRNTGYGGSLDPGLLSMERKEENSS 498
                + QP +K A KRY PGNVS T D ++EFAVFRN G GG    G       E+  S
Sbjct: 430 GIGFGSSQPSVKPAGKRYFPGNVSFTVDPSMEFAVFRNVGDGGMFSHGSAVPAPAEQPLS 489

Query: 499 FELHILIQDVEVWGCGGEKELEEQIKQLAWEEAESKRRQQINLRSLGEDRALLEMAGLVG 558
           +E  ++I+D+EVWG GGE+EL++QI++  WEEAE+ +R+ I      EDRALLEMAG+VG
Sbjct: 490 YEHRLMIKDLEVWGYGGEEELQKQIQRWQWEEAEATKRKYIKTNGGNEDRALLEMAGIVG 549

Query: 559 QHQGGGSM 566
            +Q GGS+
Sbjct: 550 HYQSGGSV 557

>TBLA0A06530 Chr1 complement(1600111..1601589) [1479 bp, 492 aa]
           {ON} Anc_5.431 YOR118W
          Length = 492

 Score =  283 bits (724), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 193/533 (36%), Positives = 284/533 (53%), Gaps = 66/533 (12%)

Query: 32  NTKAQRQITVPELVSLKGNLQIENLNTPISHKRLCNFLYFPQNHTIIVGIVTNMLRVLSN 91
           NT  +   TV EL++ +  +   +L+  IS K +  F Y P +   +  +    +R L+ 
Sbjct: 18  NTLIKEIFTVSELITFQKRIN-RSLDDIISDKEIIKFSYIPDSKPHLQHLYLRFIRNLNK 76

Query: 92  FPLVNSSYEPITGYGLLKCIVLLNKSRCEK-FLKIKSYDQLKLLFISLSLQKTDKEELSE 150
           +P   S+   ITGY  LK I LLNK R  K F KI   + +K++F+ LS      EE+  
Sbjct: 77  YP---SNDNIITGYSYLKIITLLNKKRRNKMFPKI---EWIKIIFMCLS-----DEEV-- 123

Query: 151 DNENNGVKEKNIKQIITGFDDVDTEVLYLPADFMLQFLTWLLILSVECPTTNSTINNE-- 208
                        Q        D  VL    + +++F++ LL L++ C T    IN +  
Sbjct: 124 -------------QFPCWETTHDIHVL---ENDLIEFISLLLTLNMNCCTDYCLINQDLT 167

Query: 209 -TNVQWDKF-KIPAMNLLRTMNPDVVNNIESHFITYQQFSTAIRTVMPNLLKPLENLMEH 266
             +  WD + +  A  ++R M    V   E+           +  ++PN+   L+NL+EH
Sbjct: 168 FNDHDWDTYWRKSASCIVRDMKECNVEEFEN-----------VLLIVPNIFDCLKNLIEH 216

Query: 267 FLYLQHDLVDYDTNLSSIQDSKIMTPALLAQLSTGLPKELFIQKLQSLYIGRKSGFSMRS 326
            LY +  L +     S    +K M  A+L Q+   + K      +  LYIGR++G+SMRS
Sbjct: 217 SLYTKDQLKECPLGPSQFTKTK-MNQAILCQILLSMRKRSM--DISKLYIGRENGYSMRS 273

Query: 327 LQAKVFKWMAPSILVVSGVRITNSEEYAANKNPRYRHFLEEFPILKDSDQKMDASLMNKK 386
            Q+KVFKW AP+IL+++G +I N +EY+  KN RY+ FL  +P LKD        L    
Sbjct: 274 FQSKVFKWKAPTILLITGKKIINDQEYSE-KNNRYKSFLNSYPRLKDGKTTFQTPL---- 328

Query: 387 KTTFAVYIDDPWKVTNKDYFGDLNTRIIQISPRQDIYKVNKKGTVYFNTXXXXXXXXNKQ 446
             TFA+YI++PWK+T K YFG L+T+IIQ+SPRQD++       VYF+T           
Sbjct: 329 HYTFAIYIEEPWKMT-KGYFGGLHTKIIQLSPRQDVFTCTDPNAVYFHTQNGIGIGNEHM 387

Query: 447 PLIKSASKRYVPGNVSLTFDSTLEFAVFRNTGYGGSLDPGLLSMERKEENSSFELHILIQ 506
               S+  +Y PGNVS+T DSTLEFAVFR++G      PG+           FE+ + IQ
Sbjct: 388 ----SSDNKYKPGNVSITIDSTLEFAVFRHSG------PGVFKTGIIANQEIFEIRLHIQ 437

Query: 507 DVEVWGCGGEKELEEQIKQLAWEEAESKRRQQINLRSLGEDRALLEMAGLVGQ 559
            VEVWGCGG KEL EQ  +  WEE E++RRQ +++  + EDRALLE+AG++G+
Sbjct: 438 SVEVWGCGGAKELAEQKHEWEWEEREAQRRQHVSMH-VTEDRALLELAGIIGE 489

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 60,215,616
Number of extensions: 2812770
Number of successful extensions: 9573
Number of sequences better than 10.0: 35
Number of HSP's gapped: 9794
Number of HSP's successfully gapped: 36
Length of query: 566
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 451
Effective length of database: 40,294,809
Effective search space: 18172958859
Effective search space used: 18172958859
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)