Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_15.1766.21ON34534515980.0
YOR007C (SGT2)6.21ON34634514750.0
Skud_15.1686.21ON34834714190.0
Suva_15.1826.21ON34634513480.0
SAKL0E01210g6.21ON3233299631e-130
TDEL0G044806.21ON3433409191e-123
Kpol_1037.266.21ON3423349171e-122
Kwal_56.224336.21ON3223309091e-121
CAGL0E02739g6.21ON3433229061e-121
TPHA0J003406.21ON3383518991e-120
KNAG0M011706.21ON3393368971e-119
ZYRO0C07788g6.21ON3343238921e-119
NCAS0H008306.21ON3383428741e-116
NDAI0D008106.21ON3493498711e-115
KAFR0L004106.21ON3313348401e-111
KLTH0C11220g6.21ON3273318291e-109
Ecym_30256.21ON3183308151e-107
TBLA0G010506.21ON3503328001e-104
KLLA0D01155g6.21ON3353427791e-101
ACR005W6.21ON3273417111e-91
Kpol_1032.86.21ON3433525582e-68
TPHA0M002706.21ON3773623834e-42
NDAI0I022406.21ON3503483735e-41
NCAS0D026706.21ON3512363465e-37
TBLA0A072706.21ON3733353371e-35
CAGL0H08195g5.617ON583992233e-19
TPHA0D028805.617ON5852542216e-19
NDAI0F009105.617ON583992153e-18
KNAG0B032005.617ON5792272082e-17
ZYRO0A05676g5.617ON5721002083e-17
NCAS0G008105.617ON5842282073e-17
Smik_15.2055.617ON589992073e-17
Kwal_55.199355.617ON5931922048e-17
YOR027W (STI1)5.617ON5892312048e-17
Kpol_1018.695.617ON590992049e-17
KAFR0C058905.617ON5751002031e-16
SAKL0G07084g5.617ON585992022e-16
KLTH0E02178g5.617ON5931002003e-16
AEL224W5.617ON5802271993e-16
TBLA0E033005.617ON582991977e-16
KLLA0A07062g5.617ON5811001951e-15
Suva_8.805.617ON586991905e-15
Skud_15.1925.617ON589991896e-15
TDEL0A048405.617ON576991834e-14
Ecym_55825.617ON584991834e-14
NCAS0A00490singletonON6201011791e-13
Ecym_44133.481ON510741462e-09
TBLA0C039503.481ON5121481442e-09
KNAG0A079003.481ON512751409e-09
CAGL0D05060g3.481ON510741372e-08
Smik_6.2153.481ON513701372e-08
YGR123C (PPT1)3.481ON513701372e-08
NDAI0B057903.481ON523761372e-08
TDEL0D055003.481ON5121461363e-08
TPHA0D032203.481ON5131401345e-08
Skud_7.4323.481ON513701345e-08
Suva_7.4083.481ON513701329e-08
NCAS0F034903.481ON5121011301e-07
KAFR0B066103.481ON511741301e-07
SAKL0F03102g3.481ON513751292e-07
AAR083C3.481ON5381271248e-07
KLLA0F24046g2.152ON604711231e-06
KLTH0F14542g3.481ON5131411231e-06
Kpol_505.413.481ON513751221e-06
Kwal_55.211753.481ON511861167e-06
KLLA0B10912g3.481ON5121301122e-05
KLTH0B05170g2.152ON593711123e-05
KNAG0A039508.506ON3861041113e-05
KAFR0E029808.506ON3801321113e-05
Kwal_33.147672.152ON594861114e-05
NCAS0G024802.152ON596801097e-05
ZYRO0B04224g3.481ON5131101088e-05
CAGL0L04048g2.152ON587651088e-05
NCAS0B024008.506ON380921079e-05
Kpol_1018.1067.412ON753961043e-04
Smik_2.2958.506ON385891033e-04
CAGL0H07425g8.506ON3801281033e-04
TBLA0I023106.328ON11661955e-04
Kpol_1043.605.689ON706571025e-04
TBLA0H033808.506ON3751341015e-04
Ecym_20906.328ON17252976e-04
KAFR0F007202.152ON608711017e-04
Ecym_82042.152ON59771990.001
Suva_4.4058.506ON38589980.001
NDAI0F028102.152ON60980980.001
ABR131W2.152ON59471980.001
CAGL0K09240g6.328ON14256930.001
NCAS0B070102.152ON625104980.001
YBR155W (CNS1)8.506ON38589970.001
SAKL0H10934g8.506ON380104960.002
TDEL0B051402.152ON599104960.003
Kpol_513.28.506ON374105950.003
Ecym_25598.506ON370195950.003
YBL084C (CDC27)7.412ON75897950.003
Suva_2.347.412ON76397950.003
Skud_8.1782.152ON63898950.003
Smik_2.367.412ON75197950.003
TPHA0E007407.412ON74697940.004
ZYRO0G06512g2.152ON60471930.005
TDEL0B013108.506ON380103920.006
NCAS0I008703.395ON58558930.006
SAKL0A01672g6.328ON12852870.006
KLLA0E20857g7.412ON71087930.006
CAGL0C01903g7.412ON76997930.007
ADR230W5.689ON68570920.007
TPHA0L014208.506ON374129910.007
NDAI0B043402.152ON66498910.009
TBLA0C055302.152ON61065900.011
KNAG0I025206.328ON11759840.012
KLLA0B09966g8.506ON370130890.012
ZYRO0B03828g7.412ON72796900.013
AGL268C8.506ON379159890.014
Suva_15.3142.152ON64498890.016
Skud_2.2828.506ON38589880.020
YNL121C (TOM70)2.152ON61798880.021
KNAG0B012903.395ON53763880.023
TBLA0F032203.395ON53663870.032
KNAG0A041208.470ON602118860.035
TPHA0D038606.328ON12063810.037
Skud_14.2112.152ON61765860.040
Smik_8.1952.152ON63598860.042
TDEL0A074306.328ON12461800.049
YHR117W (TOM71)2.152ON63998850.052
Ecym_40315.689ON688111850.053
Skud_2.247.412ON76997850.060
KLLA0C08910g6.328ON11551790.067
YCR060W (TAH1)6.328ON11158780.067
SAKL0E10956g2.152ON60071840.071
Suva_14.2192.152ON61765830.080
Smik_14.2072.152ON61765830.082
NCAS0E024907.412ON80996830.094
KNAG0H035302.152ON61465830.100
CAGL0J09570g8.470ON549145820.13
Suva_16.4173.395ON53964810.17
NCAS0D045006.328ON12166750.26
KAFR0J025706.328ON12159750.26
KLLA0C15455g8.470ON566135780.32
KLLA0E08009g2.665ON72164780.35
SAKL0E14542g5.689ON69053780.36
Kpol_1048.212.152ON59771780.40
TPHA0L012108.470ON58864780.41
KLTH0E11748g8.506ON378174770.43
NDAI0C043205.352ON70667770.51
NDAI0A081703.395ON53967770.52
Kpol_1028.516.328ON11754720.54
TDEL0C027207.412ON70096770.56
AGL294W7.412ON65696760.68
TPHA0G004305.689ON72856760.71
Smik_3.1596.328ON11555710.72
CAGL0K11209g8.470ON59092750.75
NDAI0I004406.328ON12839710.78
NCAS0B025608.470ON57850750.83
Kpol_1006.43.367ON73297750.89
TBLA0H019705.352ON84076750.90
Kwal_27.117378.470ON575117750.91
CAGL0K07986g3.395ON53266750.93
SAKL0H11946g8.470ON573119741.0
AFR453W8.470ON569132741.1
NDAI0C051308.470ON590101731.3
NCAS0A147707.458ON30089721.4
Ecym_71427.412ON67596731.4
TPHA0I015102.152ON60371731.5
Skud_3.1356.328ON11858691.5
YBR111C (YSA1)3.365ON23141711.9
YKL022C (CDC16)2.665ON84066722.0
NCAS0F028705.352ON70067722.1
SAKL0F12936g7.412ON63296712.5
Suva_11.2042.665ON79364712.6
AAR054C6.328ON13361672.8
KLTH0E10934g8.470ON568117703.1
KAFR0C018505.352ON64664703.5
CAGL0H07095g5.352ON661113703.7
Smik_4.4918.470ON61250703.8
Skud_11.2062.665ON80264694.1
Smik_11.2322.665ON79366694.1
CAGL0C03289g4.6ON164879704.2
Skud_4.5068.470ON61150694.2
Suva_2.4108.470ON61150694.5
Kwal_55.220393.32ON90492694.5
KNAG0J028304.27ON37744684.6
Ecym_13968.470ON573132694.8
YDR244W (PEX5)8.470ON61250695.0
NDAI0F004005.689ON76469685.5
KNAG0B022407.412ON73996685.8
TDEL0B016608.470ON54949685.8
KLTH0F18150g5.689ON68988686.4
ACR173W7.458ON285109676.6
KLTH0A00638g7.546ON141166686.8
CAGL0E01573g3.32ON904101686.9
KLTH0F19140g3.32ON92489687.1
TBLA0A016908.470ON66284677.2
ZYRO0C17138g3.395ON53626678.2
Kwal_27.107407.412ON62893678.3
CAGL0M08030g1.456ON387116668.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_15.176
         (345 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {...   620   0.0  
YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON} ...   572   0.0  
Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {...   551   0.0  
Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {...   523   0.0  
SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}...   375   e-130
TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.2...   358   e-123
Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {O...   357   e-122
Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {O...   354   e-121
CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {...   353   e-121
TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON...   350   e-120
KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {...   350   e-119
ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} simila...   348   e-119
NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {O...   341   e-116
NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {O...   340   e-115
KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}...   328   e-111
KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar...   323   e-109
Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON} si...   318   e-107
TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {O...   312   e-104
KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {...   304   e-101
ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic hom...   278   1e-91
Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON...   219   2e-68
TPHA0M00270 Chr13 complement(53640..54773) [1134 bp, 377 aa] {ON...   152   4e-42
NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.2...   148   5e-41
NCAS0D02670 Chr4 complement(512529..513584) [1056 bp, 351 aa] {O...   137   5e-37
TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa] ...   134   1e-35
CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {...    91   3e-19
TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.6...    90   6e-19
NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}     87   3e-18
KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {O...    85   2e-17
ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly...    85   3e-17
NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {O...    84   3e-17
Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027...    84   3e-17
Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027...    83   8e-17
YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90...    83   8e-17
Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON} (1971...    83   9e-17
KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON} Anc_5...    83   1e-16
SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly...    82   2e-16
KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly...    82   3e-16
AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic ho...    81   3e-16
TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {O...    80   7e-16
KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {...    80   1e-15
Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W (...    78   5e-15
Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027...    77   6e-15
TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.6...    75   4e-14
Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {O...    75   4e-14
NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON}       74   1e-13
Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}...    61   2e-09
TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {O...    60   2e-09
KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa] ...    59   9e-09
CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {...    57   2e-08
Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON...    57   2e-08
YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}  ...    57   2e-08
NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa] ...    57   2e-08
TDEL0D05500 Chr4 complement(991567..993105) [1539 bp, 512 aa] {O...    57   3e-08
TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {O...    56   5e-08
Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON...    56   5e-08
Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON...    55   9e-08
NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {O...    55   1e-07
KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON} Anc_3...    55   1e-07
SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly...    54   2e-07
AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON} S...    52   8e-07
KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} simi...    52   1e-06
KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]...    52   1e-06
Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}...    52   1e-06
Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {...    49   7e-06
KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} simila...    48   2e-05
KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} simila...    48   3e-05
KNAG0A03950 Chr1 complement(529620..530780) [1161 bp, 386 aa] {O...    47   3e-05
KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.5...    47   3e-05
Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {...    47   4e-05
NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {O...    47   7e-05
ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly...    46   8e-05
CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} simil...    46   8e-05
NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {O...    46   9e-05
Kpol_1018.106 s1018 (280224..282485) [2262 bp, 753 aa] {ON} (280...    45   3e-04
Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W ...    44   3e-04
CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly...    44   3e-04
TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.32...    41   5e-04
Kpol_1043.60 s1043 (123502..125622) [2121 bp, 706 aa] {ON} (1235...    44   5e-04
TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.5...    44   5e-04
Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON} ...    42   6e-04
KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {O...    44   7e-04
Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}...    43   0.001
Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W ...    42   0.001
NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.1...    42   0.001
ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic ho...    42   0.001
CAGL0K09240g Chr11 complement(914042..914470) [429 bp, 142 aa] {...    40   0.001
NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON} Anc_2...    42   0.001
YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}  CNS1TPR-co...    42   0.001
SAKL0H10934g Chr8 complement(945834..946976) [1143 bp, 380 aa] {...    42   0.002
TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {O...    42   0.003
Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)...    41   0.003
Ecym_2559 Chr2 (1089202..1090314) [1113 bp, 370 aa] {ON} similar...    41   0.003
YBL084C Chr2 complement(67169..69445) [2277 bp, 758 aa] {ON}  CD...    41   0.003
Suva_2.34 Chr2 complement(63832..65304,65365..66183) [2292 bp, 7...    41   0.003
Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W ...    41   0.003
Smik_2.36 Chr2 complement(61159..63414) [2256 bp, 751 aa] {ON} Y...    41   0.003
TPHA0E00740 Chr5 complement(142456..144696) [2241 bp, 746 aa] {O...    41   0.004
ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {...    40   0.005
TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {O...    40   0.006
NCAS0I00870 Chr9 (160192..161949) [1758 bp, 585 aa] {ON} Anc_3.3...    40   0.006
SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {O...    38   0.006
KLLA0E20857g Chr5 (1860517..1862649) [2133 bp, 710 aa] {ON} simi...    40   0.006
CAGL0C01903g Chr3 complement(199487..201796) [2310 bp, 769 aa] {...    40   0.007
ADR230W Chr4 (1103275..1105332) [2058 bp, 685 aa] {ON} Syntenic ...    40   0.007
TPHA0L01420 Chr12 (293980..295104) [1125 bp, 374 aa] {ON} Anc_8....    40   0.007
NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON} Anc_2...    40   0.009
TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa] ...    39   0.011
KNAG0I02520 Chr9 complement(487699..488052) [354 bp, 117 aa] {ON...    37   0.012
KLLA0B09966g Chr2 complement(872760..873872) [1113 bp, 370 aa] {...    39   0.012
ZYRO0B03828g Chr2 (318153..320336) [2184 bp, 727 aa] {ON} simila...    39   0.013
AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON} S...    39   0.014
Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117...    39   0.016
Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W ...    39   0.020
YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON} ...    39   0.021
KNAG0B01290 Chr2 (244938..246551) [1614 bp, 537 aa] {ON} Anc_3.3...    39   0.023
TBLA0F03220 Chr6 complement(782214..783824) [1611 bp, 536 aa] {O...    38   0.032
KNAG0A04120 Chr1 complement(556919..558727) [1809 bp, 602 aa] {O...    38   0.035
TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.32...    36   0.037
Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {...    38   0.040
Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W ...    38   0.042
TDEL0A07430 Chr1 (1296631..1297005) [375 bp, 124 aa] {ON} Anc_6....    35   0.049
YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}  TOM71Mitoc...    37   0.052
Ecym_4031 Chr4 complement(73900..75966) [2067 bp, 688 aa] {ON} s...    37   0.053
Skud_2.24 Chr2 complement(50790..53099) [2310 bp, 769 aa] {ON} Y...    37   0.060
KLLA0C08910g Chr3 complement(781726..782073) [348 bp, 115 aa] {O...    35   0.067
YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Compone...    35   0.067
SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} simila...    37   0.071
Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {...    37   0.080
Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {...    37   0.082
NCAS0E02490 Chr5 complement(493779..496208) [2430 bp, 809 aa] {O...    37   0.094
KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.1...    37   0.100
CAGL0J09570g Chr10 complement(941571..943220) [1650 bp, 549 aa] ...    36   0.13 
Suva_16.417 Chr16 complement(718714..720333) [1620 bp, 539 aa] {...    36   0.17 
NCAS0D04500 Chr4 (855490..855855) [366 bp, 121 aa] {ON} Anc_6.32...    33   0.26 
KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.3...    33   0.26 
KLLA0C15455g Chr3 (1341570..1343270) [1701 bp, 566 aa] {ON} simi...    35   0.32 
KLLA0E08009g Chr5 (720700..722865) [2166 bp, 721 aa] {ON} simila...    35   0.35 
SAKL0E14542g Chr5 (1199439..1201511) [2073 bp, 690 aa] {ON} weak...    35   0.36 
Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {O...    35   0.40 
TPHA0L01210 Chr12 (252106..253872) [1767 bp, 588 aa] {ON} Anc_8....    35   0.41 
KLTH0E11748g Chr5 (1043203..1044339) [1137 bp, 378 aa] {ON} simi...    34   0.43 
NDAI0C04320 Chr3 complement(983914..986034) [2121 bp, 706 aa] {O...    34   0.51 
NDAI0A08170 Chr1 complement(1870449..1872068) [1620 bp, 539 aa] ...    34   0.52 
Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {...    32   0.54 
TDEL0C02720 Chr3 (477529..479631) [2103 bp, 700 aa] {ON} Anc_7.4...    34   0.56 
AGL294W Chr7 (154711..156681) [1971 bp, 656 aa] {ON} Syntenic ho...    34   0.68 
TPHA0G00430 Chr7 complement(77860..80046) [2187 bp, 728 aa] {ON}...    34   0.71 
Smik_3.159 Chr3 (222475..222822) [348 bp, 115 aa] {ON} YCR060W (...    32   0.72 
CAGL0K11209g Chr11 (1089300..1091072) [1773 bp, 590 aa] {ON} sim...    33   0.75 
NDAI0I00440 Chr9 complement(89650..90036) [387 bp, 128 aa] {ON} ...    32   0.78 
NCAS0B02560 Chr2 complement(427447..429183) [1737 bp, 578 aa] {O...    33   0.83 
Kpol_1006.4 s1006 complement(17836..20034) [2199 bp, 732 aa] {ON...    33   0.89 
TBLA0H01970 Chr8 (464239..466761) [2523 bp, 840 aa] {ON} Anc_5.3...    33   0.90 
Kwal_27.11737 s27 (926622..928349) [1728 bp, 575 aa] {ON} YDR244...    33   0.91 
CAGL0K07986g Chr11 complement(792641..794239) [1599 bp, 532 aa] ...    33   0.93 
SAKL0H11946g Chr8 complement(1020512..1022233) [1722 bp, 573 aa]...    33   1.0  
AFR453W Chr6 (1251460..1253169) [1710 bp, 569 aa] {ON} Syntenic ...    33   1.1  
NDAI0C05130 Chr3 (1193350..1195122) [1773 bp, 590 aa] {ON} Anc_8...    33   1.3  
NCAS0A14770 Chr1 complement(2911657..2912559) [903 bp, 300 aa] {...    32   1.4  
Ecym_7142 Chr7 complement(287110..289137) [2028 bp, 675 aa] {ON}...    33   1.4  
TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {O...    33   1.5  
Skud_3.135 Chr3 (208664..209020) [357 bp, 118 aa] {ON} YCR060W (...    31   1.5  
YBR111C Chr2 complement(461178..461873) [696 bp, 231 aa] {ON}  Y...    32   1.9  
YKL022C Chr11 complement(394726..397248) [2523 bp, 840 aa] {ON} ...    32   2.0  
NCAS0F02870 Chr6 complement(573068..575170) [2103 bp, 700 aa] {O...    32   2.1  
SAKL0F12936g Chr6 (1016829..1018727) [1899 bp, 632 aa] {ON} simi...    32   2.5  
Suva_11.204 Chr11 complement(378512..380893) [2382 bp, 793 aa] {...    32   2.6  
AAR054C Chr1 complement(440706..441107) [402 bp, 133 aa] {ON} Sy...    30   2.8  
KLTH0E10934g Chr5 (981831..983537) [1707 bp, 568 aa] {ON} simila...    32   3.1  
KAFR0C01850 Chr3 (369596..371536) [1941 bp, 646 aa] {ON} Anc_5.3...    32   3.5  
CAGL0H07095g Chr8 (700262..702247) [1986 bp, 661 aa] {ON} simila...    32   3.7  
Smik_4.491 Chr4 (895429..897267) [1839 bp, 612 aa] {ON} YDR244W ...    32   3.8  
Skud_11.206 Chr11 complement(375601..378009) [2409 bp, 802 aa] {...    31   4.1  
Smik_11.232 Chr11 complement(381701..384082) [2382 bp, 793 aa] {...    31   4.1  
CAGL0C03289g Chr3 (328799..333745) [4947 bp, 1648 aa] {ON} simil...    32   4.2  
Skud_4.506 Chr4 (905143..906978) [1836 bp, 611 aa] {ON} YDR244W ...    31   4.2  
Suva_2.410 Chr2 (729992..731827) [1836 bp, 611 aa] {ON} YDR244W ...    31   4.5  
Kwal_55.22039 s55 (1084478..1087192) [2715 bp, 904 aa] {ON} YNL3...    31   4.5  
KNAG0J02830 Chr10 complement(542239..543372) [1134 bp, 377 aa] {...    31   4.6  
Ecym_1396 Chr1 (820413..822134) [1722 bp, 573 aa] {ON} similar t...    31   4.8  
YDR244W Chr4 (950563..952401) [1839 bp, 612 aa] {ON}  PEX5Peroxi...    31   5.0  
NDAI0F00400 Chr6 complement(96274..98568) [2295 bp, 764 aa] {ON}...    31   5.5  
KNAG0B02240 Chr2 complement(434466..436685) [2220 bp, 739 aa] {O...    31   5.8  
TDEL0B01660 Chr2 complement(295823..297472) [1650 bp, 549 aa] {O...    31   5.8  
KLTH0F18150g Chr6 (1462613..1464682) [2070 bp, 689 aa] {ON} weak...    31   6.4  
ACR173W Chr3 (657718..658575) [858 bp, 285 aa] {ON} Syntenic hom...    30   6.6  
KLTH0A00638g Chr1 complement(63363..67598) [4236 bp, 1411 aa] {O...    31   6.8  
CAGL0E01573g Chr5 complement(149084..151798) [2715 bp, 904 aa] {...    31   6.9  
KLTH0F19140g Chr6 (1550056..1552830) [2775 bp, 924 aa] {ON} simi...    31   7.1  
TBLA0A01690 Chr1 complement(404419..406407) [1989 bp, 662 aa] {O...    30   7.2  
ZYRO0C17138g Chr3 complement(1330370..1331980) [1611 bp, 536 aa]...    30   8.2  
Kwal_27.10740 s27 complement(476617..478503) [1887 bp, 628 aa] {...    30   8.3  
CAGL0M08030g Chr13 complement(800149..801312) [1164 bp, 387 aa] ...    30   8.7  

>Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {ON}
           YOR007C (REAL)
          Length = 345

 Score =  620 bits (1598), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/345 (90%), Positives = 312/345 (90%)

Query: 1   MLASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFERDAASGILGKSEF 60
           MLASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFERDAASGILGKSEF
Sbjct: 1   MLASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFERDAASGILGKSEF 60

Query: 61  KGKSLADVLNSASKASESNEKDDAQNVEVNIPXXXXXXXXXXXXLKMQGNKAMANKDYEL 120
           KGKSLADVLNSASKASESNEKDDAQNVEVNIP            LKMQGNKAMANKDYEL
Sbjct: 61  KGKSLADVLNSASKASESNEKDDAQNVEVNIPEEDAETKAKAEDLKMQGNKAMANKDYEL 120

Query: 121 AINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPSYFRGYSRLGFAK 180
           AINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPSYFRGYSRLGFAK
Sbjct: 121 AINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPSYFRGYSRLGFAK 180

Query: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKAVPEQSRDADANA 240
           YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKAVPEQSRDADANA
Sbjct: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKAVPEQSRDADANA 240

Query: 241 SQXXXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPSIRQMAE 300
           SQ                     MNNPQLMQAAQKMMSNPGAMQNIQKMMQDPSIRQMAE
Sbjct: 241 SQGAGSSGLPDLGSLLGGGLGGLMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPSIRQMAE 300

Query: 301 GFTSGGGAPNLSDLMNNPALRNMAGNLFGGADAPSSEGTPDSENK 345
           GFTSGGGAPNLSDLMNNPALRNMAGNLFGGADAPSSEGTPDSENK
Sbjct: 301 GFTSGGGAPNLSDLMNNPALRNMAGNLFGGADAPSSEGTPDSENK 345

>YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON}
           SGT2Glutamine-rich cytoplasmic protein that serves as a
           scaffold for binding Get4/5p and other proteins required
           to mediate posttranslational insertion of tail-anchored
           proteins into the ER membrane; has similarity to human
           cochaperone SGT
          Length = 346

 Score =  572 bits (1475), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/345 (82%), Positives = 300/345 (86%)

Query: 1   MLASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFERDAASGILGKSEF 60
           M ASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFER+A SGILGKSEF
Sbjct: 1   MSASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFEREAVSGILGKSEF 60

Query: 61  KGKSLADVLNSASKASESNEKDDAQNVEVNIPXXXXXXXXXXXXLKMQGNKAMANKDYEL 120
           KG+ LAD+LNSAS+  ESN+KDDA+NVE+NIP            LKMQGNKAMANKDYEL
Sbjct: 61  KGQHLADILNSASRVPESNKKDDAENVEINIPEDDAETKAKAEDLKMQGNKAMANKDYEL 120

Query: 121 AINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPSYFRGYSRLGFAK 180
           AINKYTEAI+VLPTNAIYYANRAAAHSSL+EYD+AVKDAES+ISIDPSYFRGYSRLGFAK
Sbjct: 121 AINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAK 180

Query: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKAVPEQSRDADANA 240
           YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEK VPEQSRDAD +A
Sbjct: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKTVPEQSRDADVDA 240

Query: 241 SQXXXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPSIRQMAE 300
           SQ                     MNNPQLMQAAQKMMSNPGAMQNIQKMMQDPSIRQMAE
Sbjct: 241 SQGASAGGLPDLGSLLGGGLGGLMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPSIRQMAE 300

Query: 301 GFTSGGGAPNLSDLMNNPALRNMAGNLFGGADAPSSEGTPDSENK 345
           GF SGGG PNLSDLMNNPALRNMAGNLFGGA A S++ TPD+ENK
Sbjct: 301 GFASGGGTPNLSDLMNNPALRNMAGNLFGGAGAQSTDETPDNENK 345

>Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {ON}
           YOR007C (REAL)
          Length = 348

 Score =  551 bits (1419), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/347 (80%), Positives = 295/347 (85%), Gaps = 2/347 (0%)

Query: 1   MLASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFERDAASGILGKSEF 60
           M ASK EIA+LIVNYFSSIVEKKEISED ADSLNVAMDCISEAFGFER+A   IL  SEF
Sbjct: 1   MSASKGEIASLIVNYFSSIVEKKEISEDSADSLNVAMDCISEAFGFEREAVPSILENSEF 60

Query: 61  KGKSLADVLNSASKASESNEKDDAQNVEVNIPXXXXXXXXXXXXLKMQGNKAMANKDYEL 120
           KG++L D+LNS S+ SES +KDDAQNVEVNIP            LKMQGNKAMANKDYEL
Sbjct: 61  KGQNLTDLLNSTSRVSESTKKDDAQNVEVNIPEEDAEIKAKAEDLKMQGNKAMANKDYEL 120

Query: 121 AINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPSYFRGYSRLGFAK 180
           AINKYTEAI+VLPTNAIYYANRAAAHSSL+ YDEAV+DAES+ISIDP+YFRGYSRLGFAK
Sbjct: 121 AINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPTYFRGYSRLGFAK 180

Query: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKAVPEQSRDADAN- 239
           YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEK VPEQSRDADAN 
Sbjct: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKTVPEQSRDADANA 240

Query: 240 -ASQXXXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPSIRQM 298
            ASQ                     MNNPQLMQAAQKMMSNPGAMQNIQKMMQDP+I+QM
Sbjct: 241 DASQGAGTSGLPDLGSLLGGGLGGLMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPNIKQM 300

Query: 299 AEGFTSGGGAPNLSDLMNNPALRNMAGNLFGGADAPSSEGTPDSENK 345
           AEGFTSGGGAPNLSDLMNNPALR+MAGNLFGGA APS+E T DSENK
Sbjct: 301 AEGFTSGGGAPNLSDLMNNPALRSMAGNLFGGAGAPSTEDTSDSENK 347

>Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {ON}
           YOR007C (REAL)
          Length = 346

 Score =  523 bits (1348), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/345 (78%), Positives = 290/345 (84%)

Query: 1   MLASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFERDAASGILGKSEF 60
           M ASKEEIA+LIVNYFSSIVEKKE+SED ADSLNVAMDCISEAFGFERDA S IL KS F
Sbjct: 1   MSASKEEIASLIVNYFSSIVEKKEVSEDSADSLNVAMDCISEAFGFERDAVSSILDKSTF 60

Query: 61  KGKSLADVLNSASKASESNEKDDAQNVEVNIPXXXXXXXXXXXXLKMQGNKAMANKDYEL 120
           KG+SL ++L+S+SK  ES +KDDAQNVEVNIP            LK+QGNKAMANK+YEL
Sbjct: 61  KGQSLNNLLSSSSKLPESGKKDDAQNVEVNIPEEDAETKAKAEELKIQGNKAMANKEYEL 120

Query: 121 AINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPSYFRGYSRLGFAK 180
           AI KYTEAI VLPTNAIYYANRAAAHSSL+EYDEA+KDAES+IS+DPSYFRGYSRLGFAK
Sbjct: 121 AIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGYSRLGFAK 180

Query: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKAVPEQSRDADANA 240
           YAQGKPEEALEAYKKVLDIEGDNAT+AMKRDYESAKK+VEQSLNLEK  PEQ RDA ANA
Sbjct: 181 YAQGKPEEALEAYKKVLDIEGDNATDAMKRDYESAKKRVEQSLNLEKTAPEQPRDAGANA 240

Query: 241 SQXXXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPSIRQMAE 300
            Q                     MNNPQLMQAAQKMMSNPGAMQNIQ MMQDPSIRQMAE
Sbjct: 241 GQGAGAGGLPDLGSLLGGGLGGLMNNPQLMQAAQKMMSNPGAMQNIQNMMQDPSIRQMAE 300

Query: 301 GFTSGGGAPNLSDLMNNPALRNMAGNLFGGADAPSSEGTPDSENK 345
           GFTSGGG PNLSDLM NPALRNMAG+LFGGADAPS+E TPDSE K
Sbjct: 301 GFTSGGGTPNLSDLMKNPALRNMAGSLFGGADAPSTEDTPDSETK 345

>SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 323

 Score =  375 bits (963), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 192/329 (58%), Positives = 245/329 (74%), Gaps = 8/329 (2%)

Query: 1   MLASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFERDAASGILGKSEF 60
           M  S +EIAALIV++ SS VEK  +SED ADSLNVA+DCISEAF FERDA S I+ K+ F
Sbjct: 1   MAQSNKEIAALIVDFLSSTVEKNAVSEDYADSLNVAIDCISEAFEFERDAVSEIV-KNSF 59

Query: 61  KGKSLADVLNSASKASESNEKDDAQNVEVNIPXXXXXXXXXXXXLKMQGNKAMANKDYEL 120
             + L ++L SA+ A  +     ++ V+VNIP            LK+QGNKAMA+KD+E 
Sbjct: 60  DNRKLDELLKSAATALPTQ----SEPVKVNIPAEDANTKAKAEDLKLQGNKAMASKDFET 115

Query: 121 AINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPSYFRGYSRLGFAK 180
           AI KYTEAI+VLP+NA+YYANRAAA+SSL++Y+E+V+DAES+I ++PSY +GYSRLGFAK
Sbjct: 116 AIKKYTEAIEVLPSNAVYYANRAAAYSSLKKYEESVQDAESAIKVNPSYSKGYSRLGFAK 175

Query: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKAVPEQSRDADANA 240
           YA GKPEEALEAYK VLDIEGD AT+ MKRDYE+AK+KVEQSLNLEK+VP Q+ + +++ 
Sbjct: 176 YALGKPEEALEAYKTVLDIEGDKATDVMKRDYETAKRKVEQSLNLEKSVPTQTDEQESST 235

Query: 241 SQXXXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPSIRQMAE 300
                                  +NNPQ+M AAQK+M NPGAM    +MM++P++RQMAE
Sbjct: 236 DAGAGASGFPDMASLLGGGLGGLLNNPQVMSAAQKLMQNPGAM---DEMMKNPAVRQMAE 292

Query: 301 GFTSGGGAPNLSDLMNNPALRNMAGNLFG 329
            F+SGGG PNL DLM+NPA+++MA NLFG
Sbjct: 293 NFSSGGGTPNLGDLMSNPAIKDMAKNLFG 321

>TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.21
           YOR007C
          Length = 343

 Score =  358 bits (919), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 182/340 (53%), Positives = 238/340 (70%), Gaps = 5/340 (1%)

Query: 1   MLASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFERDAASGILGKSEF 60
           M  S +E+A+LIV+Y S +VEKK +SE+  DSLNVA+DCI E+F  ++  +  + G    
Sbjct: 1   MSPSNKEVASLIVDYLSQLVEKKAVSEEAIDSLNVAIDCIGESFEVQKGDSKAVFG---- 56

Query: 61  KGKSLADVLNSASKASESNEKDDAQNVEVNIPXXXXXXXXXXXXLKMQGNKAMANKDYEL 120
            GK L ++L + S +S       A++++VNIP            LK++GNKAMA KD++L
Sbjct: 57  -GKGLVELLQNESGSSSETATTQAESIKVNIPAEDAETKAKAETLKLEGNKAMACKDFDL 115

Query: 121 AINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPSYFRGYSRLGFAK 180
           AI KY++AI+VLPTNA+YYANRAAAHSS++ Y+EA+KDAES+I  DP+Y +GYSRLG+AK
Sbjct: 116 AIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRLGYAK 175

Query: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKAVPEQSRDADANA 240
           +A G+ E+ALEAYKKVLDIEGD A++ MKRDYE+AKKKVEQSL+LEK    Q+R ADA A
Sbjct: 176 FALGQAEDALEAYKKVLDIEGDKASDVMKRDYETAKKKVEQSLDLEKKPETQARGADAGA 235

Query: 241 SQXXXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPSIRQMAE 300
                                  +NNPQLMQAAQ+MM NP AM  ++ MMQ+P +RQMAE
Sbjct: 236 GGAGGSGGFGDFASMLGGGLGGLLNNPQLMQAAQQMMQNPQAMSQMESMMQNPGVRQMAE 295

Query: 301 GFTSGGGAPNLSDLMNNPALRNMAGNLFGGADAPSSEGTP 340
            F  G G PN+ DLMNNPALR+MAG+LFGGA+  +    P
Sbjct: 296 NFAQGNGMPNMGDLMNNPALRDMAGSLFGGANGNAPNDVP 335

>Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {ON}
           complement(59590..60618) [1029 nt, 343 aa]
          Length = 342

 Score =  357 bits (917), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 185/334 (55%), Positives = 246/334 (73%), Gaps = 7/334 (2%)

Query: 1   MLASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFERDAASGILGKSEF 60
           M  S ++IAALI+++ S++V+K E+SED ADSLNVAMDCI+EAF FERD+ +G++ KS F
Sbjct: 1   MSVSNKDIAALIIDFLSTVVDKNEVSEDNADSLNVAMDCIAEAFEFERDSVAGVV-KSSF 59

Query: 61  KGKSLADVLNSASKASESNEKDDAQNVEVNIPXXXXXXXXXXXXLKMQGNKAMANKDYEL 120
           +G SL+  LN ++ AS +    D + V+VN+             LK++GNKAMA KDYEL
Sbjct: 60  QGNSLSSYLNGSTSASAATTTAD-ETVKVNVTEDDTEASEAAEALKLEGNKAMAGKDYEL 118

Query: 121 AINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPSYFRGYSRLGFAK 180
           AI KYTEAI  LPTNA+Y+ANRAAA+SSL++YDEAV+DA S+I I+P+Y +GYSRLGFAK
Sbjct: 119 AIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRLGFAK 178

Query: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKAVPEQSRDADANA 240
           +AQGK E+ALEAYKKVLDIEGD ATE MKRDYE+AKKKVEQSLNLEK+    +  A++++
Sbjct: 179 FAQGKAEDALEAYKKVLDIEGDKATEMMKRDYETAKKKVEQSLNLEKSTVSGNATAESDS 238

Query: 241 SQXXXXXXXXX-----XXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPSI 295
           +                           +NNPQLMQAAQ+MM +P AM+ ++ MMQ+PS+
Sbjct: 239 ASAADPFAGMGGMPDFSSMLGGGGLGNLLNNPQLMQAAQQMMQDPEAMKQVESMMQNPSV 298

Query: 296 RQMAEGFTSGGGAPNLSDLMNNPALRNMAGNLFG 329
           +QMA+ F+SG G P+ S LMN+P++R+MA N+FG
Sbjct: 299 KQMADQFSSGNGTPDFSALMNDPSIRDMAKNMFG 332

>Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {ON}
           YOR007C (SGT2) - small glutamine-rich tetratricopeptide
           repeat containing protein [contig 185] FULL
          Length = 322

 Score =  354 bits (909), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 184/330 (55%), Positives = 239/330 (72%), Gaps = 11/330 (3%)

Query: 1   MLASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFERDAASGILGKSEF 60
           M  S +++A LIV++ S  VE KE+SED  DSLNVA+DCI+EAF F+R++ +  L K+ F
Sbjct: 1   MSPSNKDLANLIVDFLSHTVENKEVSEDYVDSLNVAIDCITEAFEFDRESVATTLEKT-F 59

Query: 61  KGKSLADVLNSASKASESNEKDDAQNVEVNIPXXXXXXXXXXXXLKMQGNKAMANKDYEL 120
            G+SL  V+ +AS  S S +    ++V+VNIP            LK++GNKAMA KD+E 
Sbjct: 60  AGRSLKQVVEAASVGSSSPQ----ESVKVNIPVEDAETKAKAESLKLEGNKAMAAKDFEQ 115

Query: 121 AINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPSYFRGYSRLGFAK 180
           A+ KY+EAIQVLPTNA+YYANRAAAHSSL++Y+EAVKDAE +I ++PSY +GYSRLGFA+
Sbjct: 116 AVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPSYSKGYSRLGFAQ 175

Query: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKAVPEQSRDADANA 240
           YA GKPEEAL+AYKKVLDIEG+ AT+AMKRDY++A KKV QSLN+EK+ P  +RD   +A
Sbjct: 176 YALGKPEEALDAYKKVLDIEGEAATDAMKRDYDTAMKKVGQSLNVEKSAPAATRDGAGSA 235

Query: 241 SQXXXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPSIRQMAE 300
           +                       NNPQLMQAAQ+MM NP AMQ +   M +P+++QMAE
Sbjct: 236 TGSGGLPDISSMLGGGLGGLL---NNPQLMQAAQQMMQNPNAMQEV---MNNPAVKQMAE 289

Query: 301 GFTSGGGAPNLSDLMNNPALRNMAGNLFGG 330
            F SGGG P+++DLMNNPAL +MA N+FGG
Sbjct: 290 KFQSGGGTPSMADLMNNPALMDMAKNMFGG 319

>CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007c SGT2
          Length = 343

 Score =  353 bits (906), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 184/322 (57%), Positives = 225/322 (69%), Gaps = 6/322 (1%)

Query: 7   EIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFERDAASGILGKSEFKGKSLA 66
           E+AA+I+ Y   +V +K + ED  DS+NVA+DCI+E+F  ER     +L +S    K L 
Sbjct: 4   EVAAVIIKYLEGVVAEKAVGEDYLDSVNVAIDCIAESFEVERGDVDSVLKQSGI-SKGLE 62

Query: 67  DVLNSASKASESNEKDDAQNVEVNIPXXXXXXXXXXXXLKMQGNKAMANKDYELAINKYT 126
           + L      +  +E     +V+VNIP            LK++GNKAMA KD+ELAI KY+
Sbjct: 63  ECLECMKGGAVKSE-----DVKVNIPAEDAETKAKAEALKLEGNKAMAGKDFELAIAKYS 117

Query: 127 EAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPSYFRGYSRLGFAKYAQGKP 186
           EAI+VLPTNAIYYANRAAAHSSL++YDEAV DAE +I IDP+Y +GYSRLGFAKYAQ KP
Sbjct: 118 EAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQNKP 177

Query: 187 EEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKAVPEQSRDADANASQXXXX 246
           EEALEAYKKV+D+EGD AT+ MKRDYE+AKKKVEQSLNLEK    +  D+ A A      
Sbjct: 178 EEALEAYKKVMDLEGDKATDIMKRDYETAKKKVEQSLNLEKTPDARGADSGAGAGAGAGG 237

Query: 247 XXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPSIRQMAEGFTSGG 306
                            MNNPQ+MQAAQ+MMSNP A+Q +Q MMQDPSIRQMAE FTSG 
Sbjct: 238 AGGFDFSSMLSGGLSGLMNNPQIMQAAQQMMSNPQALQQMQSMMQDPSIRQMAEQFTSGN 297

Query: 307 GAPNLSDLMNNPALRNMAGNLF 328
           G PN+ DLM+NPALRNMA ++F
Sbjct: 298 GTPNMDDLMSNPALRNMASSMF 319

>TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score =  350 bits (899), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 190/351 (54%), Positives = 242/351 (68%), Gaps = 25/351 (7%)

Query: 1   MLASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFERDAASGILGKSEF 60
           M AS +EIAALIV+Y +++V+KKE+S D ADSLNVAMDCI+EAF FERD+    + KS F
Sbjct: 1   MAASNKEIAALIVDYLNNVVDKKEVSGDNADSLNVAMDCIAEAFEFERDSVKDTV-KSAF 59

Query: 61  KGKSLADVLN-SASKASESNEKDDAQNVEVNIPXXXXXXXXXXXXLKMQGNKAMANKDYE 119
            G  L   L+ SA+   + N  DDA + E                LK++GNKAMA KDYE
Sbjct: 60  NGNGLTSFLSGSATNDIQVNIADDAADEE---------QKATAEGLKLEGNKAMATKDYE 110

Query: 120 LAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPSYFRGYSRLGFA 179
            AI KY+EAI+VLPTNA+YYANRAAA+SSL++YD+AV DAES+I ++P+Y +GYSRLGFA
Sbjct: 111 SAIKKYSEAIEVLPTNAVYYANRAAAYSSLKKYDDAVNDAESAIKVNPTYSKGYSRLGFA 170

Query: 180 KYAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKAVPEQSRDADAN 239
           K+AQGK E+AL+AYKKVLDIEGD AT+ MKRDYE+AKKKVEQSLNLEK  P+++ + ++N
Sbjct: 171 KFAQGKVEDALDAYKKVLDIEGDKATDIMKRDYETAKKKVEQSLNLEKVTPKEA-ETESN 229

Query: 240 ASQXXXXXX----------XXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQKM 289
           A                                 + NPQ+MQAAQ+MM NP AMQ ++ M
Sbjct: 230 ADAGTGAAGMGGMGGFPDLSSMLGGGLGGGLGDLLKNPQIMQAAQQMMQNPNAMQQMESM 289

Query: 290 MQDPSIRQMAEGFTSGGGAPNLSDLMNNPALRNMAGNLFGGADAPSSEGTP 340
           MQ+P++RQMAE F SG G P+LS +MNNP L++MA N+FG    P   G P
Sbjct: 290 MQNPAVRQMAENFASGEGTPDLSAMMNNPDLKDMAKNMFGNGGFP---GAP 337

>KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {ON}
           Anc_6.21 YOR007C
          Length = 339

 Score =  350 bits (897), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 174/336 (51%), Positives = 242/336 (72%), Gaps = 5/336 (1%)

Query: 1   MLASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFERDAASGILGKSEF 60
           M  S +E+++LI++Y + +V K E+S D  DSLNVA+DC++E FG E+D  S  + +S+F
Sbjct: 1   MAYSNKEVSSLIIDYLNKVVSKAEVSADDIDSLNVAIDCLTEVFGVEKDTLSATI-ESKF 59

Query: 61  KGKSLADVLNSASKASESNEKDDAQNVEVNIPXXXXXXXXXXXXLKMQGNKAMANKDYEL 120
            GKSL ++L++AS+ + + ++   + V++NIP            LK++GNKA+A+KDY+L
Sbjct: 60  NGKSLTELLDAASQNAGNTDECKTETVKINIPQEDAETKAKAEALKLEGNKAVASKDYDL 119

Query: 121 AINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPSYFRGYSRLGFAK 180
           A+ KYTEAI++LPTNA+Y+ANRAAA+++ + YDEAVKDAE +I +DP+Y +GYSRL +AK
Sbjct: 120 AVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAK 179

Query: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKAVPEQSRDADANA 240
           Y Q   EE+LEAYKKVL+IEGD+ATE  KR YE+AKK+VE+SLNLEK+VP +S     N 
Sbjct: 180 YVQENFEESLEAYKKVLEIEGDSATEVTKRGYETAKKRVEESLNLEKSVPTESAGGQTNP 239

Query: 241 SQXXXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPSIRQMAE 300
           +                      MNNPQ+MQAAQ MMSNPGAM+ IQ MMQ+P+I+QMAE
Sbjct: 240 A---AGGGFPDFSSLMSGGLEGLMNNPQMMQAAQSMMSNPGAMEKIQSMMQNPAIQQMAE 296

Query: 301 GFTSGGGAPNLSDLMNNPALRNMAGNLFGGADAPSS 336
            F  GG  P+ S++MNNPA+RNMA +LF GA  P++
Sbjct: 297 QF-KGGNTPDFSEMMNNPAVRNMASSLFSGAGEPAA 331

>ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} similar
           to uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 334

 Score =  348 bits (892), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 175/323 (54%), Positives = 229/323 (70%), Gaps = 9/323 (2%)

Query: 1   MLASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFERDAASGILGKSEF 60
           M  S ++I++LIV+Y + +V+KK +SED  DSLNVA++CI+EAFG E+ ++S   G    
Sbjct: 1   MAPSNKDISSLIVDYLADVVDKKSVSEDSIDSLNVAIECITEAFGIEKGSSSAAFG---- 56

Query: 61  KGKSLADVLNSASKASESNEKDDAQNVEVNIPXXXXXXXXXXXXLKMQGNKAMANKDYEL 120
            GK+LA++L++ + A  S      +NV+VNIP            LK++GNKAMA KDYEL
Sbjct: 57  -GKNLAELLSAGAGAPSSQ----GENVKVNIPAEDAELKSKAESLKLEGNKAMAGKDYEL 111

Query: 121 AINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPSYFRGYSRLGFAK 180
           AI KY+EAI V+PTNA+YYANRAAAHSSL+ YDEA+KDAES++ +D SY +GYSRLG+AK
Sbjct: 112 AIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYSRLGYAK 171

Query: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKAVPEQSRDADANA 240
           +AQGK EEALEAYKKVLDIEGD+AT+ MKRDYE+AK+KVEQ+L L K    ++ D     
Sbjct: 172 FAQGKSEEALEAYKKVLDIEGDSATDVMKRDYETAKRKVEQALELNKTDETETSDRGTGE 231

Query: 241 SQXXXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPSIRQMAE 300
                                  +NNPQ+MQAAQ+MM NP AM  ++ MMQ+P++RQMAE
Sbjct: 232 PAGANPGGGFDLSSMLGGGLGGLLNNPQVMQAAQQMMQNPQAMSQMETMMQNPNVRQMAE 291

Query: 301 GFTSGGGAPNLSDLMNNPALRNM 323
            F  G G PNL+D+MNNPALR+M
Sbjct: 292 KFAGGNGTPNLNDIMNNPALRDM 314

>NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score =  341 bits (874), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 182/342 (53%), Positives = 239/342 (69%), Gaps = 13/342 (3%)

Query: 1   MLASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFERDAASGILGKSEF 60
           M  S +E+ +LIV++ S++++ KEISED ADSLNVA+DCI+E+F FERD  +  L + +F
Sbjct: 1   MSLSNKEVGSLIVDFLSTVIKNKEISEDSADSLNVAIDCITESFEFERDTVAQTL-QDKF 59

Query: 61  KGKSLADVLNSASKASESNEKDDAQNVEVNIPXXXXXXXXXXXXLKMQGNKAMANKDYEL 120
            GK+L ++L+SAS  S  +EK+++  V+VNIP             K++GNKAMA KDY L
Sbjct: 60  SGKTLKEILSSASATSTGSEKEES--VKVNIPVEDAEIKATAESFKLEGNKAMAAKDYRL 117

Query: 121 AINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPSYFRGYSRLGFAK 180
           AI KY+EAI+ LPTN IYYANRAAA+SS++EYD A+KDAE +I IDP+Y +GYSRL FAK
Sbjct: 118 AIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFAK 177

Query: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKA---VPEQSRD-- 235
           YA  KPEEALE YKKVLD+EGD AT AMKRD+E AK +VE S+NLEK+    PE SR   
Sbjct: 178 YALNKPEEALEYYKKVLDMEGDKATPAMKRDFEMAKNRVESSMNLEKSSTTTPEPSRSAG 237

Query: 236 ---ADANASQXXXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQKMMQD 292
              A+  A                       +NNPQ+MQAAQ+MMS+P +MQ +Q+MMQ+
Sbjct: 238 QQPANPFAGSGMPDMSSLFGNGGGMGGLSSFLNNPQVMQAAQQMMSDPNSMQKMQEMMQN 297

Query: 293 PSIRQMAEGFTSGGGAPNLSDLMNNPALRNMAGNLFGGADAP 334
           P++R+MA+   SG    NL DLMNNP++++MA NLFG   AP
Sbjct: 298 PNLREMAQNLASGDA--NLDDLMNNPSVKDMANNLFGPNGAP 337

>NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {ON}
           Anc_6.21 YOR007C
          Length = 349

 Score =  340 bits (871), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 184/349 (52%), Positives = 238/349 (68%), Gaps = 17/349 (4%)

Query: 1   MLASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFERDAASGILGKSEF 60
           M  + ++I ALIV++ S+I+EK E+SED ADSLNVAMDCISEA  F+R+     + K++F
Sbjct: 1   MSLNNKDIGALIVDFLSTIIEKNEVSEDNADSLNVAMDCISEALEFDREVVPETI-KNKF 59

Query: 61  KGKSLADVLNSASKASESNEKDDAQNVEVNIPXXXXXXXXXXXXLKMQGNKAMANKDYEL 120
            GK+L D+LN+ S A+ +   +  ++VEVNIP             K++GNKAMA KD+ L
Sbjct: 60  NGKTLVDILNTTSTATANTTIEKEESVEVNIPVEDAEIKANAEAFKLEGNKAMAMKDFHL 119

Query: 121 AINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPSYFRGYSRLGFAK 180
           A+ KYTEAI++LPTNAIYYANRAAAHSSL+E++EA+KDAES+I IDPSY +GYSRL FAK
Sbjct: 120 AVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSRLAFAK 179

Query: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKA-VPEQSR----- 234
           Y  GK EEALE+YKKVLDIEGDNAT  MKRDYE+AKK+VE+S+N+EK+  PEQ +     
Sbjct: 180 YGLGKHEEALESYKKVLDIEGDNATAGMKRDYETAKKRVEESMNVEKSKTPEQGQGQQQT 239

Query: 235 --DADANASQXXX----XXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQK 288
              A  NA                           ++NP  M  AQK+MS+P AMQ +Q 
Sbjct: 240 NESAQGNAPNPFAGGMPDMSSLFGGAGMGGGLGSLLSNPDFMSTAQKLMSDPNAMQQVQS 299

Query: 289 MMQDPSIRQMAEGFTSGGGAPNLSDLMNNPALRNMAGNLFGGADAPSSE 337
           MM DPS+R +A  F +G    +++D+MNNPA+RNMA NLF G   PS E
Sbjct: 300 MMSDPSMRDLANNFKNGNT--DMNDIMNNPAIRNMASNLFKG--NPSEE 344

>KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}
           Anc_6.21 YOR007C
          Length = 331

 Score =  328 bits (840), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 176/334 (52%), Positives = 228/334 (68%), Gaps = 12/334 (3%)

Query: 1   MLASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFERDAASGILGKSEF 60
           M  S +EI+ LIV+Y   + EK ++SED  DSLNVA+DCI+++F FERD+ SG++ KS+F
Sbjct: 1   MPLSNKEISTLIVDYLVKVTEKNDVSEDVKDSLNVAIDCITDSFEFERDSTSGLI-KSKF 59

Query: 61  KGKSLADVLNSASKASESNEKDDAQNVEVNIPXXX----XXXXXXXXXLKMQGNKAMANK 116
              SL ++L  A + S        +NV VN+P                LK++GNKAMA K
Sbjct: 60  YNLSLPELLEVAMENSAK------ENVTVNVPKDELENDEETKVKAEKLKLEGNKAMAMK 113

Query: 117 DYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPSYFRGYSRL 176
           D++LAI KY+EAI + P NAIYYANRAAA+SSL+++++A +DAES+I +DP+Y +GYSRL
Sbjct: 114 DFDLAIAKYSEAISISPNNAIYYANRAAAYSSLKDFEKATEDAESAIRVDPNYSKGYSRL 173

Query: 177 GFAKYAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKAVPEQSRDA 236
           GFAKYA  KPEEALEAYKKVLD+EGD ATE MKRDYE+AKK+VEQSLNLEK       ++
Sbjct: 174 GFAKYALNKPEEALEAYKKVLDLEGDKATEIMKRDYETAKKRVEQSLNLEKKESTPKEES 233

Query: 237 DANASQXXXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPSIR 296
              ++                      +NNPQLMQAAQ+MMS+P AM  IQ MMQ+PSIR
Sbjct: 234 VTESAANAAAGGFPDMSSMLGGGLNGLLNNPQLMQAAQQMMSDPNAMSKIQSMMQNPSIR 293

Query: 297 QMAEGFTSGGGAPNLSDLMNNPALRNMAGNLFGG 330
           QMAE F   G  P+ S LMN+P +++MA N FGG
Sbjct: 294 QMAENF-QNGNTPDFSQLMNDPNIKDMAKNFFGG 326

>KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar to
           uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 327

 Score =  323 bits (829), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 173/331 (52%), Positives = 239/331 (72%), Gaps = 8/331 (2%)

Query: 1   MLASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFERDAASGILGKSEF 60
           M  +K+E+A+LI++Y     E KEI ED  DSLNVA+DC++EAF  E+++AS ++ KS F
Sbjct: 1   MNPTKKELASLIIDYLCRTAEGKEIGEDYIDSLNVAIDCVTEAFEVEKESASSVIEKS-F 59

Query: 61  KGKSLADVLNSASKASESNEKDDAQNVEVNIPXXXXXXXXXXXXLKMQGNKAMANKDYEL 120
            G+SL  ++ ++SK   + +++    V+VNIP            LK++GNKAMA KD+E 
Sbjct: 60  GGQSLEQIVGASSKGPTATQQEP---VKVNIPVEDAEIKAKAEALKLEGNKAMATKDFEH 116

Query: 121 AINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPSYFRGYSRLGFAK 180
           AI+KY+EAI+ LP+NA+Y+ANRAAA+SSL++Y EAV+DAE++I ++PSY +GYSRLGFA+
Sbjct: 117 AISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQ 176

Query: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKAVPEQSRDADANA 240
           YA G+PEEAL+AYKKVLDIEG NAT+AMKRDY++A KKVEQSLN+E++ P  S     +A
Sbjct: 177 YALGRPEEALDAYKKVLDIEGSNATDAMKRDYDTAMKKVEQSLNVERSAPAASNAESPDA 236

Query: 241 SQXXX-XXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPSIRQMA 299
           +                       + NPQ+MQAAQ+MM NP AM   Q+MM +P+I+QMA
Sbjct: 237 AGGSGFPDIASMLGGGLGGGLGGLLKNPQVMQAAQQMMQNPNAM---QEMMSNPAIKQMA 293

Query: 300 EGFTSGGGAPNLSDLMNNPALRNMAGNLFGG 330
           + F SGGG P+++DLMNNPAL +MA N+FGG
Sbjct: 294 DKFQSGGGTPSMADLMNNPALMDMAKNMFGG 324

>Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON}
           similar to Ashbya gossypii ACR005W
          Length = 318

 Score =  318 bits (815), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 171/330 (51%), Positives = 230/330 (69%), Gaps = 15/330 (4%)

Query: 1   MLASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFERDAASGILGKSEF 60
           M  S +EIAALIV + S+    K++ E+  DSLNVA+DCI+EAF  ER+ ++ I+ K+ +
Sbjct: 1   MPGSNKEIAALIVQFLSTST--KDVQEEYVDSLNVAIDCIAEAFEIEREDSNEIVSKA-Y 57

Query: 61  KGKSLADVLNS-ASKASESNEKDDAQNVEVNIPXXXXXXXXXXXXLKMQGNKAMANKDYE 119
            G+ L D++ S AS+ + S+ +    N + + P            LK++GNKA A KD+E
Sbjct: 58  NGRGLVDLVKSGASEPTLSSSEPTGNNTDAHAPEVAERAEN----LKLEGNKAFAAKDFE 113

Query: 120 LAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPSYFRGYSRLGFA 179
            A+ KYTEAI+++P NA++Y NRAAA+SS ++++EAV+DAES++ I+PSY RGYSRLG A
Sbjct: 114 GAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLA 173

Query: 180 KYAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKAVPEQSRDADAN 239
           KYA GKPEEA+EAYKKVLDIEGDNATEAMKRDYESAKKKVE+SLNLE A+P   +  +  
Sbjct: 174 KYALGKPEEAMEAYKKVLDIEGDNATEAMKRDYESAKKKVEESLNLE-ALP---KGEEQQ 229

Query: 240 ASQXXXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPSIRQMA 299
            S+                     +NNPQ+MQAAQKMM NP AM   Q+MM +P+I+QMA
Sbjct: 230 TSEGSSAGGFPDLSSMLGGGLGGLLNNPQVMQAAQKMMQNPSAM---QEMMNNPAIKQMA 286

Query: 300 EGFTSGGGAPNLSDLMNNPALRNMAGNLFG 329
           + F SGGG PNL D+M +P +++MAG  FG
Sbjct: 287 QNFASGGGTPNLGDMMKDPNIKDMAGKFFG 316

>TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {ON}
           Anc_6.21 YOR007C
          Length = 350

 Score =  312 bits (800), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 168/332 (50%), Positives = 227/332 (68%), Gaps = 13/332 (3%)

Query: 1   MLASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFERDAASGILGKSEF 60
           M  S ++IA L+V++ S+ +EKK +S D ADSLNVA+DCI+EAF FE+D     L  S+F
Sbjct: 1   MSYSNKDIANLLVDFLSTAIEKKAVSSDNADSLNVAIDCITEAFEFEKDDVKSTLA-SKF 59

Query: 61  KGKSLADVLNSASKASESNEKDDAQNVEVNIPXXXXXX----XXXXXXLKMQGNKAMANK 116
            GKSL ++L++A+ A         ++++V+I                 LK++GNKAMA K
Sbjct: 60  GGKSLTELLDAATNAK--GRSSSPEDIKVSISDKDEEEDKELAAKAEALKLEGNKAMAAK 117

Query: 117 DYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPSYFRGYSRL 176
           DY LA+ KY  AI+++PT A+YYANRAAA+SS  +YDEA+KDAES+I ++P++ +GYSRL
Sbjct: 118 DYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRL 177

Query: 177 GFAKYAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKAVPEQSRDA 236
           GFAK+AQGK +EALEAYKK L+++GD AT+ MKRDYE+AKKKVEQSLN+EK+    +   
Sbjct: 178 GFAKFAQGKSQEALEAYKKALEVDGDKATDIMKRDYETAKKKVEQSLNVEKSATPSAS-- 235

Query: 237 DANASQXXXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPSIR 296
              AS                      +NNPQ+MQAAQ+MMSNP AM+ ++ MMQ+PSIR
Sbjct: 236 ---ASASASAGGMPDMASMLGGGLGSFLNNPQIMQAAQQMMSNPRAMEQMESMMQNPSIR 292

Query: 297 QMAEGFTSGGGAPNLSDLMNNPALRNMAGNLF 328
           QMAE  +S G +  + D MNNPA+R MA NLF
Sbjct: 293 QMAENLSS-GSSEGMGDFMNNPAIREMASNLF 323

>KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 335

 Score =  304 bits (779), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 173/342 (50%), Positives = 231/342 (67%), Gaps = 21/342 (6%)

Query: 1   MLASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFERDAASGILGKSEF 60
           M  S +EIAALIV++ SS      ++ED  DSLNVA+DCI+EAF FERD    ++    F
Sbjct: 1   MSLSNKEIAALIVDFLSS--SSSSVNEDYVDSLNVAIDCITEAFQFERDETDSLIS-GPF 57

Query: 61  KGKSLADVLNSA-SKASESNEKDDAQNVEVNIPXXXXXXXXXXXXLKMQGNKAMANKDYE 119
            GK L ++L SA S    S E      V+V+IP            LK+QGNKAMA K ++
Sbjct: 58  NGKKLPELLASAPSSGGVSGEP-----VKVHIPVEDAAAKAKAEELKLQGNKAMAAKKFD 112

Query: 120 LAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPSYFRGYSRLGFA 179
            AI KYT AI+V P+NA+YY+NRAAA+SSL++Y++AVKDAE +I +DP+Y +G+SRLGFA
Sbjct: 113 EAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFA 172

Query: 180 KYAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKAVPEQSRD--AD 237
           KYA  KPEEAL+AYKKVLDIEG+ AT+ MKRDYE+AKKKVE S+NLEK+    S +  +D
Sbjct: 173 KYALNKPEEALDAYKKVLDIEGEKATDVMKRDYETAKKKVETSMNLEKSSTSASSEDVSD 232

Query: 238 ANASQXXXX-------XXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQKMM 290
            +A++                            +NNPQ+MQAA+KMM NPG MQ+   MM
Sbjct: 233 KSATEGPGAGAGGLPDLSSLLGGGGLGGGLGALLNNPQVMQAAEKMMQNPGLMQD---MM 289

Query: 291 QDPSIRQMAEGFTSGGGAPNLSDLMNNPALRNMAGNLFGGAD 332
            +P+++QMA  F+SGGG P+LS +MN+P++R+MA N+FGG +
Sbjct: 290 SNPAMKQMANQFSSGGGMPDLSQMMNDPSIRDMAKNMFGGGN 331

>ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR007C (SGT2)
          Length = 327

 Score =  278 bits (711), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 161/341 (47%), Positives = 218/341 (63%), Gaps = 28/341 (8%)

Query: 1   MLASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFERDAASGILGKSEF 60
           M  S ++IAALIV++ ++    K + ED  DSL VA+DCI+EAF      A  ++ + + 
Sbjct: 1   MSPSNKDIAALIVDFLTT--SAKTVGEDYEDSLKVAIDCITEAFELGPGEADTLVSE-KC 57

Query: 61  KGKSLADVLNSA-SKASESNEKDDAQNVEVNIPXXXXXXXXXXXXLKMQGNKAMANKDYE 119
            G+SL+ +L +  +  S++ E   A                    LK++GN+AMA KDYE
Sbjct: 58  GGRSLSQLLTTGMAHTSDAGEPKVA----------AEELKKEAEALKLEGNRAMAAKDYE 107

Query: 120 LAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPSYFRGYSRLGFA 179
            AI KYT AI+VLPT+A+YYANRAAA+SSL++Y++AV+DAE +  +D SY +G+SRLG+A
Sbjct: 108 TAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYA 167

Query: 180 KYAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEK--AVPEQSRDAD 237
           KYA G+ EEALEAYK+VLDIEGDNATEAM+RDYESAK+KVE+S+N+++   V E    A 
Sbjct: 168 KYALGRHEEALEAYKRVLDIEGDNATEAMRRDYESAKRKVEESINMDRNAEVTESGDSAA 227

Query: 238 AN---------ASQXXXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQK 288
            +         AS                      +NNPQ+MQAAQKMM NP A   IQ+
Sbjct: 228 GSAGGSGLPDLASMFGGGGLGGGLGGGLGGGLGGLLNNPQVMQAAQKMMQNPSA---IQE 284

Query: 289 MMQDPSIRQMAEGFTSGGGAPNLSDLMNNPALRNMAGNLFG 329
           MM +P+I++MAE F SG G+  L DLM +PA+RNMA   FG
Sbjct: 285 MMSNPAIKKMAENFASGNGSSGLGDLMADPAVRNMASKFFG 325

>Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON}
           complement(15762..16793) [1032 nt, 344 aa]
          Length = 343

 Score =  219 bits (558), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 130/352 (36%), Positives = 194/352 (55%), Gaps = 21/352 (5%)

Query: 1   MLASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGF----ERDAASGILG 56
           M  + ++  ALIVNY   I++ KE+SED A+SLNVA+DCIS+ F      E    + +  
Sbjct: 1   MSLNNKDFGALIVNYLHKIIDGKEVSEDNAESLNVAIDCISDVFELDPTSEEKIINDVFN 60

Query: 57  KSEFKGKSLADV-LNSASKASESNEKDDAQNVEVNIPXXXXXXXXXXXXLKMQGNKAMAN 115
           KS+ K  +L  + L + S         D   +EV               LK++GNK M+ 
Sbjct: 61  KSDLKTITLKGLGLQNVS---------DVVELEVKNEEISEDKKKEAEALKLEGNKQMSL 111

Query: 116 KDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPSYFRGYSR 175
           K+Y+ AI+KY++AI++ P+N  YY+NRAAA+  + ++  AV DA ++I +DP+Y + YSR
Sbjct: 112 KNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSKAYSR 171

Query: 176 LGFAKYAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKAVPEQSRD 235
           LG AK A+G  E+A+ A+KKVL++EGD +TE MK DYE+AKK V+  + L K VP+ S  
Sbjct: 172 LGAAKLAEGNNEDAVHAFKKVLELEGDKSTEVMKNDYENAKKLVQTFVTLNKNVPDPSGP 231

Query: 236 ADANASQXXXXXXXXXXXXXXXXXXXXXMNNP--QLMQAAQKMMSNPGAMQNIQKMMQDP 293
              N +                      MNN              NP  MQ ++ +MQ+P
Sbjct: 232 PPLNTTD-----VLTDIATVLGSSFGSLMNNTQMMQRAQQMMQTQNPEMMQQVEGLMQNP 286

Query: 294 SIRQMAEGFTSGGGAPNLSDLMNNPALRNMAGNLFGGADAPSSEGTPDSENK 345
            +RQ AE   +G G   LSD++NNP+++ +A  L  G +  SS    + E+K
Sbjct: 287 VVRQFAENVANGNGPGGLSDVLNNPSVKEVANGLMNGYNVASSVTVEEPESK 338

>TPHA0M00270 Chr13 complement(53640..54773) [1134 bp, 377 aa] {ON}
           Anc_6.21 YOR007C
          Length = 377

 Score =  152 bits (383), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 111/362 (30%), Positives = 168/362 (46%), Gaps = 49/362 (13%)

Query: 1   MLASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFERDAASGILGKSEF 60
           M  + +EIA++IV+YF+  +   ++++D  DSLNVA+DCI++ F  ++D  S IL K+ +
Sbjct: 1   MNTTDQEIASIIVDYFNKCITSGKLNQDNVDSLNVAIDCIADVFDVDKDLISNIL-KTAY 59

Query: 61  KGKSLADVL-NSASKASESNEKDDAQNV-------------------EVNIPXXXXXXXX 100
           +   L   L N    A   ++K+   NV                   ++N+P        
Sbjct: 60  RSNDLLTYLPNGKRSALNLDKKNTTINVSVQTKDKINAYNDLSRNKDDINVPVKVIEDIE 119

Query: 101 XXX-------------XLKMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHS 147
                            LK +GN+ M  K Y  AI  Y++AI++ PTN  YY NRA A+ 
Sbjct: 120 ETKETKVSNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYI 179

Query: 148 SLREYDEAVKDAESSISID----PSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDI---- 199
               +D A+ DA  SI ID    P+ F+ Y RLG AKY  G  E +L A+K++++I    
Sbjct: 180 KANNFDHAIIDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQEN 239

Query: 200 -EGDNATEAMKRDYESAKKKVEQSLNLEKAVPEQSRDADANASQX--XXXXXXXXXXXXX 256
            +GD  T+ M  DYE AK+KV Q L   +      ++   N+                  
Sbjct: 240 NKGDEITKQMDADYEKAKEKV-QELFFMQITKSTGKEGSGNSVNDGPKRKVTLNDILNMA 298

Query: 257 XXXXXXXMNNPQLMQAAQKMM-SNPGAMQNIQKMMQDPSIRQMAEGFTSG--GGAPNLSD 313
                  M+NP   +  ++++ SNP A Q    +M DP +RQM E   S      P L D
Sbjct: 299 GNNLNIIMSNPLFKEVVEQLLASNPQAKQQFDNVMNDPRVRQMKENVNSDSMSNIPILKD 358

Query: 314 LM 315
           L 
Sbjct: 359 LF 360

>NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.21
           YOR007C
          Length = 350

 Score =  148 bits (373), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 111/348 (31%), Positives = 164/348 (47%), Gaps = 52/348 (14%)

Query: 1   MLASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFERDAASGILGKSEF 60
           M  +KE+ A+LI++Y S +     + ED  +SL VA+ CI E+F  + D    IL  S  
Sbjct: 1   MSLTKEQTASLIISYLSYLTNNNVLDEDKKESLRVAITCIGESFSLDGD----ILPTS-L 55

Query: 61  KGKSLADVLNSASKASESNEKDDAQNVEVNIPXXXXXXXXXXXXLKMQGNKAMANKDYEL 120
           K ++L  +L       E+ +K   +  E                LK +GN+AM    YE 
Sbjct: 56  KERTLKTILQENLNTLEATQKIHNEEAEA---------------LKKEGNEAMIEGQYEE 100

Query: 121 AINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPSYFRGYSRLGFAK 180
           AI KYTEAIQ    N  YY+NR+ A+S L  Y++AV DA  +I+IDPS+ + YSRLG+AK
Sbjct: 101 AIKKYTEAIQ-FSKNVAYYSNRSLAYSKLGRYEDAVNDATLAINIDPSFSKAYSRLGYAK 159

Query: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEK------------- 227
             Q K E+ + AYK+ +D+EG NA++ +  DYE A+ K EQ   L+K             
Sbjct: 160 CCQDKLEDGMTAYKRAIDLEGTNASKTLYDDYEDARFKYEQ---LKKNDDSEERKSIKEV 216

Query: 228 ---AVPEQSRDADANASQXXXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQ 284
                PE++ + D   +                           L   A+ + S  G   
Sbjct: 217 TSEECPEKNNNQDEGFTAVNHYAQNNDNKSKEETKEENRSQAADLSNIARLLGSGVGG-- 274

Query: 285 NIQKMMQDPSIRQMAEGFTSGGGAPNLS----DLMNNPALRNMAGNLF 328
               +M +P ++QM   F +    P+ S    D++NNP LR     L 
Sbjct: 275 ----LMNNPQLKQMV--FQAINDNPDASRQVKDVLNNPLLRTTLSELM 316

>NCAS0D02670 Chr4 complement(512529..513584) [1056 bp, 351 aa] {ON}
           Anc_6.21 YOR007C
          Length = 351

 Score =  137 bits (346), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 87/236 (36%), Positives = 140/236 (59%), Gaps = 28/236 (11%)

Query: 1   MLASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFERDAASGILGKSEF 60
           M  S +EIA+ IV+Y SS++   +++ED A+S++VA++CI ++F  + + ++     S+ 
Sbjct: 1   MSLSNKEIASRIVSYLSSLIRTGQVTEDYAESISVAIECIRDSFDLQEEVSAD----SDL 56

Query: 61  KGKSLADV-LNSASKASES-NEKDDAQNVEVNIPXXXXXXXXXXXXLKMQGNKAMANKDY 118
               LA++ L    K SE   E  + Q ++                LK++GNKA+  ++Y
Sbjct: 57  ATVLLANLNLEPEPKLSEKERELVNEQAIK----------------LKLEGNKAVERENY 100

Query: 119 ELAINKYTEAIQVLPTNAI-----YYANRAAAHSSLREYDEAVKDAESSISIDPSYFRGY 173
           + AI+KYT AI +L  N +     Y +N++ A +    Y+EA  DA + I IDP++ +GY
Sbjct: 101 KDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEACDDALACIKIDPTFSKGY 160

Query: 174 SRLGFAKYAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKAV 229
           SRL  AK  Q K E+A+ AYK+VLD+EG+ AT+ MKRD+E  K+K E +LN    +
Sbjct: 161 SRLAEAKIGQNKYEDAMNAYKQVLDLEGNKATDTMKRDFEITKQKFE-TLNFSTHI 215

>TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa]
           {ON} Anc_6.21 YOR007C
          Length = 373

 Score =  134 bits (337), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 91/335 (27%), Positives = 164/335 (48%), Gaps = 34/335 (10%)

Query: 6   EEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFG-------------FERDAAS 52
           +++A LIVN+  +++ KKEIS+D  DSLNVA+DCI + +              F +   +
Sbjct: 9   KDVACLIVNFLENVISKKEISQDNIDSLNVAIDCIQQCYNLNEAYISSSLILKFSKSDLT 68

Query: 53  GIL---GKSEFKGKSLA----------DVLNSASKASESN-EKDDAQNVEVNIPXXXXXX 98
            IL    K+ +K  +              LN + K ++SN   D+ + + +N+       
Sbjct: 69  SILNNFAKNNYKNITSTKETTPLTLEPSSLNESVKKNQSNISNDNNEKISINLNDTSKNN 128

Query: 99  -----XXXXXXLKMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYD 153
                       K +GN+ M ++DY+ AI  YT AI   P + IYY+NR+ A+  + +Y+
Sbjct: 129 FSDKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYE 188

Query: 154 EAVKDAESSISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNATEAMKRDYE 213
            A+ DA   ISID ++ + Y RL   K  Q +  +AL+ YKK +++  D+  E + R++E
Sbjct: 189 SAINDANFCISIDANFSKAYIRLANIKVQQHQYIDALDYYKKFIELNKDSVPEKITREFE 248

Query: 214 SAKKKVEQSLNLEKAVPEQSRDADANASQXXXXXXXXXXXXXXXXXXXXXMNNPQLMQAA 273
             K KV+  ++L + +     + + N +                      ++NP L Q  
Sbjct: 249 DLKLKVQTDISL-REISNDHSNNNYNENSYNSTKNSPDIGSILGDGFAALLSNPMLQQMI 307

Query: 274 QKMM-SNPGAMQNIQKMMQDPSIRQMAEGFTSGGG 307
            K++ +NP A +NI  ++ +P+++ + + F +G  
Sbjct: 308 FKIIQNNPDAAKNIGYVLANPAMKNLLQNFKNGSA 342

>CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027w STI1
          Length = 583

 Score = 90.5 bits (223), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 70/99 (70%), Gaps = 1/99 (1%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIQVLPT-NAIYYANRAAAHSSLREYDEAVKDAESSIS 164
           K QGN A   KDYE AI+ +++AI+V  T N ++Y+NR+A ++SL+++ EA+ DAE  + 
Sbjct: 8   KQQGNAAFVAKDYEKAIDLFSKAIEVSETPNHVFYSNRSACYASLKKFPEALNDAEECVK 67

Query: 165 IDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDN 203
           I+P++ +GY+RLG A    G  +EA  +YKK L+++G N
Sbjct: 68  INPTWSKGYNRLGAAHLGLGDLDEAEGSYKKALELDGSN 106

 Score = 55.5 bits (132), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 43/77 (55%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISI 165
           +++G       D+  A+  YTE I+  P +A  Y+NRAAA S L  + EA++D   +I  
Sbjct: 394 RLEGKDYFTKGDWPNAVKAYTEMIKRAPEDARGYSNRAAALSKLMSFPEAIEDCNKAIEK 453

Query: 166 DPSYFRGYSRLGFAKYA 182
           DP++ R Y R   A+ A
Sbjct: 454 DPNFIRAYIRKATAQIA 470

>TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.617
           YOR027W
          Length = 585

 Score = 89.7 bits (221), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 68/254 (26%), Positives = 122/254 (48%), Gaps = 62/254 (24%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIQVLP-TNAIYYANRAAAHSSLREYDEAVKDAESSIS 164
           K QGN A + K+YE A++ +++AI+V P  N + Y+NR+A ++SL+++ +A+ DA     
Sbjct: 9   KQQGNTAFSAKEYEKAVDLFSKAIEVSPEPNHVLYSNRSACYTSLKKFTDALNDANECTK 68

Query: 165 IDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNAT-----EAMKRDYESAKKKV 219
           I+P++ +GY+R+G A Y  G  +EA ++YKK L+++  N       E +KR  E+ K + 
Sbjct: 69  INPTWSKGYNRVGAAHYGLGDLDEAEKSYKKALELDASNKVAQEGLEQVKRTQEARKAQP 128

Query: 220 EQSLNLEKAVPEQSRDADANASQXXXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSN 279
           +  L                                         N+P L+   +K+ SN
Sbjct: 129 DMGLT-------------------------------------SMFNDPNLI---EKLKSN 148

Query: 280 PGAMQNIQKMMQDPSIRQMAEGFTSGGGAPNLSDLMNNPALRNMAGNLFG---------G 330
           P   +    MM DP +      + S   A + ++L ++P L  +   L G         G
Sbjct: 149 PKTAE----MMNDPQLVAKLLSYRSNSQALS-TELFSDPRLMTIMATLLGVDLNMGDLNG 203

Query: 331 ADA--PSSEGTPDS 342
           +++  P++E TP++
Sbjct: 204 SNSMPPTAEKTPEA 217

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 53/201 (26%), Positives = 85/201 (42%), Gaps = 17/201 (8%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISI 165
           ++QG        +  A+  YTE I   P +A  Y+NRAAA S L  + EA+ D E ++  
Sbjct: 396 RIQGKDFFNKGQWPDAVKAYTEMIARAPDDARAYSNRAAALSKLMSFPEAISDCEKALEK 455

Query: 166 DPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNL 225
           DP++ + Y R   A+ A  +   ALE     LDI       A  +D E       + +N 
Sbjct: 456 DPNFVKAYIRKATAQIAIKEYSSALE----TLDI-------ARSKDTELNNGSNIREINQ 504

Query: 226 EKAVPEQSRDADANASQXXXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQN 285
             A   Q R   A++++                     M +P +    Q+  +NP A+  
Sbjct: 505 LYAKATQQRFEPASSNE---TPEQTYQRAMKDPEVAAIMQDPVMQSILQQAQTNPAAL-- 559

Query: 286 IQKMMQDPSIRQMAEGFTSGG 306
            Q+ M++P I +  +   S G
Sbjct: 560 -QEHMKNPEIFKKIQTLISAG 579

>NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}
          Length = 583

 Score = 87.4 bits (215), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 69/99 (69%), Gaps = 1/99 (1%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIQVLPT-NAIYYANRAAAHSSLREYDEAVKDAESSIS 164
           K QGN A  +KD+  AI  +T+AI+V PT N + Y+NR+AA++S +++ EA+ DA   + 
Sbjct: 9   KQQGNAAFTSKDFNKAIELFTKAIEVSPTPNHVLYSNRSAAYTSAKQFQEALNDATECVK 68

Query: 165 IDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDN 203
           I+P++ +GY+RLG A++  G  EEA + YK+ L ++ +N
Sbjct: 69  INPTWSKGYNRLGAAEFGLGNLEEAEKNYKEALKLDNNN 107

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 48/206 (23%), Positives = 92/206 (44%), Gaps = 27/206 (13%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISI 165
           +++G +     D+  A+  Y+E I+  P +A  Y+NRAAA S L  + EA+KD +++I  
Sbjct: 393 RLEGKEYFTKGDWPNAVKAYSEMIKRAPEDARGYSNRAAALSKLMSFPEAIKDCDNAIKK 452

Query: 166 DPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIE-----GDNATEAMKRDYESAKKKVE 220
           DP++ R Y R   A+ A  +   AL+  ++    +     G N+ E M+   ++ +++ +
Sbjct: 453 DPNFVRAYIRKATAQIAIKEYANALDTLEEAKSKDSSVNNGANSNEIMRLQMKATQERFQ 512

Query: 221 QSLNLEKAVPEQSRDADANASQXXXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNP 280
                E   PE++                              M +P +    Q+  +NP
Sbjct: 513 APTGNE--TPEET-----------------YKRAMQDPEVAAIMQDPVMQSILQQAQTNP 553

Query: 281 GAMQNIQKMMQDPSIRQMAEGFTSGG 306
            A+   Q+ M++P I +  +   + G
Sbjct: 554 AAL---QEHMKNPEISKKIQILIAAG 576

 Score = 31.6 bits (70), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 32/132 (24%), Positives = 65/132 (49%), Gaps = 10/132 (7%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSI-- 163
           K++GNK      ++ AI +Y +A   L  +  Y  NR+AA     +++ A+     ++  
Sbjct: 259 KVEGNKLYKAHKFDEAIEQYNKAW-ALNKDITYLNNRSAAEFEKGDFETAIATLNEAVDQ 317

Query: 164 --SIDPSY---FRGYSRLGFAKYAQGKPEEALEAYKKVL--DIEGDNATEAMKRDYESAK 216
              +   Y    + ++R+G A + +G  +++++ Y+K L      D  T+    + E  K
Sbjct: 318 GRELRADYKIIAKSFARIGNAYHKKGDLKKSIDYYQKSLTEHRTADILTKLRNCEKELKK 377

Query: 217 KKVEQSLNLEKA 228
           ++ EQ ++ EKA
Sbjct: 378 QEAEQYIDPEKA 389

>KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {ON}
           Anc_5.617 YOR027W
          Length = 579

 Score = 84.7 bits (208), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 65/227 (28%), Positives = 114/227 (50%), Gaps = 45/227 (19%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIQVLPT-NAIYYANRAAAHSSLREYDEAVKDAESSIS 164
           K QGN A A K Y+ A++ +T+AI+V  T N + Y+NR+A+++S ++++EA+KDA     
Sbjct: 9   KQQGNSAFAAKKYDEAVDLFTKAIEVSETPNHVLYSNRSASYASEQKFNEALKDALECTK 68

Query: 165 IDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLN 224
           I+PS+ +GY+R G A +  G  ++A  +YKK L+++ +N           AK+ +EQ   
Sbjct: 69  INPSWAKGYTREGAAHFGMGNLDDAEASYKKALELDANNKI---------AKEGIEQ--- 116

Query: 225 LEKAVPEQSRDADANASQXXXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQ 284
           +++   ++    D   ++                      N+P L+   +K+ +NP   +
Sbjct: 117 IQRVQSQRQAQPDLGLTE--------------------MFNDPNLI---EKLKNNPKTAE 153

Query: 285 NIQKMMQDPSIRQMAEGFTSGGGAPN--LSDLMNNPALRNMAGNLFG 329
               +M DP   Q+     S    PN    DL ++P L  + G L G
Sbjct: 154 ----LMNDP---QLVAKLLSFRSNPNGLAQDLFSDPRLMTIMGTLMG 193

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 53/211 (25%), Positives = 92/211 (43%), Gaps = 37/211 (17%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISI 165
           +++G +     D+  A+  YTE I+  P +A  Y+NRAAA S L  + +A+ D   +I  
Sbjct: 389 RLEGKEYFTKGDWPSAVKAYTEMIKRAPEDARGYSNRAAALSKLMSFPDAISDCNKAIEK 448

Query: 166 DPSYFRGYSRLGFAKYAQGKPEEALEAYK--KVLDIE---GDNATEAMKRDYESAKKKVE 220
           DP++ R Y R   A+ A      A+E     +  D E   G NA E  +   ++A+++ +
Sbjct: 449 DPNFVRAYIRKATAQIAVKDFSYAIETLDAARTKDAEVNGGANAREIDQLYMKAAQQRFQ 508

Query: 221 QSLNLEKAVPEQS-----RDADANASQXXXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQK 275
            +   E   PEQ+     RD +                          M +P L    Q+
Sbjct: 509 PATGDE--TPEQTYERAMRDPEV----------------------AKIMQDPVLQSILQQ 544

Query: 276 MMSNPGAMQNIQKMMQDPSIRQMAEGFTSGG 306
             ++P A+   Q+ M++P I +  +   + G
Sbjct: 545 AQNDPAAL---QEHMKNPEIFKKIQTLIAAG 572

 Score = 38.5 bits (88), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 50/99 (50%), Gaps = 8/99 (8%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSI-- 163
           K++GNKA   ++++ AI  Y +A + L  N  Y  NR+AA     EYD A+     +I  
Sbjct: 255 KVEGNKAYKARNFDEAIACYNKAWE-LDNNITYLNNRSAAEFEKGEYDTAINTLNEAIEK 313

Query: 164 --SIDPSY---FRGYSRLGFAKYAQGKPEEALEAYKKVL 197
              +   Y    + ++R+G A    G  +EA+  Y+K L
Sbjct: 314 GREMRADYKIIAKSFARIGNAYVKMGNLKEAINHYQKSL 352

>ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 572

 Score = 84.7 bits (208), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 70/100 (70%), Gaps = 1/100 (1%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIQVLPT-NAIYYANRAAAHSSLREYDEAVKDAESSI 163
            K QGN A   KDY  AI+ +T+AI+V  T N + Y+NR+A ++S ++++EA+KDAE  +
Sbjct: 6   FKQQGNAAFLAKDYVKAIDLFTKAIEVSETPNHVLYSNRSACYASNKKFEEALKDAEECV 65

Query: 164 SIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDN 203
            I PS+ +GY+R+G A++   + +EA ++YK+ L+++  N
Sbjct: 66  KISPSWSKGYNRVGAAQFGLSQLDEAEKSYKRALELDSSN 105

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 46/77 (59%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISI 165
           ++QG +     D+  A+  YTE ++  P +A  ++NRAAA + L  + EA++D   ++SI
Sbjct: 384 RLQGKEFFTKGDWPNAVKAYTEMVKRAPQDARGFSNRAAALAKLMSFPEAIEDCNKAVSI 443

Query: 166 DPSYFRGYSRLGFAKYA 182
           DP++ R Y R   A+ A
Sbjct: 444 DPNFVRAYIRKATAQIA 460

 Score = 35.0 bits (79), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 46/99 (46%), Gaps = 8/99 (8%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKD----AES 161
           K +GNK    + +E AI  Y +A + L  +  Y  NR+AA     +YD A+K      E 
Sbjct: 250 KAEGNKLYKARQFEEAIEHYNKAWE-LHKDITYLNNRSAAEFEKGDYDTAIKTLNDAVEQ 308

Query: 162 SISIDPSY---FRGYSRLGFAKYAQGKPEEALEAYKKVL 197
              +   Y    + ++R+G A Y      +A+E Y + L
Sbjct: 309 GRELRADYKTIAKSFARIGNAYYKLKDLRKAIEHYNRSL 347

>NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {ON}
           Anc_5.617
          Length = 584

 Score = 84.3 bits (207), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 65/228 (28%), Positives = 113/228 (49%), Gaps = 45/228 (19%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIQVLPT-NAIYYANRAAAHSSLREYDEAVKDAESSI 163
           LK +GN A A+KD+  AI  +TEAI    T N + Y+NR+A ++SL+++ EA+ DA+  +
Sbjct: 7   LKQKGNAAFASKDFTGAIEYFTEAIAASTTPNHVLYSNRSACYTSLKQFQEALNDAQQCV 66

Query: 164 SIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDN--ATEAMKRDYESAKKKVEQ 221
            I+P + +GY+R+G A    G  ++A   YKK L+++ +N  A+E +++ +     +V++
Sbjct: 67  KINPDWSKGYNRMGAAHLGLGDLDDAESNYKKALELDSNNKAASEGLEQVH-----RVQE 121

Query: 222 SLNLEKAVPEQSRDADANASQXXXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPG 281
           S    K+ P+                                 ++P L+   +K+  NP 
Sbjct: 122 S---RKSRPD--------------------------FGMTEMFSDPNLI---EKLRQNP- 148

Query: 282 AMQNIQKMMQDPSIRQMAEGFTSGGGAPNLSDLMNNPALRNMAGNLFG 329
                + MM DPS+    + + S     + SDLM +P L  +   L G
Sbjct: 149 ---KTKDMMNDPSLVAKLQSYKSNPQGLS-SDLMGDPRLMTIMATLLG 192

 Score = 59.3 bits (142), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 29/77 (37%), Positives = 45/77 (58%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISI 165
           +++G +     D+  A+  YTE I+  P +A  Y+NRAAA + L  + EA+KD E +I  
Sbjct: 394 RLEGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIKDCEKAIEK 453

Query: 166 DPSYFRGYSRLGFAKYA 182
           DP++ R Y R   A+ A
Sbjct: 454 DPNFVRAYLRKATAQIA 470

>Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 84.3 bits (207), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 67/99 (67%), Gaps = 1/99 (1%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIQVLPT-NAIYYANRAAAHSSLREYDEAVKDAESSIS 164
           K QGN A   KDY+ AI  +T+AI+V  T N + Y+NR+A ++SL+++ +A+ DA+  I+
Sbjct: 9   KQQGNSAFTAKDYDKAIELFTKAIEVSKTPNHVLYSNRSACYASLKKFSDALNDAKECIN 68

Query: 165 IDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDN 203
           I+PS+ +GY+RLG A    G  +EA   YKK L+++  N
Sbjct: 69  INPSWSKGYNRLGAAHLGLGDLDEAENNYKKALELDASN 107

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 46/86 (53%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISI 165
           +++G       D+  A+  YTE I+  P +A  Y+NRAAA + L  + EA+ D   +I  
Sbjct: 400 RLEGKDYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEK 459

Query: 166 DPSYFRGYSRLGFAKYAQGKPEEALE 191
           DP++ R Y R   A+ A  +   ALE
Sbjct: 460 DPNFVRAYIRKATAQIAVQEYAAALE 485

 Score = 34.3 bits (77), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 61/132 (46%), Gaps = 10/132 (7%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAV---KDA-ES 161
           K +GNK    + ++ AI  Y +A + L  +  Y  NRAAA     EY  A+    DA E 
Sbjct: 266 KAEGNKFYKARQFDEAIEHYNKAWE-LHRDITYLNNRAAAEYEKGEYKTAIATLNDAVEQ 324

Query: 162 SISIDPSY---FRGYSRLGFAKYAQGKPEEALEAYKKVL--DIEGDNATEAMKRDYESAK 216
              +   Y    R ++R+G A +  G  ++ +E Y+K L      D  T+    + E  K
Sbjct: 325 GREMRADYKVISRSFARIGNAYHKLGDLKKTIEYYQKSLTEHRTADILTKLRNAEKELKK 384

Query: 217 KKVEQSLNLEKA 228
            + E  +N EKA
Sbjct: 385 AEAEAYINPEKA 396

>Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027W
           (STI1) - Heat shock protein also induced by canavanine
           and entry into stationary phase [contig 159] FULL
          Length = 593

 Score = 83.2 bits (204), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 59/192 (30%), Positives = 101/192 (52%), Gaps = 16/192 (8%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIQVLPT-NAIYYANRAAAHSSLREYDEAVKDAESSI 163
            K QGN A   KD+E A   +++AI+   T N + Y+NR+A ++SL+++ EA++DAE  +
Sbjct: 6   FKKQGNAAFVAKDFEKAAELFSKAIESSETPNHVLYSNRSACYTSLKKFKEALEDAEECV 65

Query: 164 SIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSL 223
            I+P++ +GY+R+G A+Y  G  ++A + YKK L+I+  N         ++A++ +EQ  
Sbjct: 66  KINPTWSKGYNRVGAAQYGLGNLDDAEKEYKKALEIDSSN---------KAAQEGLEQVQ 116

Query: 224 NLEKAVPEQSRDADANASQXXXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAM 283
             + A  +Q    D    Q                     M +PQL+    +  SNP  M
Sbjct: 117 KTQNARQQQP---DLGFGQ-LFNDPNMIEKLKSNPKTAELMKDPQLVSKVLQFQSNPQMM 172

Query: 284 QNIQKMMQDPSI 295
              Q++M+DP +
Sbjct: 173 G--QEVMKDPRM 182

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 46/77 (59%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISI 165
           ++QG +     D+  A++ YTE I+  P +A  Y+NRAA  + L  + +A+KD + +IS 
Sbjct: 405 RLQGKEFFTKGDWPSAVSAYTEMIKRAPEDARGYSNRAAVLAKLMSFPDAIKDCDVAISK 464

Query: 166 DPSYFRGYSRLGFAKYA 182
           DP++ R Y R   A+ A
Sbjct: 465 DPNFVRAYIRKASAQIA 481

>YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90
           cochaperone, interacts with the Ssa group of the
           cytosolic Hsp70 chaperones and activates Ssa1p ATPase
           activity; interacts with Hsp90 chaperones and inhibits
           their ATPase activity; homolog of mammalian Hop
          Length = 589

 Score = 83.2 bits (204), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 65/231 (28%), Positives = 108/231 (46%), Gaps = 53/231 (22%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIQVLPT-NAIYYANRAAAHSSLREYDEAVKDAESSIS 164
           K QGN A   KDY+ AI  +T+AI+V  T N + Y+NR+A ++SL+++ +A+ DA   + 
Sbjct: 9   KQQGNAAFTAKDYDKAIELFTKAIEVSETPNHVLYSNRSACYTSLKKFSDALNDANECVK 68

Query: 165 IDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLN 224
           I+PS+ +GY+RLG A    G  +EA   YKK L+++  N         ++AK+ ++Q   
Sbjct: 69  INPSWSKGYNRLGAAHLGLGDLDEAESNYKKALELDASN---------KAAKEGLDQVHR 119

Query: 225 LEKAVPEQSRDADANASQXXXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQ 284
                 +Q+R A                              P L     ++ ++P  ++
Sbjct: 120 T-----QQARQA-----------------------------QPDL--GLTQLFADPNLIE 143

Query: 285 NIQK------MMQDPSIRQMAEGFTSGGGAPNLSDLMNNPALRNMAGNLFG 329
           N++K      MM+DP +     G+     A    DL  +P L  +   L G
Sbjct: 144 NLKKNPKTSEMMKDPQLVAKLIGYKQNPQAIG-QDLFTDPRLMTIMATLMG 193

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 51/211 (24%), Positives = 95/211 (45%), Gaps = 37/211 (17%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISI 165
           +++G +     D+  A+  YTE I+  P +A  Y+NRAAA + L  + EA+ D   +I  
Sbjct: 400 RLEGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEK 459

Query: 166 DPSYFRGYSRLGFAKYAQGKPEEALEAYK--KVLDIEGDNATEAMKRD---YESAKKKVE 220
           DP++ R Y R   A+ A  +   ALE     +  D E +N + A + D   Y++++++ +
Sbjct: 460 DPNFVRAYIRKATAQIAVKEYASALETLDAARTKDAEVNNGSSAREIDQLYYKASQQRFQ 519

Query: 221 QSLNLEKAVPEQS-----RDADANASQXXXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQK 275
              + E   PE++     +D +  A                       M +P +    Q+
Sbjct: 520 PGTSNE--TPEETYQRAMKDPEVAA----------------------IMQDPVMQSILQQ 555

Query: 276 MMSNPGAMQNIQKMMQDPSIRQMAEGFTSGG 306
              NP A+   Q+ M++P + +  +   + G
Sbjct: 556 AQQNPAAL---QEHMKNPEVFKKIQTLIAAG 583

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 60/132 (45%), Gaps = 10/132 (7%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKD----AES 161
           K +GNK    + ++ AI  Y +A + L  +  Y  NRAAA     EY+ A+       E 
Sbjct: 266 KAEGNKFYKARQFDEAIEHYNKAWE-LHKDITYLNNRAAAEYEKGEYETAISTLNDAVEQ 324

Query: 162 SISIDPSY---FRGYSRLGFAKYAQGKPEEALEAYKKVLDIE--GDNATEAMKRDYESAK 216
              +   Y    + ++R+G A +  G  ++ +E Y+K L      D  T+    + E  K
Sbjct: 325 GREMRADYKVISKSFARIGNAYHKLGDLKKTIEYYQKSLTEHRTADILTKLRNAEKELKK 384

Query: 217 KKVEQSLNLEKA 228
            + E  +N EKA
Sbjct: 385 AEAEAYVNPEKA 396

>Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON}
           (197149..198921) [1773 nt, 591 aa]
          Length = 590

 Score = 83.2 bits (204), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 66/99 (66%), Gaps = 1/99 (1%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIQVLPT-NAIYYANRAAAHSSLREYDEAVKDAESSIS 164
           K QGN A   KDY+ AI+ +++AI V    N + Y+NR+A ++SL+++  A+KDAE  + 
Sbjct: 9   KQQGNAAFVAKDYDKAIDLFSKAIDVSEQPNHVLYSNRSACYTSLKKFVNALKDAEECVK 68

Query: 165 IDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDN 203
           I+PS+ +GY+R+G A +  G  +EA   YKK L+++  N
Sbjct: 69  INPSWSKGYNRVGAAHFGMGDLDEAEAGYKKALELDASN 107

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 45/87 (51%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISI 165
           +++G       D+  A+  YTE I+  P +A  Y+NRAA  S L  + EA+ D   +I  
Sbjct: 401 RLEGKDYFTKGDWPNAVKAYTEMIKRAPEDARGYSNRAAVLSKLMSFPEAIDDCNKAIEK 460

Query: 166 DPSYFRGYSRLGFAKYAQGKPEEALEA 192
           DP++ R Y R   A+ A  +   ALE 
Sbjct: 461 DPNFVRAYIRKATAQIAVREFSSALET 487

>KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON}
           Anc_5.617 YOR027W
          Length = 575

 Score = 82.8 bits (203), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 68/100 (68%), Gaps = 1/100 (1%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIQVLPT-NAIYYANRAAAHSSLREYDEAVKDAESSIS 164
           K +GN A   KDY+ AI+ +T+AI+V  T N + Y+NR+AA++S ++Y++A+ DA+  I 
Sbjct: 9   KQEGNTAFVAKDYQKAIDAFTKAIEVSETPNHVLYSNRSAAYTSSKQYEQALSDADECIK 68

Query: 165 IDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNA 204
           I+PS+ +GY+R G A     K EEA + Y + L I+ +NA
Sbjct: 69  INPSWAKGYTRKGAALQGLHKYEEAEQCYNETLKIDPNNA 108

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 40/70 (57%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISI 165
           +++G +     D+  A+  YTE I+  P +A  Y+NRAAA + L  + +A+ D   +I  
Sbjct: 389 RLEGKEYFTKADWPNAVKSYTEMIKRAPDDARGYSNRAAALAKLMSFPDAISDCNKAIEK 448

Query: 166 DPSYFRGYSR 175
           DPS+ R Y R
Sbjct: 449 DPSFIRAYLR 458

>SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 585

 Score = 82.4 bits (202), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 70/99 (70%), Gaps = 1/99 (1%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIQVL-PTNAIYYANRAAAHSSLREYDEAVKDAESSIS 164
           K QGN A A KD+E AI  +T+AI+V    N + Y+NR+A ++S +++++A++DA+  ++
Sbjct: 7   KQQGNAAFAAKDFEKAIELFTKAIEVSEKPNHVLYSNRSACYTSTKQFNKALEDAKQCVN 66

Query: 165 IDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDN 203
           I+P++ +GY+R+G A +  G  +EA + YKK L+++  N
Sbjct: 67  INPAWSKGYNRVGAAHFGLGDLDEAEQGYKKALELDSAN 105

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 45/77 (58%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISI 165
           ++QG +     D+  A+  YTE I+  P +A  Y+NRAAA S L  + EA+KD   +IS 
Sbjct: 397 RLQGKEYFTKGDWPNAVKSYTEMIKRAPEDARGYSNRAAALSKLMSFPEAIKDCNVAISK 456

Query: 166 DPSYFRGYSRLGFAKYA 182
           DP++ R Y R   A+ A
Sbjct: 457 DPNFIRAYIRKATAQIA 473

 Score = 33.9 bits (76), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 51/99 (51%), Gaps = 8/99 (8%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSI-- 163
           K +GNK    + ++ AI  Y++A + L  +  Y  NRAAA     EY+ A+K    ++  
Sbjct: 263 KAEGNKFYKARKFDEAIEHYSKAWE-LHKDITYLNNRAAAEYEKGEYETAIKTLTEAVEQ 321

Query: 164 --SIDPSY---FRGYSRLGFAKYAQGKPEEALEAYKKVL 197
              +   Y    + ++R+G + +   + ++A+E Y+K L
Sbjct: 322 GRELRADYKVISKSFARIGNSYHKLNELKKAIEFYQKSL 360

>KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 593

 Score = 81.6 bits (200), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 65/100 (65%), Gaps = 1/100 (1%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIQVLPT-NAIYYANRAAAHSSLREYDEAVKDAESSI 163
            K QGN A   KDYE A   +T+AI+     N + Y+NR+A  +SL++++EA+ DA   +
Sbjct: 6   FKKQGNAAFVAKDYEKASELFTKAIEASEAPNHVLYSNRSACFTSLKKFNEALNDANECV 65

Query: 164 SIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDN 203
            I+P++ +GY+R+G A +  GK +EA + YKK L+I+  N
Sbjct: 66  KINPAWSKGYNRVGAAYFGLGKLDEAEQGYKKALEIDTSN 105

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 29/77 (37%), Positives = 45/77 (58%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISI 165
           ++QG +     D+  A+  YTE  +  P +A  Y+NRAAA + L  + EA+KD + +IS 
Sbjct: 405 RLQGKEYFTKGDWPNAVKAYTEMTKRAPEDARGYSNRAAALAKLMSFPEAIKDCDMAISK 464

Query: 166 DPSYFRGYSRLGFAKYA 182
           DP++ R Y R   A+ A
Sbjct: 465 DPNFIRAYIRKATAQIA 481

>AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR027W (STI1)
          Length = 580

 Score = 81.3 bits (199), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 64/227 (28%), Positives = 110/227 (48%), Gaps = 45/227 (19%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIQVLPT-NAIYYANRAAAHSSLREYDEAVKDAESSIS 164
           K +GN A A KD+E AI  + +AI+V    N + Y+NR+A ++S+R++ EA+ DA+  + 
Sbjct: 8   KKEGNSAFAAKDFEKAIELFGKAIEVSEQPNHVLYSNRSACYASMRKFREALADAQECVR 67

Query: 165 IDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDN--ATEAMKRDYESAKKKVEQS 222
           I P + +G++RLG A Y  G  +EA E+YKK L+++  N  A + + +   + ++++EQ 
Sbjct: 68  IKPDWSKGHNRLGAAHYGLGDLDEAEESYKKALELDSSNKAAQDGLAQVQATQQQRMEQP 127

Query: 223 LNLEKAVPEQSRDADANASQXXXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGA 282
                         D    Q                       +P L+   QK+ +NP  
Sbjct: 128 --------------DLGFGQ--------------------MFQDPNLI---QKLKNNPKT 150

Query: 283 MQNIQKMMQDPSIRQMAEGFTSGGGAPNLSDLMNNPALRNMAGNLFG 329
            +    MM+DP +      F S   A + ++LM +P L  +   + G
Sbjct: 151 AE----MMKDPQLVAKVLQFQSNPQAIS-TELMRDPRLMTVMAAILG 192

 Score = 58.5 bits (140), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 29/77 (37%), Positives = 46/77 (59%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISI 165
           ++QG +   N D+  A+  YTE I+  P +A  Y+NRAAA + L  + +A+KD + +I  
Sbjct: 392 RLQGKEYFTNADWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPDAIKDCDMAIQK 451

Query: 166 DPSYFRGYSRLGFAKYA 182
           DP++ R Y R   A+ A
Sbjct: 452 DPNFVRAYIRKATAQIA 468

 Score = 35.0 bits (79), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 49/99 (49%), Gaps = 8/99 (8%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSI-- 163
           K +GN+    + ++ AI  Y +A   L  +  Y  NRAAA     +Y+ A+K  E ++  
Sbjct: 258 KAKGNELYKKRQFDEAIANYEKAWD-LHKDITYLNNRAAAEYEKGDYESAIKTLEKAVEE 316

Query: 164 --SIDPSY---FRGYSRLGFAKYAQGKPEEALEAYKKVL 197
              +   Y    + ++RLG A Y     ++A+E Y+K L
Sbjct: 317 GRELRADYKVIAKSFARLGNAHYKLADLKKAIEYYEKSL 355

>TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {ON}
           Anc_5.617 YOR027W
          Length = 582

 Score = 80.5 bits (197), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 68/99 (68%), Gaps = 1/99 (1%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIQVLPT-NAIYYANRAAAHSSLREYDEAVKDAESSIS 164
           K QGN A   K+Y+ AI K+T+AI+V  T N + Y+NR+A ++S +++ + ++DA   + 
Sbjct: 9   KDQGNAAFVAKNYDEAIEKFTKAIEVSETPNHVLYSNRSACYTSKKQFVKGLEDANECVK 68

Query: 165 IDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDN 203
           I+P++ +GY+R+G A +  G  +EA +AYKK L+++  N
Sbjct: 69  INPTWSKGYNRVGAAHFGMGDLDEAEKAYKKALELDSSN 107

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 52/205 (25%), Positives = 89/205 (43%), Gaps = 25/205 (12%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISI 165
           +++G +     D+  A+  YTE I   P++A  Y+NRAAA S L  + EA+ D  ++I  
Sbjct: 393 RLEGKEYFTKGDWPNAVKAYTEMIARDPSDARGYSNRAAALSKLMSFPEAITDCNTAIEK 452

Query: 166 DPSYFRGYSRLGFAKYAQGKPEEALEAYK--KVLDIEGDNATEAMKRD--YESAKKKVEQ 221
           DP++ R Y R   A+ A      A+E     +  D E +N   + + D  Y  A ++  Q
Sbjct: 453 DPNFIRAYIRKATAQIAIKDFVPAIETLDAARTKDAELNNGANSREIDQLYLKANQQRFQ 512

Query: 222 SLNLEKAVPEQSRDADANASQXXXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPG 281
             N  +  PEQ+ +                            M +P +    Q+  +NP 
Sbjct: 513 PSNANE-TPEQTYE-----------------RAMKDPEVAAIMQDPVMQSILQQAQTNPA 554

Query: 282 AMQNIQKMMQDPSIRQMAEGFTSGG 306
           A+   Q+ M++P I +  +   + G
Sbjct: 555 AL---QEHMKNPEIFKKIQTLIAAG 576

>KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027W STI1 Heat shock protein also induced
           by canavanine and entry into stationary phase
          Length = 581

 Score = 79.7 bits (195), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 68/100 (68%), Gaps = 1/100 (1%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIQVLPT-NAIYYANRAAAHSSLREYDEAVKDAESSI 163
            K +GN+A A+KDY  AI  +T+AI+V    N + ++NR+A ++S +++ +A+ DA   +
Sbjct: 6   FKQEGNQAFASKDYAKAIELFTKAIEVSEQPNHVLFSNRSACYASNKDFVKALDDANECV 65

Query: 164 SIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDN 203
            I+PS+ +GY+RLG A Y  G  +EA ++YKK L+++  N
Sbjct: 66  KINPSWAKGYNRLGAAHYGLGDLDEAEQSYKKALELDSAN 105

 Score = 55.8 bits (133), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 42/70 (60%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISI 165
           ++QG +     D+  A+  YTE I+  P +A  Y+NRAAA S L  + +A++D + +I  
Sbjct: 393 RLQGKEYFTKADWPKAVEAYTEMIKRNPNDARGYSNRAAALSKLMSFADAIRDCDKAIEK 452

Query: 166 DPSYFRGYSR 175
           DP++ R Y R
Sbjct: 453 DPNFVRAYIR 462

 Score = 34.3 bits (77), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 63/132 (47%), Gaps = 10/132 (7%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAV----KDAES 161
           K +GNK    + ++ AI KY EA +    +  Y  NRAAA     +Y+ A+    K  E 
Sbjct: 259 KAEGNKLYKQRKFDEAIEKYNEAWETH-NDITYLNNRAAAEYEKGDYEAAIETLTKAVEQ 317

Query: 162 SISIDPSY---FRGYSRLGFAKYAQGKPEEALEAYKKVL--DIEGDNATEAMKRDYESAK 216
              +   Y    + ++R+G + +  G  ++A++ Y+K L      D  T+    + E  +
Sbjct: 318 GRELRADYKVISKSFARMGNSYHKLGDLKKAIDYYEKSLTEHRTPDILTKLRNTEKELKQ 377

Query: 217 KKVEQSLNLEKA 228
           K+ E  ++ EKA
Sbjct: 378 KEAESYMDPEKA 389

>Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W
           (REAL)
          Length = 586

 Score = 77.8 bits (190), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 64/99 (64%), Gaps = 1/99 (1%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIQVLPT-NAIYYANRAAAHSSLREYDEAVKDAESSIS 164
           K QGN A   KDY  AI+ +T+AI+V    N + Y+NR+A ++SL+++ +A+ DA   + 
Sbjct: 9   KQQGNAAFTAKDYGKAIDLFTKAIEVSEAPNHVLYSNRSACYTSLKKFTDALNDATECVK 68

Query: 165 IDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDN 203
           I+PS+ +GY+RLG A    G  ++A   YKK L+++  N
Sbjct: 69  INPSWSKGYNRLGAAHLGLGDLDDAESNYKKALELDAAN 107

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 43/77 (55%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISI 165
           +++G +     D+  A+  YTE I+  P +A  Y+NRAAA + L  + EA+ D   +I  
Sbjct: 397 RLEGKEYFTKSDWPNAVKAYTEMIKRSPEDARGYSNRAAALAKLMSFPEAIADCNKAIEK 456

Query: 166 DPSYFRGYSRLGFAKYA 182
           DP++ R Y R   A+ A
Sbjct: 457 DPNFVRAYIRKATAQIA 473

>Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 77.4 bits (189), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 66/99 (66%), Gaps = 1/99 (1%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIQVLPT-NAIYYANRAAAHSSLREYDEAVKDAESSIS 164
           K QGN A   K+Y+ AI  +T+AI+V  T + + ++NR+A ++SL+++ +A+ DA   + 
Sbjct: 9   KQQGNAAFTAKNYDGAIELFTKAIEVSETPSHVLFSNRSACYTSLKKFSDALNDANECVK 68

Query: 165 IDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDN 203
           I+PS+ +GY+RLG A    G  +EA   YKK L+++ +N
Sbjct: 69  INPSWSKGYNRLGAAHLGLGDLDEAESDYKKALELDANN 107

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 49/210 (23%), Positives = 92/210 (43%), Gaps = 35/210 (16%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISI 165
           +++G +     D+  A+  YTE I+  P +A  Y+NRAAA + L  + EA+ D   +I  
Sbjct: 400 RLEGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEK 459

Query: 166 DPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDI---------EGDNATEAMKRDYESAK 216
           DP++ R Y R+  A+ A  +   ALE     LD+         +G +A E  +  Y++++
Sbjct: 460 DPNFVRAYIRMAAAQIAVKEFAAALE----TLDVARTKDAEVNKGASAKEIDQLYYKASQ 515

Query: 217 KKVEQSLNLEKAVPEQSRDADANASQXXXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKM 276
           ++ +     E   PE++                              M +P +    Q+ 
Sbjct: 516 QRFQPDTGSE--TPEET-----------------YQRAMKDPEVAAIMQDPVMQSILQQA 556

Query: 277 MSNPGAMQNIQKMMQDPSIRQMAEGFTSGG 306
             NP A+   Q+ M++P++ +  +   + G
Sbjct: 557 QQNPAAL---QEHMKNPAVFKKIQTLIAAG 583

 Score = 30.0 bits (66), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 54/122 (44%), Gaps = 8/122 (6%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAV---KDA-ES 161
           K +GNK      ++ AI  Y  A + L  +  Y  NRAAA     +Y+  +    DA E 
Sbjct: 266 KAEGNKFYKAHQFDEAIEHYNRAWE-LHKDITYLNNRAAAEYEKGDYETVIATLNDAVEK 324

Query: 162 SISIDPSY---FRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKK 218
              +   Y    + ++R+G A +  G  ++ +E Y+K L         A  R+ E  +KK
Sbjct: 325 GRDMRADYKVISKSFARIGNAYHKLGDLKKTIEYYQKSLTEHRTADILAKLRNVEKEQKK 384

Query: 219 VE 220
            E
Sbjct: 385 AE 386

>TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.617
           YOR027W
          Length = 576

 Score = 75.1 bits (183), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 64/99 (64%), Gaps = 1/99 (1%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIQVLPT-NAIYYANRAAAHSSLREYDEAVKDAESSIS 164
           K QGN A   KDYE A   + +AI V    N + Y+NR+A ++SL+++ E +KDAE  + 
Sbjct: 8   KQQGNAAFVAKDYEKAAELFGKAIDVSEQPNHVLYSNRSACYTSLKKFAEGLKDAEECVK 67

Query: 165 IDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDN 203
           I+P + +GY+R+G A++     E+A ++Y+K L+++  N
Sbjct: 68  INPGWSKGYNRVGAAQFGLNNLEDAEKSYQKALELDSAN 106

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 70/262 (26%), Positives = 111/262 (42%), Gaps = 36/262 (13%)

Query: 53  GILGKS-EFKGKSL-----ADVLNSASKASESNEKDDAQNVEVNIPXXXXXXXXXXXXLK 106
           G L KS  F  KSL     ADVLN    A +  +K +A+  E   P             +
Sbjct: 336 GDLKKSINFYQKSLTEHRSADVLNKLRNAEKELKKQEAE--EYVDPEKAEEA-------R 386

Query: 107 MQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISID 166
           ++G +  +  D+  A+  YTE I+  P +A  Y+NRAAA + L  + EA+ D + +I  D
Sbjct: 387 LEGKEYFSKADWPNAVKAYTEMIKRSPQDARGYSNRAAALAKLMSFPEAIADCDRAIEKD 446

Query: 167 PSYFRGYSRLGFAKYAQGKPEEALEAYKKVL--DIEGDNATEAMKRDYESAKKKVEQSLN 224
           P++ R Y R   A+ A  +   A+E    V   D E +N   A + D      ++    N
Sbjct: 447 PNFIRAYIRKASAQIAVKEFAAAVETLDTVRTKDSELNNGANAREID------QLYIKAN 500

Query: 225 LEKAVPEQSRDADANASQXXXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQ 284
            ++  PE   D + N  Q                     M +P +    Q+   NP A+ 
Sbjct: 501 NQRFQPE---DVNENPEQ-------TYQRAMKDPEVAAIMQDPVMQSILQQAQQNPAAL- 549

Query: 285 NIQKMMQDPSIRQMAEGFTSGG 306
             Q+ MQ+P + +  +   + G
Sbjct: 550 --QEHMQNPDVFRKIQTLIAAG 569

>Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {ON}
           similar to Ashbya gossypii AEL224W
          Length = 584

 Score = 75.1 bits (183), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 63/99 (63%), Gaps = 1/99 (1%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIQ-VLPTNAIYYANRAAAHSSLREYDEAVKDAESSIS 164
           K +GN A   KD++ A+  +T AIQ     N + Y+NR+ A++SL+++DEA+ DA   + 
Sbjct: 8   KKEGNAAFVAKDFKRAVELFTNAIQESEEPNHVLYSNRSGAYASLKKFDEALSDATECVK 67

Query: 165 IDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDN 203
           I   + +G++RLG A +  G  +EA E+YKK L+++  N
Sbjct: 68  IKADWSKGHNRLGAAHFGLGNLDEAEESYKKALELDATN 106

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 29/77 (37%), Positives = 44/77 (57%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISI 165
           ++ G +     D+  A+  Y+E I   P +A  Y+NRAAA S L  + +A+KD + +I I
Sbjct: 396 RLDGKEYFTKGDWPSAVKAYSEMIMRAPHDARGYSNRAAALSKLMSFPDAIKDCDKAIEI 455

Query: 166 DPSYFRGYSRLGFAKYA 182
           DPS+ R Y R   A+ A
Sbjct: 456 DPSFVRAYIRKATAQIA 472

 Score = 36.6 bits (83), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 49/99 (49%), Gaps = 8/99 (8%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKD----AES 161
           K +GN+    + ++ AI KY EA   L  +  Y  NRAAA     +Y+ A+K      E 
Sbjct: 262 KAEGNQLYKQRKFDEAIAKYEEAWN-LQKDITYLNNRAAAEYEKGDYNSAIKTLNEAVEQ 320

Query: 162 SISIDPSY---FRGYSRLGFAKYAQGKPEEALEAYKKVL 197
              +   Y    + ++RLG A Y   + ++A+E Y+K L
Sbjct: 321 GRELRADYKVIAKSFARLGNAYYKLDEVKKAVEYYEKSL 359

>NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON} 
          Length = 620

 Score = 73.6 bits (179), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 41/101 (40%), Positives = 60/101 (59%), Gaps = 1/101 (0%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIQVLPTN-AIYYANRAAAHSSLREYDEAVKDAESSI 163
           LK  GNK    K YE A++ +T A+    TN  I Y+NRAAAH  L+ Y EA++D ++ +
Sbjct: 11  LKELGNKTYKEKGYEQAVHYFTSALSQPSTNKHILYSNRAAAHIGLKHYAEALEDGKNCV 70

Query: 164 SIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNA 204
            + P++ +GYSR+G A     K +EA E +KK L +   N 
Sbjct: 71  ELAPNWDKGYSRVGVAYLGLQKLDEAEENFKKALQLNEQNV 111

 Score = 69.3 bits (168), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 52/88 (59%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISI 165
           +++G +   N++Y  A+  YTE I+  PT+ + + NRAA    L    + + D + +IS+
Sbjct: 433 RIEGKQHFLNREYFKAMKCYTEMIKTNPTSPVGWCNRAAVFEKLLTCPQVIDDCDKAISV 492

Query: 166 DPSYFRGYSRLGFAKYAQGKPEEALEAY 193
           DPSY + Y R GFA+  +   +EALE +
Sbjct: 493 DPSYIKAYVRKGFAQITERDLDEALETW 520

>Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}
           similar to Ashbya gossypii AAR083C
          Length = 510

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 31/74 (41%), Positives = 48/74 (64%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISI 165
           K QGNK +A+KDY  AI  YT+AI++    +I+++NRA A+  L  +  A++D+  +I +
Sbjct: 13  KDQGNKFVASKDYGQAIEAYTKAIELDGCQSIFFSNRALANLKLDRFQSALEDSSKAIEL 72

Query: 166 DPSYFRGYSRLGFA 179
           D S  +GY R G A
Sbjct: 73  DSSNVKGYHRRGMA 86

>TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 60.1 bits (144), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 74/148 (50%), Gaps = 11/148 (7%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSIS 164
            K +GN A+  +DY  AI  YTEAI++  T +IY++NRA  H  +  +   + D + ++ 
Sbjct: 15  FKNRGNDAIKTQDYPGAIELYTEAIKLDDTVSIYFSNRAMGHLKMDNFQSGINDCDKALE 74

Query: 165 IDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNATEAMKRDY-------ESAKK 217
           IDP   + Y R G +     + + A +  K VL  + ++AT     D        E  KK
Sbjct: 75  IDPKNIKAYHRRGMSYIGLLEFKNAQKDLKIVLASKPNDATAKRGLDVCEKFIREERFKK 134

Query: 218 KV----EQSLNLEKAVPEQSRDADANAS 241
            +    +Q +NL   +  ++ D++A+ +
Sbjct: 135 AIGGEEQQKVNLYLTLNLETFDSNADLT 162

>KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa]
           {ON} Anc_3.481 YGR123C
          Length = 512

 Score = 58.5 bits (140), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 46/75 (61%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSIS 164
            K +GN  + ++DY+ AI  YT+AI++  T++I+Y+NRA AH  L  +  A+ D   +I 
Sbjct: 15  FKDEGNVYIKSQDYQKAIELYTKAIELDSTSSIFYSNRALAHLKLDNFQSALHDCNDAIK 74

Query: 165 IDPSYFRGYSRLGFA 179
           +D +  + Y R G A
Sbjct: 75  LDNNNIKAYHRRGLA 89

>CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {ON}
           highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123c PPT1 protein ser/thr phosphatase
          Length = 510

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 44/74 (59%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISI 165
           K +GN  +  +DY  AI KY +AI++  T ++Y++NRA  H  L  +  A +D + ++++
Sbjct: 13  KNEGNACVKVQDYAKAIEKYDKAIELDDTQSVYFSNRALCHLKLDNFQCASQDCDKALAL 72

Query: 166 DPSYFRGYSRLGFA 179
           DP   + Y R G A
Sbjct: 73  DPKNVKAYHRRGLA 86

>Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 41/70 (58%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISI 165
           K +GN  +  K +  AI KYTEAI +  T +IY++NRA AH  +  +  A+ D + +I +
Sbjct: 16  KNEGNVFVKEKHFLKAIEKYTEAIDLDATQSIYFSNRAFAHFKVDNFQSALNDCDEAIKL 75

Query: 166 DPSYFRGYSR 175
           DP   + Y R
Sbjct: 76  DPKNIKAYHR 85

>YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}
           PPT1Protein serine/threonine phosphatase, regulates
           Hsp90 chaperone by affecting its ATPase and cochaperone
           binding activities; has similarity to human phosphatase
           PP5; present in both the nucleus and cytoplasm;
           expressed during logarithmic growth
          Length = 513

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 41/70 (58%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISI 165
           K +GN  +  K +  AI KYTEAI +  T +IY++NRA AH  +  +  A+ D + +I +
Sbjct: 16  KNEGNVFVKEKHFLKAIEKYTEAIDLDSTQSIYFSNRAFAHFKVDNFQSALNDCDEAIKL 75

Query: 166 DPSYFRGYSR 175
           DP   + Y R
Sbjct: 76  DPKNIKAYHR 85

>NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa]
           {ON} Anc_3.481
          Length = 523

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 44/76 (57%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSIS 164
           LK +GNK +  K Y  A+  YT+AI++  T +I+++NRA A   L  +   + D  S++ 
Sbjct: 16  LKNEGNKYIKEKKYTKAVEYYTKAIELDSTQSIFFSNRALAQLKLDNFQSCLDDCNSALE 75

Query: 165 IDPSYFRGYSRLGFAK 180
           +DP   + Y R G ++
Sbjct: 76  LDPKNIKAYHRRGLSQ 91

>TDEL0D05500 Chr4 complement(991567..993105) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 75/146 (51%), Gaps = 11/146 (7%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSIS 164
           LK +GN  +  +D+  AI+ YT+AI +  T +IY++NRA AH  L  +  ++ D + ++ 
Sbjct: 15  LKNEGNIFIKKQDFTKAIDLYTKAIGLDSTQSIYFSNRALAHLKLDNFQSSLNDCDEALK 74

Query: 165 IDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNATEAMKRDY-------ESAKK 217
           +DP   + Y R G +     + ++A    + VL  +  +AT +   D        E  +K
Sbjct: 75  LDPKNAKAYHRRGLSYIGLLEFKKAKNDLQIVLKAKPGDATASRALDVCEKFIREERFRK 134

Query: 218 KV----EQSLNLEKAVPEQSRDADAN 239
            +    E  +NL + +  +S DA+A+
Sbjct: 135 AIGGGDEIKVNLCETLRLESYDANAD 160

>TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {ON}
           Anc_3.481 YGR123C
          Length = 513

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 70/140 (50%), Gaps = 18/140 (12%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSIS 164
            K +GN+ +   DY+ AI  Y++AI +  T +IY++NRA AH     +  AV D ++++ 
Sbjct: 15  FKNKGNEYIKKSDYDSAIEFYSKAIALDSTQSIYFSNRALAHLKQDNFYSAVVDCDNALK 74

Query: 165 IDPS-----YFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNATE------------- 206
           +DP      + RG S +G  ++ + K +  +    K  DI   NA +             
Sbjct: 75  LDPKNIKAYHRRGLSYVGILEFRKAKNDLNVVLKAKPNDITASNALKVCENFIREERFKN 134

Query: 207 AMKRDYESAKKKVEQSLNLE 226
           A+    ++AK  + Q+LNLE
Sbjct: 135 AIGGSGDNAKSNICQTLNLE 154

>Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 40/70 (57%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISI 165
           K +GN  +  K +  AI KYTEAI +  T  IY++NRA +H  +  +  A+ D + +I +
Sbjct: 16  KNEGNVLVKEKHFLKAIEKYTEAIDLDSTQTIYFSNRALSHFKVDNFQSALNDCDEAIKL 75

Query: 166 DPSYFRGYSR 175
           DP   + Y R
Sbjct: 76  DPKNIKAYHR 85

 Score = 30.4 bits (67), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 110 NKAMAN---KDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISID 166
           N+A+++    +++ A+N   EAI++ P N   Y  RA +  +L E+ +A +D    + + 
Sbjct: 51  NRALSHFKVDNFQSALNDCDEAIKLDPKNIKAYHRRALSCMALLEFKKAKRDLNVLLKVK 110

Query: 167 PS 168
           P+
Sbjct: 111 PN 112

>Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 55.5 bits (132), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 41/70 (58%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISI 165
           K +GN  +  K +  AI KYT+AI +  T +IY++NRA AH  +  +  A+ D + ++ +
Sbjct: 16  KNEGNVFIKEKHFLKAIEKYTQAIDLDSTQSIYFSNRAFAHFKVDNFQSALNDCDEALKL 75

Query: 166 DPSYFRGYSR 175
           DP   + Y R
Sbjct: 76  DPKNIKAYHR 85

>NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {ON}
           Anc_3.142 YDL047W
          Length = 512

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 54/101 (53%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSIS 164
            K +GN  +  ++Y  AI  Y++AI++ PT +I+++NRA A   L  +   + D + ++ 
Sbjct: 15  FKNEGNTYIKEQNYMKAIELYSQAIELDPTQSIFFSNRALAQLKLDNFQSCMNDCDVALR 74

Query: 165 IDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNAT 205
           +DP   + Y R G +     + ++A    + VL  +  +AT
Sbjct: 75  LDPKNIKAYHRRGLSHLGLLQCKKARNDLQVVLKAKPTDAT 115

>KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON}
           Anc_3.481 YGR123C
          Length = 511

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 45/74 (60%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISI 165
           K +GNK +  +D++ A   YT+AI+  PT +I+Y+NRA A+  L  +  A+ D  ++I +
Sbjct: 13  KDEGNKFLKQQDFQRANELYTKAIETDPTQSIFYSNRALANLKLDNFMNALNDCTNAIEL 72

Query: 166 DPSYFRGYSRLGFA 179
           + S  + Y R G A
Sbjct: 73  NSSNLKAYHRRGLA 86

>SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 42/75 (56%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSIS 164
            K QGN  +  K++  A   Y++AI++  T +IY++NRA AH  L  +  A+ D   +I 
Sbjct: 15  FKNQGNVFIKGKNFSKAAELYSKAIELDGTQSIYFSNRAFAHLKLDNFQTALNDCNKAIE 74

Query: 165 IDPSYFRGYSRLGFA 179
           +DP   + Y R G +
Sbjct: 75  LDPKNVKAYHRRGLS 89

 Score = 30.8 bits (68), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 34/62 (54%), Gaps = 3/62 (4%)

Query: 110 NKAMAN---KDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISID 166
           N+A A+    +++ A+N   +AI++ P N   Y  R  ++  L E+++A KD +  +   
Sbjct: 51  NRAFAHLKLDNFQTALNDCNKAIELDPKNVKAYHRRGLSYIGLLEFNKARKDLKIVLRAK 110

Query: 167 PS 168
           P+
Sbjct: 111 PN 112

>AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR123C
           (PPT1)
          Length = 538

 Score = 52.4 bits (124), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 62/127 (48%), Gaps = 9/127 (7%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISI 165
           K +GN+ +  KDY  A+  YT AI+   T +I+++NRA A+  L  +  A++D+  +I +
Sbjct: 42  KNEGNEWVKAKDYARAVEAYTRAIEADGTQSIFFSNRALANLKLDRFQSALEDSARAIEL 101

Query: 166 DPSYFRGYSRLGFAKYA---QGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQS 222
           D    + Y R G A       G  +  LE       +      EA++R  E  ++ + + 
Sbjct: 102 DAGNVKAYHRRGLAHCGLLEWGPAKRDLEVV-----VRAKPGDEAVRRALEVCERMLRRE 156

Query: 223 LNLEKAV 229
              E+A+
Sbjct: 157 -RFERAI 162

>KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 604

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 45/71 (63%), Gaps = 1/71 (1%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSIS 164
           LK +GN+    KD+E AI  YT AI  L  + ++Y+NR+AA+ S+  +++ V+D  +++ 
Sbjct: 107 LKDKGNEFFKAKDFEKAIEYYTLAIS-LKEDPVFYSNRSAAYVSINNFEKVVEDTTAALK 165

Query: 165 IDPSYFRGYSR 175
           + P Y + + R
Sbjct: 166 LKPDYSKCWLR 176

>KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]
           {ON} highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123C
          Length = 513

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 42/141 (29%), Positives = 68/141 (48%), Gaps = 22/141 (15%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSIS 164
            K QGN  +  K Y  A+  Y++AI++  T +I+++NRA +   L  +  A++D   SI 
Sbjct: 15  FKNQGNAFIKEKKYPEAVEYYSKAIELDDTQSIFFSNRAFSRLKLDNFLTALEDCNKSIE 74

Query: 165 IDPS-----YFRGYSRLGFAKYA----------QGKPEE-----ALEAYKKVLDIEGDNA 204
           +DP      + RG S +G  +++          Q KP E     ALE  ++   I  +  
Sbjct: 75  LDPKNIKAIHRRGLSYVGLLEFSKARKDLKTILQVKPNEQSALKALEVCERF--IREERF 132

Query: 205 TEAMKRDYESAKKKVEQSLNL 225
            +A+  D E +K  V  SL L
Sbjct: 133 KKAISGDGEESKVNVCASLQL 153

>Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}
           complement(91130..92671) [1542 nt, 514 aa]
          Length = 513

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 41/75 (54%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSIS 164
            K +GN  +  ++Y  AI  YT+AI++ P  +I+Y+NRA A   L  +  A  D   +++
Sbjct: 15  FKNEGNVFIKEQNYSKAIELYTKAIELDPNQSIFYSNRALAQLKLDNFQSAYNDCNEALT 74

Query: 165 IDPSYFRGYSRLGFA 179
           +D    + Y R G A
Sbjct: 75  LDSKNVKAYHRRGLA 89

>Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {ON}
           YGR123C (PPT1) - serine/threonine phosphatase [contig
           295] FULL
          Length = 511

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 49/86 (56%), Gaps = 5/86 (5%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSIS 164
            K QGN  +  K Y+ A+  Y++AI++  T +IY++NRA +   L  +  A +D + +I+
Sbjct: 13  FKNQGNAYVKEKKYQEAVEYYSKAIELDDTQSIYFSNRAFSRLRLDNFLTAQEDCDKAIA 72

Query: 165 IDPS-----YFRGYSRLGFAKYAQGK 185
           +DP      + RG S +G  ++ + +
Sbjct: 73  LDPKNIKAIHRRGLSYVGLLEFFKAR 98

>KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} similar
           to uniprot|P53043 Saccharomyces cerevisiae YGR123C
          Length = 512

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 62/130 (47%), Gaps = 13/130 (10%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSIS 164
           LK +GNK +  K Y  A   YT+AI+  P N I Y+NRA  +  L  +  ++ DA+ +I 
Sbjct: 16  LKNEGNKFVKEKLYAKAAEYYTKAIEHDPENTILYSNRAFTNLKLDNFQSSLDDAKRAIE 75

Query: 165 IDPSYFRGYSR-----LGFAKYAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKV 219
           +D +  + Y R     +G  ++ + + +  +    K  ++   NA         +   KV
Sbjct: 76  LDNNNLKAYHRRAMSYIGLLEFRKARKDLIIVLKFKPNELTAKNAL--------AICDKV 127

Query: 220 EQSLNLEKAV 229
            Q  N EKA+
Sbjct: 128 IQKENFEKAI 137

>KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 593

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSIS 164
           LK +GN+   NK Y+ AI  Y+ AI+V   + ++Y+NR+A + SL + ++ V+D  +++ 
Sbjct: 98  LKDKGNEFFKNKKYDEAIQYYSWAIEV-KEDPVFYSNRSACYVSLGQQEKVVEDTTAALK 156

Query: 165 IDPSYFRGYSR 175
           + P Y +   R
Sbjct: 157 LKPDYSKCLLR 167

>KNAG0A03950 Chr1 complement(529620..530780) [1161 bp, 386 aa] {ON}
           Anc_8.506 YBR155W
          Length = 386

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 33/104 (31%), Positives = 49/104 (47%), Gaps = 4/104 (3%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIQVL----PTNAIYYANRAAAHSSLREYDEAVKDAE 160
            K Q N     K +  A   YT+ I+V       N   +ANRAA    L+ Y   V D +
Sbjct: 88  FKNQANDLYKVKRFRDARELYTKGIKVFCEDKSINESLFANRAACELELKNYRSCVADCQ 147

Query: 161 SSISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNA 204
            ++ I+P   + + R+G A  A GK +EA +A    L I+ +N 
Sbjct: 148 KAMEINPMNLKCFYRMGKAFLALGKFKEAHDAVSFGLKIDEENV 191

>KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.506
           YBR155W
          Length = 380

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 39/132 (29%), Positives = 58/132 (43%), Gaps = 15/132 (11%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIQ----VLPTNAIYYANRAAAHSSLREYDEAVKDAE 160
            K QGN     K +  A   YT+ I+    V   N   YANRAA    L+ +   + D +
Sbjct: 81  FKNQGNDLYKVKRFRDAREIYTKGIEMKCDVAKINESLYANRAACQLELKNFRSCISDCK 140

Query: 161 SSISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNAT-----------EAMK 209
           ++++ +P   + Y R+G A  A  K E A E+ +    I+ DN +           E   
Sbjct: 141 TALTYNPKNIKCYFRMGKAFTAINKFESARESIEFGQKIDNDNKSFENLLNIIKNKEEEI 200

Query: 210 RDYESAKKKVEQ 221
           R YE  K K +Q
Sbjct: 201 RKYEEKKLKAQQ 212

>Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {ON}
           YHR117W (TOM71) - 71-kDa component of the protein
           translocase of the outer membrane of mitochondria
           [contig 101] FULL
          Length = 594

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 51/86 (59%), Gaps = 1/86 (1%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSIS 164
           LK +GN+   NK +E A+  Y+ AI+V   + ++Y+NR+A + SL + ++ V+D  +++ 
Sbjct: 99  LKDKGNEFFKNKQFEDALKYYSLAIEV-KEDPVFYSNRSACYVSLGQQEKVVEDTTAALK 157

Query: 165 IDPSYFRGYSRLGFAKYAQGKPEEAL 190
           + P Y +   R   A  + GK  +A+
Sbjct: 158 LKPDYSKCLLRRASANESLGKFADAM 183

>NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {ON}
           Anc_2.152
          Length = 596

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 45/80 (56%), Gaps = 8/80 (10%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSIS 164
           LK +GN     KD+E AI  YT A+  L  + +YY+N +A +SSL  Y++ ++ A  +++
Sbjct: 98  LKEKGNALFKKKDFENAIKYYTFALS-LKEDPVYYSNISACYSSLLNYEKVIEMATKALA 156

Query: 165 IDPSYFR-------GYSRLG 177
           + P Y +        Y +LG
Sbjct: 157 LRPDYSKVLVRRANAYEKLG 176

>ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 55/110 (50%), Gaps = 5/110 (4%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISI 165
           K QGN  +  +D+  A   YT+AI++  T +I+++NRA AH     +  ++ D + ++ +
Sbjct: 16  KDQGNDFVKKQDFIKAAELYTKAIELDDTKSIFFSNRALAHLKQDNFQLSLNDCDKALEL 75

Query: 166 DPSYFRGYSRLGFAKYAQGKPEEALEAYKKVL-----DIEGDNATEAMKR 210
           D    + Y R G +     + ++A    K VL     D+  D A +  ++
Sbjct: 76  DSKNIKAYHRRGLSYVGLLEFKKARTDLKTVLKSKPGDVAADRALQICEK 125

>CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121c TOM70
           or uniprot|P38825 Saccharomyces cerevisiae YHR117w TOM7
          Length = 587

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 38/65 (58%), Gaps = 1/65 (1%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSIS 164
           LK +GN     KDYE AIN Y  A+Q L  + ++Y+N AA + SL    EA++    ++ 
Sbjct: 89  LKKRGNAYFKVKDYENAINYYKFALQ-LKNDPVFYSNMAACYISLEHNKEAIEACSKALE 147

Query: 165 IDPSY 169
           ++P Y
Sbjct: 148 LNPDY 152

>NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 45.8 bits (107), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 44/92 (47%), Gaps = 4/92 (4%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIQVL----PTNAIYYANRAAAHSSLREYDEAVKDAE 160
            K QGN     K +  A + Y + I++       N   +ANRAA    L+ Y   + D +
Sbjct: 83  FKNQGNDLFTVKRFREARDIYNKGIEIKCENDKINEALFANRAACQLELKNYRSCINDCK 142

Query: 161 SSISIDPSYFRGYSRLGFAKYAQGKPEEALEA 192
            +++++P   + Y R+G A Y     EEA E+
Sbjct: 143 HALTLNPKNIKCYYRMGKAFYLLNNIEEAKES 174

>Kpol_1018.106 s1018 (280224..282485) [2262 bp, 753 aa] {ON}
           (280224..282485) [2262 nt, 754 aa]
          Length = 753

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 45/96 (46%)

Query: 109 GNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPS 168
           GN     KD+E AI  + +A QV P  A  Y  +   HSS   +D A      +++ DP 
Sbjct: 542 GNFLSLQKDHEDAIKAFEKATQVDPNFAYAYTLQGHEHSSNDSFDTAKNCYRKALACDPQ 601

Query: 169 YFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNA 204
           ++  Y  LG +    G+ +EAL  ++K   I   N 
Sbjct: 602 HYNAYYGLGMSCMKLGQYDEALLHFEKARSINPINV 637

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 47/104 (45%)

Query: 107 MQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISID 166
           +QG++  +N  ++ A N Y +A+   P +   Y     +   L +YDEA+   E + SI+
Sbjct: 574 LQGHEHSSNDSFDTAKNCYRKALACDPQHYNAYYGLGMSCMKLGQYDEALLHFEKARSIN 633

Query: 167 PSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNATEAMKR 210
           P         G A       E+AL  Y+   +++  ++    KR
Sbjct: 634 PINVILICCCGVALEKLQYQEKALSYYELACELQPSSSLANFKR 677

>Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 43/89 (48%), Gaps = 4/89 (4%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIQV----LPTNAIYYANRAAAHSSLREYDEAVKDAE 160
            K QGN+    K ++ A   YT+ I V       N   +ANRAA    L+ Y   ++D  
Sbjct: 86  FKKQGNELYKAKRFKDARELYTKGIAVECEDKSINESLFANRAACELELKNYRRCIEDCS 145

Query: 161 SSISIDPSYFRGYSRLGFAKYAQGKPEEA 189
            +++I+P   + Y R   A ++  K EEA
Sbjct: 146 KALTINPKNIKCYYRTSKAFFSLSKLEEA 174

>CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155w CNS1
          Length = 380

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 62/128 (48%), Gaps = 6/128 (4%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAI----QVLPTNAIYYANRAAAHSSLREYDEAVKDAE 160
            K QGN     K +  A   Y++ I    QV   N   YANRAA    ++ Y   + D +
Sbjct: 84  FKKQGNDLYKVKRFRDARELYSKGIDVKCQVNTINESLYANRAACELEIKNYRRCINDCK 143

Query: 161 SSISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDN-ATEAMKRDYESAKKKV 219
            ++ ++P   + Y R+  A  A  + +EALE+ +    I+  N + + +K   E+ + ++
Sbjct: 144 QALQLNPKNIKCYYRIAKAFTALERLDEALESIEFGEKIDNTNKSLKTLKLHIETKQLEI 203

Query: 220 E-QSLNLE 226
           E + L LE
Sbjct: 204 EARRLKLE 211

>TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.328
           YCR060W
          Length = 116

 Score = 41.2 bits (95), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 32/61 (52%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSIS 164
           LK +GN +  N  Y  AI+ Y   I + P+N I Y+N+A A      +DEA+   E  + 
Sbjct: 6   LKAKGNISFKNGSYSEAISWYNRCISIDPSNPIGYSNKAMALLKADRFDEAITTCEKGLQ 65

Query: 165 I 165
           +
Sbjct: 66  L 66

>Kpol_1043.60 s1043 (123502..125622) [2121 bp, 706 aa] {ON}
           (123502..125622) [2121 nt, 707 aa]
          Length = 706

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 32/57 (56%)

Query: 139 YANRAAAHSSLREYDEAVKDAESSISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKK 195
           Y N +A +  L+E D+A + +   I I+P   +GY R+G     QGK  EA + YKK
Sbjct: 74  YDNLSATYEKLQELDKAYESSSRMIHIEPYNMKGYIRMGKVLQRQGKDPEAYKCYKK 130

>TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.506
           YBR155W
          Length = 375

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 38/134 (28%), Positives = 67/134 (50%), Gaps = 11/134 (8%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIQVL----PTNAIYYANRAAAHSSLREYDEAVKDAE 160
            K +GN+    K Y  A   YT+ I V       N   YANRAA    L+ + + ++D +
Sbjct: 77  FKNRGNEFYKLKQYRDAREVYTKGIDVKCDDDKINESLYANRAACELELKNFRKCIEDCK 136

Query: 161 SSISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNAT-----EAM-KRDYES 214
            ++S +    + Y R+G A  +  + +E+ E+ +  L I+ +N +     +A+ KR  E 
Sbjct: 137 KALSFNVKNIKCYYRMGKAFLSVDRFDESKESIEFGLKIDSENKSLKNLLQAIEKRQLEI 196

Query: 215 AKKK-VEQSLNLEK 227
            ++K +E  + LEK
Sbjct: 197 QRRKDMEMKIKLEK 210

>Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON}
           similar to Ashbya gossypii AAR054C
          Length = 172

 Score = 42.0 bits (97), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 30/52 (57%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAV 156
           LK++GN    N DYE AI  Y +A  +  +N IY++N A A   L  + EAV
Sbjct: 44  LKVKGNTFFKNGDYETAILYYEKACALDSSNPIYFSNMATALIKLERWQEAV 95

>KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {ON}
           Anc_2.152 YHR117W
          Length = 608

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSIS 164
           LK +GN+    KDYE A+  Y  A+ +L  + ++Y+N +A + SL E D+ ++ +  ++ 
Sbjct: 111 LKDKGNEYFKEKDYENALKFYDFAL-ILKKDPVFYSNMSACYVSLNELDKVIEMSTKALE 169

Query: 165 IDPSYFRGYSR 175
           + P Y +   R
Sbjct: 170 LKPDYSKALLR 180

>Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}
           similar to Ashbya gossypii ABR131W
          Length = 597

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSIS 164
           +K +GN+    K YE AI  Y+ A++ L  + ++Y+NR+A    L + ++ V+D  +++ 
Sbjct: 101 MKDKGNECFKEKKYEEAIKYYSCALR-LKKDPVFYSNRSACWVPLNKLEKVVEDTTAALE 159

Query: 165 IDPSYFRGYSR 175
           + P Y +   R
Sbjct: 160 LKPDYSKCLLR 170

>Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 44/89 (49%), Gaps = 4/89 (4%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIQV----LPTNAIYYANRAAAHSSLREYDEAVKDAE 160
            K QGN+    K ++ A   YT+ + V       N   +ANRAA    L+ Y + V+D  
Sbjct: 86  FKKQGNELYKAKRFKDARELYTKGVAVECEDKSINESLFANRAACELELKNYRKCVEDCG 145

Query: 161 SSISIDPSYFRGYSRLGFAKYAQGKPEEA 189
            +++I+P   + Y R+  + +   K EEA
Sbjct: 146 KALTINPKNIKCYYRISKSFFQLRKLEEA 174

>NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.152
           YHR117W
          Length = 609

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 45/80 (56%), Gaps = 1/80 (1%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSIS 164
           LK +GN+      +E AI  Y  A++ L  + IYY+N +A ++SL +Y++ ++ A  ++ 
Sbjct: 113 LKDKGNELFKTSKFEDAIKYYHYALK-LKDDPIYYSNISACYASLLQYEKVIEYATKALK 171

Query: 165 IDPSYFRGYSRLGFAKYAQG 184
           + P++ +   R   A  A G
Sbjct: 172 LRPTFSKVLMRRALAYEAMG 191

>ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL121C (TOM70) and
           YHR117W (TOM71)
          Length = 594

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 42/71 (59%), Gaps = 1/71 (1%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSIS 164
           LK +GN+   ++ YE AI  Y  A++ L  + ++Y+NR+A +  L + ++ V+D  +++ 
Sbjct: 98  LKDKGNECFKDQRYEEAIKFYDCALK-LKEDPVFYSNRSACYVPLNKLEKVVEDTTAALK 156

Query: 165 IDPSYFRGYSR 175
           + P Y +   R
Sbjct: 157 LKPDYSKCLLR 167

 Score = 31.6 bits (70), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 16/61 (26%), Positives = 34/61 (55%)

Query: 125 YTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPSYFRGYSRLGFAKYAQG 184
           + +A+++ P ++  Y +RA  +  ++++D+A KD + +   DPS    Y +L    Y + 
Sbjct: 362 FEKALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYREK 421

Query: 185 K 185
           K
Sbjct: 422 K 422

>CAGL0K09240g Chr11 complement(914042..914470) [429 bp, 142 aa] {ON}
           weakly similar to uniprot|P25638 Saccharomyces
           cerevisiae YCR060w
          Length = 142

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 109 GNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSIS 164
           GN+     +Y+LAI +Y + I + PTNA+ Y+N A A+   R  DEA    E  +S
Sbjct: 42  GNEHFKKGEYDLAIEQYRKCISLEPTNAVGYSNLAMAYLKNRCPDEAKTACEMGLS 97

 Score = 30.0 bits (66), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 21/39 (53%)

Query: 151 EYDEAVKDAESSISIDPSYFRGYSRLGFAKYAQGKPEEA 189
           EYD A++     IS++P+   GYS L  A      P+EA
Sbjct: 50  EYDLAIEQYRKCISLEPTNAVGYSNLAMAYLKNRCPDEA 88

>NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON}
           Anc_2.152
          Length = 625

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 52/104 (50%), Gaps = 14/104 (13%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSIS 164
           LK +GNK    KDY  AI  Y  A+  L  + I+Y+N +A + SL + D+ ++ +  ++ 
Sbjct: 125 LKDKGNKYFKAKDYTNAIKYYNLALD-LNKDPIFYSNISACYVSLGQLDKVIESSTKALE 183

Query: 165 IDPSYFRGYSRLGFAKYAQGKPEEALEAYK------KVLDIEGD 202
           ++P+Y +   R       +    E+LE Y        VL + GD
Sbjct: 184 LNPNYSKALLR-------RASANESLENYSDALFDLSVLSLNGD 220

>YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}
           CNS1TPR-containing co-chaperone; binds both Hsp82p
           (Hsp90) and Ssa1p (Hsp70) and stimulates the ATPase
           activity of SSA1, ts mutants reduce Hsp82p function
           while over expression suppresses the phenotypes of an
           HSP82 ts allele and a cpr7 deletion
          Length = 385

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 42/89 (47%), Gaps = 4/89 (4%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIQV----LPTNAIYYANRAAAHSSLREYDEAVKDAE 160
            K QGN+    K ++ A   Y++ + V       N   YANRAA    L+ Y   ++D  
Sbjct: 86  FKKQGNELYKAKRFKDARELYSKGLAVECEDKSINESLYANRAACELELKNYRRCIEDCS 145

Query: 161 SSISIDPSYFRGYSRLGFAKYAQGKPEEA 189
            +++I+P   + Y R   A +   K EEA
Sbjct: 146 KALTINPKNVKCYYRTSKAFFQLNKLEEA 174

>SAKL0H10934g Chr8 complement(945834..946976) [1143 bp, 380 aa] {ON}
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155W CNS1 cyclophilin seven suppressor component of
           Hsp90p chaperone machinery
          Length = 380

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 49/104 (47%), Gaps = 4/104 (3%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIQVLP----TNAIYYANRAAAHSSLREYDEAVKDAE 160
            K QGN     + Y+ A   Y + ++V       N   + NRAA    L+ +   + D +
Sbjct: 83  FKNQGNDLYRARRYKDARELYNKGVEVHCDDDAINESLFLNRAACELELKNHRRCINDCK 142

Query: 161 SSISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNA 204
            ++  +P   + + R+G A ++  K EEA EA +  L  + +NA
Sbjct: 143 EALRYNPKNVKCFYRMGRAFFSLNKLEEAKEAIEFGLRFDSNNA 186

>TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {ON}
           Anc_2.152 YHR117W
          Length = 599

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 53/104 (50%), Gaps = 14/104 (13%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSIS 164
           LK +GN+    KDY+ A+  Y  A+ V+  + ++Y+N +A + SL + D+ V+++  ++ 
Sbjct: 104 LKDRGNEFFKKKDYDNALKYYNYAL-VVKKDPVFYSNISACYVSLGQLDKVVENSTKALE 162

Query: 165 IDPSYFRGYSRLGFAKYAQGKPEEALEAYK------KVLDIEGD 202
           + P Y +   R       +    E+LE Y        VL + GD
Sbjct: 163 LKPDYSKALLR-------RASANESLENYADAMFDLSVLSLNGD 199

>Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)
           [1125 nt, 375 aa]
          Length = 374

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 48/105 (45%), Gaps = 4/105 (3%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIQVL----PTNAIYYANRAAAHSSLREYDEAVKDAE 160
            K QGN     K +  A   Y +AI V       N   YANRAA    L+ Y   + D +
Sbjct: 77  FKNQGNDLYKVKRFRDARELYNKAIDVKCDDDKINESLYANRAACELELKNYRRCINDCK 136

Query: 161 SSISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNAT 205
            ++S++P   + Y R+  A  A  K ++  EA +  L  + +N +
Sbjct: 137 MALSLNPKNIKCYFRMAKAFLAIEKFDDCKEAIQFGLKFDLENKS 181

>Ecym_2559 Chr2 (1089202..1090314) [1113 bp, 370 aa] {ON} similar to
           Ashbya gossypii AGL268C
          Length = 370

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 43/195 (22%), Positives = 85/195 (43%), Gaps = 15/195 (7%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIQVL----PTNAIYYANRAAAHSSLREYDEAVKDAE 160
            K QGN     K Y+ A   Y++ I+V       N   Y NRAA    LR +   + D +
Sbjct: 82  FKNQGNDLYKVKRYKDARTMYSKGIEVKCEDDSINGSLYLNRAACELELRNFRSCINDCK 141

Query: 161 SSISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVE 220
            +++ +    + + R+G A +   K EEA  +   +  ++ D+   A+    ++  K+ E
Sbjct: 142 KALNFNAKCVKAFYRMGQAYFKLKKLEEAKGSV--LFGLKLDSQNNALVSLLDTIVKQEE 199

Query: 221 QSLNLEKAVPEQSRDADANASQXXXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNP 280
           ++  LE++     ++ D +AS+                      N P ++Q +  M+S P
Sbjct: 200 KANVLEESRFRDQQEKDLHASKLKEALSWRKITEFKTA------NPPAVLQNSTLMLSEP 253

Query: 281 GAMQNIQKMMQDPSI 295
              ++I+  +  P++
Sbjct: 254 ---EDIESQLSFPAM 265

>YBL084C Chr2 complement(67169..69445) [2277 bp, 758 aa] {ON}
           CDC27Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C), which is a ubiquitin-protein ligase required
           for degradation of anaphase inhibitors, including
           mitotic cyclins, during the metaphase/anaphase
           transition
          Length = 758

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 44/97 (45%)

Query: 109 GNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPS 168
           GN     KD++ AI  + +A Q+ P  A  Y  +   HSS    D A      +++ DP 
Sbjct: 547 GNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYRKALACDPQ 606

Query: 169 YFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNAT 205
           ++  Y  LG +    G+ EEAL  ++K   I   N  
Sbjct: 607 HYNAYYGLGTSAMKLGQYEEALLYFEKARSINPVNVV 643

>Suva_2.34 Chr2 complement(63832..65304,65365..66183) [2292 bp, 763
           aa] {ON} YBL084C (REAL)
          Length = 763

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 44/97 (45%)

Query: 109 GNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPS 168
           GN     KD++ AI  + +A Q+ P  A  Y  +   HSS    D A      +++ DP 
Sbjct: 552 GNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYRKALACDPQ 611

Query: 169 YFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNAT 205
           ++  Y  LG +    G+ EEAL  ++K   I   N  
Sbjct: 612 HYNAYYGLGTSSMKLGQYEEALLYFEKARSINPVNVV 648

>Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W
           (REAL)
          Length = 638

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 51/98 (52%), Gaps = 1/98 (1%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSIS 164
           LK +GN    +K+++ AI  Y  AI++ P + ++Y+N +A + S  + ++ V+    ++ 
Sbjct: 128 LKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALE 187

Query: 165 IDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGD 202
           I P + +   R   A  + G   +A+     VL + GD
Sbjct: 188 IKPDHSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 224

>Smik_2.36 Chr2 complement(61159..63414) [2256 bp, 751 aa] {ON}
           YBL084C (REAL)
          Length = 751

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 44/97 (45%)

Query: 109 GNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPS 168
           GN     KD++ AI  + +A Q+ P  A  Y  +   HSS    D A      +++ DP 
Sbjct: 540 GNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYRKALACDPQ 599

Query: 169 YFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNAT 205
           ++  Y  LG +    G+ EEAL  ++K   I   N  
Sbjct: 600 HYNAYYGLGTSSMKLGQYEEALLYFEKARSINPVNVV 636

>TPHA0E00740 Chr5 complement(142456..144696) [2241 bp, 746 aa] {ON}
           Anc_7.412 YBL084C
          Length = 746

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 44/97 (45%)

Query: 109 GNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPS 168
           GN     K++  AI  + +A QV P  A  Y  +   ++S   +D A +    +I+ DP 
Sbjct: 535 GNFLSLQKNHHEAIKAFEKATQVDPKFAYAYTLQGHEYTSSDSFDVAKRCYRKAIACDPG 594

Query: 169 YFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNAT 205
           ++  Y  LG      G+ EEAL  ++K   I   N  
Sbjct: 595 HYNAYYGLGMVSMKLGQYEEALLFFEKARSINPINVV 631

>ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121C TOM70 Translocase of Outer Mitochondrial
           membrane 70 kDa mitochondrial specialized import
           receptor of the outer membrane
          Length = 604

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSIS 164
           LK +GN+    KDY+ A+  Y  A+  L  + ++Y+N +A + S+ + D+ V+++  ++ 
Sbjct: 109 LKDKGNEFFKQKDYDNALKYYDYAL-TLKKDPVFYSNISACYVSMNQLDKVVENSTKALE 167

Query: 165 IDPSYFRGYSR 175
           + P Y +   R
Sbjct: 168 LKPDYSKALLR 178

>TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 48/103 (46%), Gaps = 4/103 (3%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIQV----LPTNAIYYANRAAAHSSLREYDEAVKDAE 160
            K QGN     K ++ A   Y + I++       N   YANRAA    ++ Y   + D +
Sbjct: 81  FKNQGNDLYKAKRFKDARELYNKGIEIKCDDTSINESLYANRAACELEIKNYRRCLNDCK 140

Query: 161 SSISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDN 203
           +++  +P   + Y R+G A  A    EEA ++ +  L ++  N
Sbjct: 141 TALQYNPKNLKCYYRMGKAFLALELLEEAQKSVEFGLQVDSSN 183

>NCAS0I00870 Chr9 (160192..161949) [1758 bp, 585 aa] {ON} Anc_3.395
           YPR088C
          Length = 585

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 33/58 (56%), Gaps = 18/58 (31%)

Query: 266 NPQLMQAAQ-KMMSNPGAMQNIQ-----------------KMMQDPSIRQMAEGFTSG 305
           +PQ+MQ AQ ++  NPG MQN+Q                 KMMQDP++++MA+ F  G
Sbjct: 527 SPQMMQQAQQRLRQNPGMMQNMQNMFGGAGGGMPDMNEMMKMMQDPNMQKMAQQFGMG 584

>SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {ON}
           similar to uniprot|P25638 Saccharomyces cerevisiae
           YCR060W TAH1 HSP90
          Length = 128

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 28/52 (53%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAV 156
           LK +GN      DYE A+  Y +AI   P+N I Y+N A     L ++ EAV
Sbjct: 7   LKAKGNVFFKKCDYETAVLYYQKAITADPSNPIGYSNNAMGLIKLEKWSEAV 58

>KLLA0E20857g Chr5 (1860517..1862649) [2133 bp, 710 aa] {ON} similar
           to uniprot|Q751K0 Ashbya gossypii AGL294W AGL294Wp and
           some similarites with YBL084C uniprot|P38042
           Saccharomyces cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 710

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 44/87 (50%)

Query: 109 GNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPS 168
           GN    NKD++ AI  + +AIQ+ P  A  Y  +   +S+   +D A      +++I+ +
Sbjct: 499 GNLHSLNKDHDEAITAFGKAIQLDPFFAYAYTLQGHEYSNNDAFDNAKSCFRKALTIEKT 558

Query: 169 YFRGYSRLGFAKYAQGKPEEALEAYKK 195
           ++     LG      GK EEAL  ++K
Sbjct: 559 HYNALYGLGMCCVKLGKFEEALLFFEK 585

>CAGL0C01903g Chr3 complement(199487..201796) [2310 bp, 769 aa] {ON}
           similar to uniprot|P38042 Saccharomyces cerevisiae
           YBL084c CDC27 subunit of anaphase-promoting complex
          Length = 769

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 44/97 (45%)

Query: 109 GNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPS 168
           GN     KD+E AI  + +A ++ P  A  Y  +    SS   +D A K    +I+ DP 
Sbjct: 558 GNYLSLKKDHEDAIEAFEKATKIDPKFAYAYTLQGHECSSNDSFDAAKKCFRKAIACDPR 617

Query: 169 YFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNAT 205
           ++  Y  +G      G  +EAL  ++K   I   NA 
Sbjct: 618 HYNAYYGMGIYSMKLGHYDEALLYFEKARQIYPINAV 654

>ADR230W Chr4 (1103275..1105332) [2058 bp, 685 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR080W (DIA2)
          Length = 685

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 34/70 (48%)

Query: 133 PTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPSYFRGYSRLGFAKYAQGKPEEALEA 192
           P   +   NRAA    L + D A+ DA   I++D    +GY R G      G+ EEAL+ 
Sbjct: 67  PRFFVLLDNRAATFEKLNKLDRALADAAYMITVDAYNLKGYIRRGKVLQKLGRYEEALQV 126

Query: 193 YKKVLDIEGD 202
           Y+  L   G+
Sbjct: 127 YENGLKQAGE 136

>TPHA0L01420 Chr12 (293980..295104) [1125 bp, 374 aa] {ON} Anc_8.506
           YBR155W
          Length = 374

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 33/129 (25%), Positives = 60/129 (46%), Gaps = 6/129 (4%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIQV----LPTNAIYYANRAAAHSSLREYDEAVKDAE 160
            K QGN+A   K Y  A   Y   I+V       N + + N+AA    ++ Y   + D +
Sbjct: 77  FKKQGNEAYKLKQYRNARVLYERGIEVNCNNDKINELLFVNKAACELEMKNYRSCINDCK 136

Query: 161 SSISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNAT--EAMKRDYESAKKK 218
            ++S +P   + Y R+  A  A  K +E+ E+ +  L ++  N++    +K   +  ++K
Sbjct: 137 KALSFNPLNVKCYFRMAKAFSAIEKYDESRESIEFGLKVDSRNSSLLNLLKTIIKKQEEK 196

Query: 219 VEQSLNLEK 227
               L LE+
Sbjct: 197 TAYRLKLER 205

 Score = 33.1 bits (74), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 39/85 (45%), Gaps = 4/85 (4%)

Query: 116 KDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPSYFRGYSR 175
           K+Y   IN   +A+   P N   Y   A A S++ +YDE+ +  E  + +D    R  S 
Sbjct: 126 KNYRSCINDCKKALSFNPLNVKCYFRMAKAFSAIEKYDESRESIEFGLKVDS---RNSSL 182

Query: 176 LGFAKYAQGKPEEALEAYKKVLDIE 200
           L   K    K EE   AY+  L+ E
Sbjct: 183 LNLLKTIIKKQEEK-TAYRLKLERE 206

>NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON}
           Anc_2.152 YHR117W
          Length = 664

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 54/98 (55%), Gaps = 2/98 (2%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSIS 164
           LK +GN+   +KD E AI  Y  A++ L  + ++Y+N +A + ++ + D+ ++ +  ++ 
Sbjct: 161 LKNKGNQYFKSKDNENAIKYYEYALR-LDQDPVFYSNISACYFAMNQLDKVIESSNKALE 219

Query: 165 IDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGD 202
           + P Y +   R   A  A G  +EAL  +  +L + G+
Sbjct: 220 LKPDYSKALLRRANAYEALGNNKEALYDF-SILSLFGE 256

>TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa]
           {ON} Anc_2.152 YHR117W
          Length = 610

 Score = 39.3 bits (90), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 35/65 (53%), Gaps = 1/65 (1%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSIS 164
           LK +GN       +E AI  Y  AI+ L  N I+Y+N +A + SL + +E +K    ++ 
Sbjct: 114 LKDKGNSLFKADKFEEAIKYYNWAIE-LKENPIFYSNLSACYVSLNKLEEIIKYCNKALE 172

Query: 165 IDPSY 169
           + P Y
Sbjct: 173 LKPDY 177

>KNAG0I02520 Chr9 complement(487699..488052) [354 bp, 117 aa] {ON}
           Anc_6.328 YCR060W
          Length = 117

 Score = 37.0 bits (84), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 31/59 (52%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSI 163
           +K QGN A  N ++  A   Y + I + P N I Y+NRA A   L+++ E +   +  +
Sbjct: 7   VKEQGNVAFRNSNFSSAAEYYGKCICLEPENPIGYSNRAMALIKLQKFSETIDTCQRGL 65

>KLLA0B09966g Chr2 complement(872760..873872) [1113 bp, 370 aa] {ON}
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155W CNS1 cyclophilin seven suppressor component of
           Hsp90p chaperone machinery
          Length = 370

 Score = 38.9 bits (89), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 57/130 (43%), Gaps = 13/130 (10%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIQV----LPTNAIYYANRAAAHSSLREYDEAVKDAE 160
            K QGN     K ++ A   Y +A+ V    L  N   Y N AA    ++ Y   +    
Sbjct: 73  FKNQGNDLYKGKRFKDARAMYLKALDVKCDVLSINESLYLNLAACELEIKNYRSCINYCR 132

Query: 161 SSISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDN---------ATEAMKRD 211
            ++ ++    + + R+G A    G+ E++LEA +  L ++ +N         ATE +KR 
Sbjct: 133 EALKLNAKNVKAFFRIGKAYLELGRFEDSLEAVQVGLAVDPENGALKSIQSKATEKLKRK 192

Query: 212 YESAKKKVEQ 221
            E   + + Q
Sbjct: 193 KELENRTLAQ 202

>ZYRO0B03828g Chr2 (318153..320336) [2184 bp, 727 aa] {ON} similar
           to uniprot|P38042 Saccharomyces cerevisiae YBL084C CDC27
           Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C) which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors including mitotic
           cyclins during the metaphase/anaphase transition
          Length = 727

 Score = 39.3 bits (90), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 43/96 (44%)

Query: 109 GNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPS 168
           GN     +D++ AI  + +A +V P  A  Y  +   HSS    D A      +I+ DP 
Sbjct: 516 GNLYSLQRDHDEAIRYFEKATEVDPHFAYGYTLQGHEHSSNDSIDMAKTCYRKAIASDPQ 575

Query: 169 YFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNA 204
           ++  Y  LG      G+ EEAL  ++K   I   N 
Sbjct: 576 HYNAYYGLGMCCMKLGQYEEALLYFEKARSINPVNV 611

>AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR155W
           (CNS1)
          Length = 379

 Score = 38.9 bits (89), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 40/159 (25%), Positives = 65/159 (40%), Gaps = 13/159 (8%)

Query: 58  SEFKGKSLADVLNSASKAS------ESNEKDDAQNVEVNIPXXXX---XXXXXXXXLKMQ 108
           SEF+GK+  +VL   ++        E  +    +NVE+                   K Q
Sbjct: 24  SEFQGKTTDEVLGELNRMPFFMTKLEPGDAASGENVELEALKALAYDGEPHEVAENFKNQ 83

Query: 109 GNKAMANKDYELAINKYTEAIQVLPTNA----IYYANRAAAHSSLREYDEAVKDAESSIS 164
           GN     K +  A   Y + I+V   +A    +   NRAA    L+ Y   + D   ++ 
Sbjct: 84  GNDLYKVKRFRDARVMYNKGIEVKCDDAGISELLLLNRAACELELKNYRRCINDCREALK 143

Query: 165 IDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDN 203
           ++P   + + R+G A     K EEA EA    L ++ +N
Sbjct: 144 LNPKNPKAFFRIGKAFLQLDKLEEAAEAVDFGLRVDTEN 182

>Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117W
           (REAL)
          Length = 644

 Score = 38.9 bits (89), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 48/98 (48%), Gaps = 1/98 (1%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSIS 164
           LK +GN     K +  AI  Y  AI++ P + ++Y+N +A + S  + D+ V+    ++ 
Sbjct: 134 LKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALE 193

Query: 165 IDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGD 202
           I P + +   R   A  + G   +A+     VL + GD
Sbjct: 194 IKPDHSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 230

>Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 38.5 bits (88), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 41/89 (46%), Gaps = 4/89 (4%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIQVLP----TNAIYYANRAAAHSSLREYDEAVKDAE 160
            K QGN+    K ++ A   Y + + V       N   +AN+AA    L+ Y   ++D  
Sbjct: 86  FKKQGNELYKAKRFKDARELYIKGLNVECEDKFINESLFANKAACELELKNYRRCIEDCS 145

Query: 161 SSISIDPSYFRGYSRLGFAKYAQGKPEEA 189
            ++SI+P   + Y R   A +   K EEA
Sbjct: 146 KALSINPKNTKCYYRTSKAFFQLNKLEEA 174

>YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON}
           TOM70Component of the TOM (translocase of outer
           membrane) complex responsible for recognition and
           initial import steps for all mitochondrially directed
           proteins; acts as a receptor for incoming precursor
           proteins
          Length = 617

 Score = 38.5 bits (88), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 51/98 (52%), Gaps = 2/98 (2%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSIS 164
           LK +GN+   NK Y+ AI  Y  A++ L  + ++Y+N +A + S+ +  + V+ +  ++ 
Sbjct: 102 LKDKGNQFFRNKKYDDAIKYYNWALE-LKEDPVFYSNLSACYVSVGDLKKVVEMSTKALE 160

Query: 165 IDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGD 202
           + P Y +   R   A    GK  +A+     VL + GD
Sbjct: 161 LKPDYSKVLLRRASANEGLGKFADAMFDL-SVLSLNGD 197

 Score = 30.8 bits (68), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 32/63 (50%)

Query: 123 NKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPSYFRGYSRLGFAKYA 182
           N + +A+++   N+  Y +R   +  L+ YD+A KD + +  +DP     Y +L    Y 
Sbjct: 384 NYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYR 443

Query: 183 QGK 185
           + K
Sbjct: 444 ENK 446

>KNAG0B01290 Chr2 (244938..246551) [1614 bp, 537 aa] {ON} Anc_3.395
           YPR088C gene spans a gap in the genome sequence
          Length = 537

 Score = 38.5 bits (88), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 33/63 (52%), Gaps = 21/63 (33%)

Query: 266 NPQLMQAAQ-KMMSNPGAMQNIQ--------------------KMMQDPSIRQMAEGFTS 304
           +PQ+MQ AQ ++  NPG M+N+                     KMMQDP ++QMA+ F +
Sbjct: 474 SPQMMQQAQQRLKQNPGMMKNMMDMFGGANGGAGGMPNMNDMMKMMQDPKMQQMAQQFGA 533

Query: 305 GGG 307
           G G
Sbjct: 534 GMG 536

>TBLA0F03220 Chr6 complement(782214..783824) [1611 bp, 536 aa] {ON}
           Anc_3.395 YPR088C
          Length = 536

 Score = 38.1 bits (87), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 35/63 (55%), Gaps = 7/63 (11%)

Query: 266 NPQLMQAAQ-KMMSNPGAMQNIQKMMQDPSIRQMAEGFTSGGGAPNLSD---LMNNPALR 321
           +PQ+MQ AQ ++  NPG M+N   MM          G  S GG PN++D   +M +P ++
Sbjct: 472 SPQMMQQAQQRLRQNPGMMEN---MMNMFGGAGGMPGMGSAGGMPNMNDMMKMMQDPKMQ 528

Query: 322 NMA 324
            MA
Sbjct: 529 EMA 531

>KNAG0A04120 Chr1 complement(556919..558727) [1809 bp, 602 aa] {ON}
           Anc_8.470 YDR244W
          Length = 602

 Score = 37.7 bits (86), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 28/118 (23%), Positives = 51/118 (43%), Gaps = 19/118 (16%)

Query: 114 ANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPSYFRGY 173
           AN D+   I+ +  A+QV P + + +    AA ++    +E++K    ++ + PS+ R  
Sbjct: 458 ANDDFNKTIDCFKTALQVNPNDELMWNRLGAALANSNRSEESIKAYHRALQLKPSFVRAR 517

Query: 174 SRLGFAKYAQGKPEEALEAYKKVL---DIEG----------------DNATEAMKRDY 212
             L  +    G  +EA+E     L   ++EG                DN  E +KR +
Sbjct: 518 YNLAVSSMNIGCYKEAVEHLLTALSMHEVEGLRQKDKDSHHYSNYNNDNILETLKRAF 575

>TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.328
           YCR060W
          Length = 120

 Score = 35.8 bits (81), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 31/63 (49%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISI 165
           K +GN+      Y++A   Y + + + P N I Y+N+A A   L  Y E V+     ++ 
Sbjct: 7   KEEGNRNFKEGSYKVAAELYQKCVDIEPENPIGYSNKAMALIKLGRYTEVVELCRKGLTF 66

Query: 166 DPS 168
            P+
Sbjct: 67  TPN 69

>Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 37.7 bits (86), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 38/65 (58%), Gaps = 1/65 (1%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSIS 164
           LK +GN+   NK Y+ AI  Y  A++ L  + ++Y+N +A + S+ +  + V+ +  ++ 
Sbjct: 102 LKDKGNQYFRNKKYDDAIKYYNWALE-LKEDPVFYSNLSACYVSVGDLKKVVEMSTKALE 160

Query: 165 IDPSY 169
           I P Y
Sbjct: 161 IKPDY 165

 Score = 34.3 bits (77), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 33/63 (52%)

Query: 123 NKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPSYFRGYSRLGFAKYA 182
           N + +A+++ P N+  Y +R   +  L+ YD+A KD + +  +DP     Y +L    Y 
Sbjct: 384 NYFDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYR 443

Query: 183 QGK 185
           + K
Sbjct: 444 ENK 446

>Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W
           (REAL)
          Length = 635

 Score = 37.7 bits (86), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 49/98 (50%), Gaps = 1/98 (1%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSIS 164
           LK +GN     K++  AI  Y  AI++ P + ++Y+N +A + S  + ++ ++    ++ 
Sbjct: 127 LKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALE 186

Query: 165 IDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGD 202
           I P + +   R   A  + G   +A+     VL + GD
Sbjct: 187 IKPDHSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 223

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/77 (24%), Positives = 38/77 (49%)

Query: 134 TNAIYYANRAAAHSSLREYDEAVKDAESSISIDPSYFRGYSRLGFAKYAQGKPEEALEAY 193
           T A+   N+     + + + EA+K  + +I +DP+    YS +     + G   + LE  
Sbjct: 122 TYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYT 181

Query: 194 KKVLDIEGDNATEAMKR 210
            K L+I+ D++   ++R
Sbjct: 182 TKALEIKPDHSKALLRR 198

>TDEL0A07430 Chr1 (1296631..1297005) [375 bp, 124 aa] {ON} Anc_6.328
           YCR060W
          Length = 124

 Score = 35.4 bits (80), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 31/61 (50%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSIS 164
           LK QGN     +DY  A+  Y + ++   TN I ++NRA     L    EA K  ++ ++
Sbjct: 7   LKAQGNSCYQQQDYAGALRWYDQCLEADATNPIAHSNRAMCLIKLNRSQEAQKACQAGLA 66

Query: 165 I 165
           +
Sbjct: 67  L 67

>YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}
           TOM71Mitochondrial outer membrane protein with
           similarity to Tom70p; probable minor component of the
           TOM (translocase of outer membrane) complex responsible
           for recognition and import of mitochondrially directed
           proteins
          Length = 639

 Score = 37.4 bits (85), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 48/98 (48%), Gaps = 1/98 (1%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSIS 164
           LK +GN     K++  AI  Y  AI++ P   ++Y+N +A + S  + ++ ++    ++ 
Sbjct: 130 LKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALE 189

Query: 165 IDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGD 202
           I P + +   R   A  + G   +A+     VL + GD
Sbjct: 190 IKPDHSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 226

>Ecym_4031 Chr4 complement(73900..75966) [2067 bp, 688 aa] {ON}
           similar to Ashbya gossypii ADR230W
          Length = 688

 Score = 37.4 bits (85), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 35/111 (31%), Positives = 49/111 (44%), Gaps = 19/111 (17%)

Query: 133 PTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPSYFRGYSRLG--FAKYAQGKPEEAL 190
           P   I   NRAA+   +    +A+ DA+  I +D    +GY R G    K AQ K  EAL
Sbjct: 67  PRYLILLDNRAASWERINNLGKALIDADRMIKVDAYNLKGYIRKGKILQKMAQDK--EAL 124

Query: 191 EAYKKVLDIEGDNATEAMKRDY-----------ESAKKKVEQSLNLEKAVP 230
             Y++ L      A EA +  +           E  K +V + LNL+K  P
Sbjct: 125 YVYREGL----SKAKEAYQLHFEKPPSKFVEIVEHQKNEVIKRLNLQKLTP 171

>Skud_2.24 Chr2 complement(50790..53099) [2310 bp, 769 aa] {ON}
           YBL084C (REAL)
          Length = 769

 Score = 37.4 bits (85), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 43/97 (44%)

Query: 109 GNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPS 168
           GN     KD++ AI  + +A Q+ P  A  Y  +   HSS    D A      +++ D  
Sbjct: 558 GNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYRKALACDSQ 617

Query: 169 YFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNAT 205
           ++  Y  LG +    G+ EEAL  ++K   I   N  
Sbjct: 618 HYNAYYGLGTSSMKLGQYEEALLYFEKARSINPVNVV 654

>KLLA0C08910g Chr3 complement(781726..782073) [348 bp, 115 aa] {ON}
           similar to uniprot|P25638 Saccharomyces cerevisiae
           YCR060W TAH1 HSP90 cofactor interacts with Hsp82p Pih1p
           Rvb1 and Rvb2 contains a single TPR domain with at least
           two TPR motifs
          Length = 115

 Score = 35.0 bits (79), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 28/51 (54%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEA 155
            K++GN A    ++  A+N Y +AI   PTN + Y+N A A   L  Y +A
Sbjct: 7   FKIKGNTAYKQNNFTDAVNFYKKAITYDPTNPVGYSNCAMALIKLNNYADA 57

>YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Component
           of the conserved R2TP complex (Rvb1-Rvb2-Tah1-Pih1);
           contains a single TPR domain with at least two TPR
           motifs; R2TP complex interacts with Hsp90 (Hsp82p and
           Hsc82p) to mediate assembly large protein complexes such
           as box C/D snoRNPs and RNA polymerase II
          Length = 111

 Score = 34.7 bits (78), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 29/58 (50%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSI 163
           K QGN       Y  A++ Y + I   P N + Y+N+A A   L EY +A++  +  +
Sbjct: 8   KEQGNSLFKQGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQMCQQGL 65

>SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 600

 Score = 37.0 bits (84), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSIS 164
           LK +GN+    K ++ AI  Y  A++ L  + ++Y+NR+A + S+ + ++ V+D  +++ 
Sbjct: 105 LKDKGNEFFKEKKFDDAIKYYNLALE-LKKDPVFYSNRSACYVSMGQLEKVVEDTTAALK 163

Query: 165 IDPSYFRGYSR 175
           +   Y +   R
Sbjct: 164 LKSDYSKCLLR 174

>Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 36.6 bits (83), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 38/65 (58%), Gaps = 1/65 (1%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSIS 164
           LK +GN+   NK Y+ AI  Y  A++ L  + ++Y+N +A + S+ +  + V+ +  ++ 
Sbjct: 102 LKDKGNQYFRNKKYDDAIKYYNWALE-LKEDPVFYSNLSACYVSVGDLKKVVEMSTKALE 160

Query: 165 IDPSY 169
           + P Y
Sbjct: 161 LKPDY 165

 Score = 30.4 bits (67), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 32/63 (50%)

Query: 123 NKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPSYFRGYSRLGFAKYA 182
           N + +A+++   N+  Y +R   +  L+ YD+A KD + +  +DP     Y +L    Y 
Sbjct: 384 NYFDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYR 443

Query: 183 QGK 185
           + K
Sbjct: 444 ENK 446

>Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 36.6 bits (83), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 38/65 (58%), Gaps = 1/65 (1%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSIS 164
           LK +GN+   NK Y+ AI  Y  A++ L  + ++Y+N +A + S+ +  + V+ +  ++ 
Sbjct: 102 LKDKGNQFFRNKKYDDAIKYYNWALE-LKDDPVFYSNLSACYVSVGDLKKVVEMSTKALE 160

Query: 165 IDPSY 169
           + P Y
Sbjct: 161 LKPDY 165

 Score = 31.2 bits (69), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 32/63 (50%)

Query: 123 NKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPSYFRGYSRLGFAKYA 182
           N + +A+++   N+  Y +R   +  L+ YD+A KD + +  +DP     Y +L    Y 
Sbjct: 384 NYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYR 443

Query: 183 QGK 185
           + K
Sbjct: 444 ENK 446

>NCAS0E02490 Chr5 complement(493779..496208) [2430 bp, 809 aa] {ON}
           Anc_7.412 YBL084C
          Length = 809

 Score = 36.6 bits (83), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 43/96 (44%)

Query: 109 GNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPS 168
           GN     KD++ AI  + +A ++ P     Y  +   + S+  YD A      +IS D  
Sbjct: 597 GNLFSLQKDHDEAIRAFDKATKLDPNFVYAYTLQGHEYLSMDSYDTAKTFYRKAISNDLH 656

Query: 169 YFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNA 204
           ++  Y  +G      G+ E+AL  ++K   I   NA
Sbjct: 657 HYNAYYGMGMCSMKLGEYEQALVYFEKARSINPSNA 692

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 49/98 (50%), Gaps = 3/98 (3%)

Query: 119 ELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPSYFRGYSRLGF 178
           E A+N Y  A Q+ PT+++    RA    S+ +Y +A+   E  I I P        LG 
Sbjct: 709 EKALNYYELACQIQPTSSLAKFKRAHLLYSMAKYTQALDAFEELIKIAPEEATVQFILGQ 768

Query: 179 AKYAQGKPEEALEAYKKV--LDIEGDN-ATEAMKRDYE 213
                G+ ++A++ Y     LD +G N  ++A+K+ +E
Sbjct: 769 LYQIMGRKKDAIKRYTIAMNLDPKGSNLISDALKKCHE 806

>KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.152
           YHR117W
          Length = 614

 Score = 36.6 bits (83), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 37/65 (56%), Gaps = 1/65 (1%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSIS 164
           LK +GN+    K  E AI  Y  A++    + ++YAN +A + SL ++++ +++   ++ 
Sbjct: 109 LKDKGNELFKEKAVEEAIKYYQWALE-FKKDPVFYANISACYVSLNDFEKVLENCNKALE 167

Query: 165 IDPSY 169
           + P Y
Sbjct: 168 LKPDY 172

>CAGL0J09570g Chr10 complement(941571..943220) [1650 bp, 549 aa]
           {ON} some similarities with uniprot|P35056 Saccharomyces
           cerevisiae YDR244w PAS10 peroxisomal targeting signal
           receptor
          Length = 549

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 31/145 (21%), Positives = 64/145 (44%), Gaps = 7/145 (4%)

Query: 59  EFKGKSLADVLNSASKASESNEKDDAQNVEVNIPXXXXXXXXXXXXLKMQG--NKAMANK 116
           E KG +++   N   + S  N ++  +NV ++IP            L +    N  +   
Sbjct: 351 ELKGVTIS---NWPQELSILNVRETMENVLLDIPSTAINITRDKDILTVLALFNYLLGRS 407

Query: 117 DYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPSYFRGYSRL 176
           D   AI  + + ++  P + I + +  A  ++ + YD A++   ++I + PS+ R    L
Sbjct: 408 DN--AIKCFEKLLEQDPKDEITWNHLGATLANSKRYDTAIQVYMNTIELKPSFVRARYNL 465

Query: 177 GFAKYAQGKPEEALEAYKKVLDIEG 201
           G      G+ +  +E+    L ++G
Sbjct: 466 GSTLVKNGELQRGIESLLTALVMQG 490

>Suva_16.417 Chr16 complement(718714..720333) [1620 bp, 539 aa] {ON}
           YPR088C (REAL)
          Length = 539

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 31/64 (48%), Gaps = 24/64 (37%)

Query: 266 NPQLMQAAQ-KMMSNPGAMQN-----------------------IQKMMQDPSIRQMAEG 301
           +PQ+MQ AQ K+  NPG MQN                       + KMMQDP +++MA+ 
Sbjct: 476 SPQMMQQAQQKLKQNPGLMQNMMSMFGGSGMGGGMGGGMPDMNEMMKMMQDPQMQEMAKQ 535

Query: 302 FTSG 305
           F  G
Sbjct: 536 FGMG 539

>NCAS0D04500 Chr4 (855490..855855) [366 bp, 121 aa] {ON} Anc_6.328
           YCR060W
          Length = 121

 Score = 33.5 bits (75), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 32/66 (48%), Gaps = 2/66 (3%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSI-- 163
           K +GN+     DY  A   Y   I   PTN I Y+N+A +      +D+A++   + +  
Sbjct: 7   KTEGNRLFKLGDYTAANKFYDLCIMEEPTNPIGYSNKAMSLIKQEHFDQAIRTCNTGLLY 66

Query: 164 SIDPSY 169
           S DP +
Sbjct: 67  SSDPEH 72

>KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.328
           YCR060W
          Length = 121

 Score = 33.5 bits (75), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 30/59 (50%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSI 163
            K +GN+     +Y  AI  Y + I++ P N I Y+N+A A     +  EAV+  +  +
Sbjct: 6   FKTEGNQYFKEGNYASAIKSYEKCIEINPENPIGYSNKAMALIKANKNQEAVRTCQDGL 64

>KLLA0C15455g Chr3 (1341570..1343270) [1701 bp, 566 aa] {ON} similar
           to uniprot|P35056 Saccharomyces cerevisiae YDR244W PEX5
           Essential for import of proteins with SKL- like import
           signal into peroxisomal matrix 69-kDa protein containing
           tetratricopeptide repeat (TPR)
          Length = 566

 Score = 34.7 bits (78), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 27/135 (20%), Positives = 60/135 (44%), Gaps = 17/135 (12%)

Query: 109 GNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPS 168
           G    AN+++   I+ +  A++V P + + +    A+ ++    +EA++    ++++ PS
Sbjct: 423 GTLFYANEEFGKTIDCFRTALEVNPNDELMWNRLGASLANSNRSEEAIQAYHKALALKPS 482

Query: 169 YFRGYSRLGFAKYAQGKPEEALEAYKKVLD-------------IEGDNATEAMKRDYESA 215
           + R    L  +    G  +EA E+    L              ++ +N  E +KR + + 
Sbjct: 483 FVRARYNLAISSMNIGCYKEAAESLLSALSMHEVENVPITGSVVQSNNILETLKRSFVAM 542

Query: 216 KKKVEQSLNLEKAVP 230
            ++      LEK +P
Sbjct: 543 DRRDL----LEKVMP 553

>KLLA0E08009g Chr5 (720700..722865) [2166 bp, 721 aa] {ON} similar
           to uniprot|P09798 Saccharomyces cerevisiae YKL022C CDC16
           Subunit of the anaphase-promoting complex/cyclosome
           (APC/C) which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors including mitotic
           cyclins during the metaphase/anaphase transition
           required for sporulation
          Length = 721

 Score = 34.7 bits (78), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 34/64 (53%), Gaps = 4/64 (6%)

Query: 132 LPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPSYFRGYSRLGFAK--YAQGKPEEA 189
            P + + +   A  +  + +  EA K    S  +DPS+  GYS LGFA    A+G+ E+A
Sbjct: 428 FPKSPVTWFAVATYYLCMGKVSEARKYFSRSSIMDPSF--GYSWLGFAHTYVAEGEHEQA 485

Query: 190 LEAY 193
           L AY
Sbjct: 486 LSAY 489

>SAKL0E14542g Chr5 (1199439..1201511) [2073 bp, 690 aa] {ON} weakly
           similar to uniprot|Q7LGN4 Saccharomyces cerevisiae
           YOR080W DIA2 Protein of unknown function involved in
           invasive and pseudohyphal growth
          Length = 690

 Score = 34.7 bits (78), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 29/53 (54%)

Query: 141 NRAAAHSSLREYDEAVKDAESSISIDPSYFRGYSRLGFAKYAQGKPEEALEAY 193
           NRAA+   L + D+A+KDA++ I ++P   + Y R G       K +EA   Y
Sbjct: 76  NRAASWEKLGKLDKALKDAKNMIRVEPHNLKCYIRCGKILQKLNKDKEAYSNY 128

>Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {ON}
           complement(67975..69768) [1794 nt, 598 aa]
          Length = 597

 Score = 34.7 bits (78), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 38/71 (53%), Gaps = 1/71 (1%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSIS 164
           LK +GN+    + YE A+  Y  A+  L  + ++Y+N +A + SL   ++ V+ +  ++ 
Sbjct: 102 LKDKGNQFFKEQKYEDALKYYNYALD-LKQDPVFYSNISACYVSLGNLEKVVESSTKALE 160

Query: 165 IDPSYFRGYSR 175
           + P Y +   R
Sbjct: 161 LKPDYSKALLR 171

 Score = 30.8 bits (68), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 53/117 (45%), Gaps = 20/117 (17%)

Query: 125 YTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPSYFRGYSRLGFAKYAQG 184
           + +A+ V P +A  Y +R   H   ++Y++A  D E +   D S    Y +L    Y +G
Sbjct: 366 FDKALDVDPNSAPVYYHRGQMHFLSQQYEKAAADFEKAKESDSSNIFPYIQLACLTYHEG 425

Query: 185 KPE-----------------EALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLN 224
           K +                 E    Y +VL  +GD   +A  + Y+ A K++E+SL+
Sbjct: 426 KFDDCETLFSEAKRKFPTAPEVPNFYAEVLTDKGD--FDAASKQYDIA-KRLEESLD 479

>TPHA0L01210 Chr12 (252106..253872) [1767 bp, 588 aa] {ON} Anc_8.470
           YDR244W
          Length = 588

 Score = 34.7 bits (78), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 17/64 (26%), Positives = 35/64 (54%), Gaps = 8/64 (12%)

Query: 137 IYYANRAAAHSSLREYDEAVKDAESSISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKV 196
           ++Y+N         E+D+ +   ++++ I P     ++RLG +     +PEEA++AY K 
Sbjct: 440 LFYSNN--------EFDKTIDCFKTALVIHPEDELMWNRLGASLANSSRPEEAIQAYHKA 491

Query: 197 LDIE 200
           L ++
Sbjct: 492 LQLK 495

>KLTH0E11748g Chr5 (1043203..1044339) [1137 bp, 378 aa] {ON} similar
           to uniprot|P33313 Saccharomyces cerevisiae YBR155W CNS1
           cyclophilin seven suppressor component of Hsp90p
           chaperone machinery
          Length = 378

 Score = 34.3 bits (77), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 43/174 (24%), Positives = 71/174 (40%), Gaps = 14/174 (8%)

Query: 58  SEFKGKSLADVLNSASKASESNEKDDA------QNVEVNIPXXXXXX---XXXXXXLKMQ 108
           SEF+ KS  DV+   ++      K D       QNVE+                   K Q
Sbjct: 25  SEFQNKSTDDVMEELNRMPFFMSKLDGTDGEGGQNVELEALKALAYEGEPHEVAENFKNQ 84

Query: 109 GNKAMANKDYELAINKYTEAIQVL----PTNAIYYANRAAAHSSLREYDEAVKDAESSIS 164
           GN     K Y+ A   Y   I +       N   ++NRAA    L+ Y   V D + ++ 
Sbjct: 85  GNDLYRAKRYKDAREIYNRGIDIKCDDSKVNESLFSNRAACELELKNYRRCVNDCKRALQ 144

Query: 165 IDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDN-ATEAMKRDYESAKK 217
            +    + Y R+  A     K E+A +A +  L ++ +N A  A++++ +  K+
Sbjct: 145 YNVKNIKCYYRIAKAFLLLNKLEDAKQAAEFGLKLDPENQALNALRQNVDKKKQ 198

>NDAI0C04320 Chr3 complement(983914..986034) [2121 bp, 706 aa] {ON}
           Anc_5.352 YDR320C
          Length = 706

 Score = 34.3 bits (77), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 36/67 (53%), Gaps = 4/67 (5%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIQVLP----TNAIYYANRAAAHSSLREYDEAVKDAE 160
            K +G++   N DY  A+ +Y +++  LP       I Y+N  A    + EY ++++D +
Sbjct: 417 FKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIEDCK 476

Query: 161 SSISIDP 167
            ++S+ P
Sbjct: 477 IALSLFP 483

>NDAI0A08170 Chr1 complement(1870449..1872068) [1620 bp, 539 aa]
           {ON} Anc_3.395 YPR088C
          Length = 539

 Score = 34.3 bits (77), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 31/67 (46%), Gaps = 26/67 (38%)

Query: 266 NPQLMQAAQKMMS-NPGAMQNIQ-------------------------KMMQDPSIRQMA 299
            PQLMQ AQ+ +S NP  M+N+                          KMMQDP +++MA
Sbjct: 472 TPQLMQQAQQKLSQNPNLMKNMMNMFGGAGGMPGMGGAGGMPDMNEMMKMMQDPGMQEMA 531

Query: 300 EGFTSGG 306
           + F  GG
Sbjct: 532 KQFGMGG 538

>Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {ON}
           complement(123535..123888) [354 nt, 118 aa]
          Length = 117

 Score = 32.3 bits (72), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 28/54 (51%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDA 159
           K  GN    + +Y  A+  Y + I+V P N I Y+N A +   L +Y EA++  
Sbjct: 7   KTTGNTYFKDGNYLKAVEYYKKCIEVEPENPIGYSNSAMSLIKLTKYTEALESC 60

>TDEL0C02720 Chr3 (477529..479631) [2103 bp, 700 aa] {ON} Anc_7.412
           YBL084C
          Length = 700

 Score = 34.3 bits (77), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 43/96 (44%)

Query: 109 GNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPS 168
           GN     +D+E AI  + +A ++    A  Y  +   HSS    D A      +++ DP 
Sbjct: 489 GNLYSLQRDHEDAIKYFEKATKIDYNFAYAYTLQGHEHSSNDSIDTAKNCYRRALACDPQ 548

Query: 169 YFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNA 204
           ++  Y  LG      G+ ++AL  ++K  +I   N 
Sbjct: 549 HYNAYYGLGMCYMKLGQYDKALLFFEKARNINPVNV 584

>AGL294W Chr7 (154711..156681) [1971 bp, 656 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBL084C (CDC27)
          Length = 656

 Score = 33.9 bits (76), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 46/96 (47%)

Query: 109 GNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPS 168
           GN    N+D++ AI    +A  + P  A  Y  +   +S+   +D A      +++I+P+
Sbjct: 445 GNLFSLNRDHDEAIKALKKATSLNPQFAYAYTLQGHEYSNNDAFDNAKMCYRKALAINPN 504

Query: 169 YFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNA 204
           ++  +  LG +    G+ +EAL  ++K   I   N 
Sbjct: 505 HYNAHYGLGMSCIKLGQYDEALLHFEKARSINPVNV 540

 Score = 31.2 bits (69), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 26/106 (24%), Positives = 53/106 (50%), Gaps = 4/106 (3%)

Query: 107 MQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLR--EYDEAVKDAESSIS 164
           +QG++   N  ++ A   Y +A+ + P +  Y A+     S ++  +YDEA+   E + S
Sbjct: 477 LQGHEYSNNDAFDNAKMCYRKALAINPNH--YNAHYGLGMSCIKLGQYDEALLHFEKARS 534

Query: 165 IDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNATEAMKR 210
           I+P         G A    G+ E+AL+ Y+   +++ +++    K+
Sbjct: 535 INPVNVILNCCCGVALERLGRREKALDFYQLACELQPNSSLALFKK 580

>TPHA0G00430 Chr7 complement(77860..80046) [2187 bp, 728 aa] {ON}
           Anc_5.689 YOR080W
          Length = 728

 Score = 33.9 bits (76), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 30/56 (53%)

Query: 139 YANRAAAHSSLREYDEAVKDAESSISIDPSYFRGYSRLGFAKYAQGKPEEALEAYK 194
           Y N +A +  L+  D+A   ++  I++DP   +GY  +G     Q K + A +AYK
Sbjct: 75  YGNLSATYDKLQNLDKASDCSQRMINVDPYNLKGYIMMGKILQKQNKDKLAYKAYK 130

>Smik_3.159 Chr3 (222475..222822) [348 bp, 115 aa] {ON} YCR060W
           (REAL)
          Length = 115

 Score = 32.0 bits (71), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 26/55 (47%)

Query: 109 GNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSI 163
           GN       Y  A++ Y + I   P N + Y+N+A A   L EY  A++  +  +
Sbjct: 15  GNALFKQGLYREAVDSYDQLITAQPQNPVGYSNKAMALIKLAEYTHAIQTCQEGL 69

>CAGL0K11209g Chr11 (1089300..1091072) [1773 bp, 590 aa] {ON}
           similar to uniprot|P35056 Saccharomyces cerevisiae
           YDR244w PAS10 peroxisomal targeting signal receptor
          Length = 590

 Score = 33.5 bits (75), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 21/92 (22%), Positives = 45/92 (48%), Gaps = 3/92 (3%)

Query: 114 ANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPSYFRGY 173
           AN +++  I+ +  A++V P + + +    A+ ++    +EA++    ++ + PS+ R  
Sbjct: 436 ANDEFDRTIDCFQAALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVRAR 495

Query: 174 SRLGFAKYAQGKPEEALEAYKKVL---DIEGD 202
             L  +    G  +EA E     L   D+EG+
Sbjct: 496 YNLAVSSMNIGCYKEAAEHLLTALSMHDVEGE 527

>NDAI0I00440 Chr9 complement(89650..90036) [387 bp, 128 aa] {ON}
           Anc_6.328 YCR060W
          Length = 128

 Score = 32.0 bits (71), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 22/39 (56%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRA 143
           LK +GN      DY  A   Y + I++ PTN I Y+N+A
Sbjct: 6   LKQEGNTFFQKGDYAQANGYYDQCIKLEPTNPIGYSNKA 44

>NCAS0B02560 Chr2 complement(427447..429183) [1737 bp, 578 aa] {ON}
           Anc_8.470
          Length = 578

 Score = 33.5 bits (75), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 33/50 (66%)

Query: 151 EYDEAVKDAESSISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIE 200
           ++D+ ++  + S+ I+P+    ++RLG +     KPE+A++AY + L+++
Sbjct: 446 DFDKTIECFKESLKINPNDEVMWNRLGASLANSNKPEDAIQAYHRALNLK 495

>Kpol_1006.4 s1006 complement(17836..20034) [2199 bp, 732 aa] {ON}
           complement(17836..20034) [2199 nt, 733 aa]
          Length = 732

 Score = 33.5 bits (75), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 22/97 (22%), Positives = 43/97 (44%), Gaps = 1/97 (1%)

Query: 109 GNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPS 168
           G   M   DY  A   + +A+     N I++ +    +  + +Y +A+     +I ++P 
Sbjct: 293 GRIHMIRSDYNAAYEAFQQAVNRDARNPIFWCSIGVLYYQIYQYRDALDAYTRAIRLNPY 352

Query: 169 YFRGYSRLG-FAKYAQGKPEEALEAYKKVLDIEGDNA 204
               +  LG   +    +  +AL+AYK+   +E DN 
Sbjct: 353 ISEVWYDLGTLYETCNNQLTDALDAYKQAARLEPDNT 389

>TBLA0H01970 Chr8 (464239..466761) [2523 bp, 840 aa] {ON} Anc_5.352
           YDR320C
          Length = 840

 Score = 33.5 bits (75), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 18/76 (23%), Positives = 39/76 (51%), Gaps = 4/76 (5%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIQVLP----TNAIYYANRAAAHSSLREYDEAVKDAE 160
            +  G +     DY+ A+++Y +++  LP       I Y+N  AA   + EY ++VKD +
Sbjct: 549 FRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDCD 608

Query: 161 SSISIDPSYFRGYSRL 176
            ++ + P   + +++ 
Sbjct: 609 VALELFPKNDKQWTQF 624

>Kwal_27.11737 s27 (926622..928349) [1728 bp, 575 aa] {ON} YDR244W
           (PEX5) - 1:1 [contig 27] FULL
          Length = 575

 Score = 33.5 bits (75), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 23/117 (19%), Positives = 53/117 (45%), Gaps = 12/117 (10%)

Query: 114 ANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPSYFRGY 173
           +N DY+  ++ +  A+ V P + + +    A+ ++    +EA++    ++ + P++ R  
Sbjct: 438 SNDDYDKTVDCFRAALAVRPDDELMWNRLGASLANSNRSEEAIQAYRKALQLKPTFVRAR 497

Query: 174 SRLGFAKYAQGKPEEALEAYKKVL---DIEG---------DNATEAMKRDYESAKKK 218
             L  +    G  +EA E     L   ++EG         +N  E +KR +   +++
Sbjct: 498 CNLAVSCMNMGCYKEAAEYLLTALSMHEVEGILPSETPASNNLIETLKRAFIGMERR 554

>CAGL0K07986g Chr11 complement(792641..794239) [1599 bp, 532 aa]
           {ON} highly similar to uniprot|P20424 Saccharomyces
           cerevisiae YPR088c
          Length = 532

 Score = 33.5 bits (75), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 28/66 (42%), Gaps = 26/66 (39%)

Query: 266 NPQLMQAAQ-KMMSNPGAMQN-------------------------IQKMMQDPSIRQMA 299
            PQLMQ AQ K+  NPG M+N                         + KMMQDP ++ MA
Sbjct: 466 TPQLMQQAQQKLRQNPGLMKNMMNMFGGAGGMGGMGGPGGMPDMNEMMKMMQDPQMQDMA 525

Query: 300 EGFTSG 305
             F  G
Sbjct: 526 RQFGMG 531

>SAKL0H11946g Chr8 complement(1020512..1022233) [1722 bp, 573 aa]
           {ON} similar to uniprot|P35056 Saccharomyces cerevisiae
           YDR244W PEX5 Essential for import of proteins with SKL-
           like import signal into peroxisomal matrix 69-kDa
           protein containing tetratricopeptide repeat (TPR)
          Length = 573

 Score = 33.1 bits (74), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 26/119 (21%), Positives = 54/119 (45%), Gaps = 14/119 (11%)

Query: 114 ANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPSYFRGY 173
           AN+DY+  I+ +  A+ V P + + +    A+ ++    +EA++    ++ + PS+ R  
Sbjct: 434 ANEDYDKTIDCFKAALTVKPDDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVRAR 493

Query: 174 SRLGFAKYAQGKPEEALEAYKKVL---DIEG-----------DNATEAMKRDYESAKKK 218
             L  +    G  +EA E     L   ++EG            N  E +KR + + +++
Sbjct: 494 YNLAVSSMNIGCYKEAAEYLLTALSMHEVEGVPVASGGSIPSTNILETLKRAFIAMERR 552

>AFR453W Chr6 (1251460..1253169) [1710 bp, 569 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR244W (PEX5)
          Length = 569

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 29/132 (21%), Positives = 56/132 (42%), Gaps = 19/132 (14%)

Query: 114 ANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPSYFRGY 173
           AN+D++  I+ +  A+ V P +   +    A+ ++    +EA++    +I + P++ R  
Sbjct: 429 ANEDFDKTIDCFRAALAVRPDDECMWNRLGASLANSNRSEEAIQAYHRAIQLKPTFVRAR 488

Query: 174 SRLGFAKYAQGKPEEALEAYKKVL---DIEG------------DNATEAMKRDYESAKKK 218
             L  +    G   EA E     L   ++EG             N  E +KR + +  ++
Sbjct: 489 YNLAVSSMNIGCYREAAEHLLTALSMHEVEGVAMAPGSGNVPSSNILETLKRAFIAMDRR 548

Query: 219 VEQSLNLEKAVP 230
                 LE+ VP
Sbjct: 549 DL----LERVVP 556

>NDAI0C05130 Chr3 (1193350..1195122) [1773 bp, 590 aa] {ON}
           Anc_8.470
          Length = 590

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 23/101 (22%), Positives = 49/101 (48%), Gaps = 4/101 (3%)

Query: 114 ANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPSYFRGY 173
           +N D++  +  +  A+++ P + + +    A+ ++    +EA+K    +I++ PS+ R  
Sbjct: 453 SNDDFDKTLECFQNALKINPNDELMWNRLGASLANSNRSEEAIKAYHKAINLKPSFVRAR 512

Query: 174 SRLGFAKYAQGKPEEA---LEAYKKVLDIEGDNATEAMKRD 211
             L  A    G  +EA   L    K+  + G + T ++K D
Sbjct: 513 YNLAVASMNIGCYQEAAGHLLTVLKMHQVHGQDNT-SVKTD 552

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 14/55 (25%), Positives = 35/55 (63%)

Query: 146 HSSLREYDEAVKDAESSISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIE 200
           H S  ++D+ ++  ++++ I+P+    ++RLG +     + EEA++AY K ++++
Sbjct: 451 HYSNDDFDKTLECFQNALKINPNDELMWNRLGASLANSNRSEEAIKAYHKAINLK 505

>NCAS0A14770 Chr1 complement(2911657..2912559) [903 bp, 300 aa] {ON}
           Anc_7.458 YJR088C
          Length = 300

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 42/89 (47%), Gaps = 16/89 (17%)

Query: 107 MQGNKAMANKDYELAINKYTEAIQVLPTNAI---------YYANRAAAHSS-----LRE- 151
           M G   M  KD++ AI  + E + ++P N +         YY  ++ +HSS     LR+ 
Sbjct: 169 MLGEIYMNLKDFDRAIYCFEEILCIMPFNYVAFAQLAESLYYKAKSMSHSSKAKVELRKE 228

Query: 152 -YDEAVKDAESSISIDPSYFRGYSRLGFA 179
              +++ +A  SI +   Y +G+S +   
Sbjct: 229 IVQKSMNNALRSIELSGLYLKGWSMVAIT 257

>Ecym_7142 Chr7 complement(287110..289137) [2028 bp, 675 aa] {ON}
           similar to Ashbya gossypii AGL294W
          Length = 675

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 46/96 (47%)

Query: 109 GNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPS 168
           GN    N+D++ AI    +A  + P  A  Y  +   +S+   +D A      +++I+P+
Sbjct: 464 GNLFSLNRDHDEAIKALKKATNLDPRFAYAYTLQGHEYSNNDAFDNAKMCYRKALAINPN 523

Query: 169 YFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNA 204
           ++  +  LG +    G+ +EAL  ++K   I   N 
Sbjct: 524 HYNAHYGLGMSCIKLGQYDEALLHFEKARSINPVNV 559

 Score = 30.4 bits (67), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 26/106 (24%), Positives = 53/106 (50%), Gaps = 4/106 (3%)

Query: 107 MQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLR--EYDEAVKDAESSIS 164
           +QG++   N  ++ A   Y +A+ + P +  Y A+     S ++  +YDEA+   E + S
Sbjct: 496 LQGHEYSNNDAFDNAKMCYRKALAINPNH--YNAHYGLGMSCIKLGQYDEALLHFEKARS 553

Query: 165 IDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNATEAMKR 210
           I+P         G A    G+ E+AL+ Y+   +++ +++    K+
Sbjct: 554 INPVNVILNCCCGVALERLGRREKALDFYQLACELQPNSSLALFKK 599

>TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {ON}
           Anc_2.152 YHR117W
          Length = 603

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 38/71 (53%), Gaps = 1/71 (1%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSIS 164
           LK +GN     +D+E A+  Y  A+  L  + ++Y+N +A + SL + ++ V+ +  ++ 
Sbjct: 108 LKDKGNDYFKKQDFENALKYYNYAL-TLKQDPVFYSNISACYVSLGQLEKVVESSTEALK 166

Query: 165 IDPSYFRGYSR 175
           +   Y +   R
Sbjct: 167 LKHDYSKALLR 177

>Skud_3.135 Chr3 (208664..209020) [357 bp, 118 aa] {ON} YCR060W
           (REAL)
          Length = 118

 Score = 31.2 bits (69), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 28/58 (48%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSI 163
           K QGN       Y  A++ Y   I   P N + Y+N+A A   L E+ +A++  +  +
Sbjct: 12  KQQGNALFKQGLYLEAVDSYDRLIAAQPQNPVGYSNKAMALIKLGEHAQAIQACQQGL 69

>YBR111C Chr2 complement(461178..461873) [696 bp, 231 aa] {ON}
           YSA1Nudix hydrolase family member with ADP-ribose
           pyrophosphatase activity; shown to metabolize
           O-acetyl-ADP-ribose to AMP and acetylated ribose
           5'-phosphate
          Length = 231

 Score = 32.0 bits (71), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 21/41 (51%), Gaps = 5/41 (12%)

Query: 150 REYDEAVKDAESSISIDPSYFRGYSRLGFAKYAQGKPEEAL 190
           RE+D AV+   SS  +D     G   L   KY  GKP+E L
Sbjct: 62  REWDSAVRTTRSSGGVD-----GIGILTILKYKDGKPDEIL 97

>YKL022C Chr11 complement(394726..397248) [2523 bp, 840 aa] {ON}
           CDC16Subunit of the anaphase-promoting complex/cyclosome
           (APC/C), which is a ubiquitin-protein ligase required
           for degradation of anaphase inhibitors, including
           mitotic cyclins, during the metaphase/anaphase
           transition; required for sporulation
          Length = 840

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 36/66 (54%), Gaps = 4/66 (6%)

Query: 130 QVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPSYFRGYSRLGFAK-YA-QGKPE 187
           +  P +AI + + A  + SL    EA K    S  +DPS+   +  LGFA  YA +G+ +
Sbjct: 525 ETFPKSAITWFSVATYYMSLDRISEAQKYYSKSSILDPSFAAAW--LGFAHTYALEGEQD 582

Query: 188 EALEAY 193
           +AL AY
Sbjct: 583 QALTAY 588

>NCAS0F02870 Chr6 complement(573068..575170) [2103 bp, 700 aa] {ON}
           Anc_5.352 YDR320C
          Length = 700

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 36/67 (53%), Gaps = 4/67 (5%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIQVLPTN----AIYYANRAAAHSSLREYDEAVKDAE 160
            + +G +   N DY  +  +Y +++  LP N     I Y+N  A+   + EY +++K++ 
Sbjct: 406 FRNRGTQYFKNGDYVSSFQEYEKSLNTLPVNHPLRIIAYSNIIASELKIGEYSKSLKNSS 465

Query: 161 SSISIDP 167
           S++ + P
Sbjct: 466 SALEMFP 472

>SAKL0F12936g Chr6 (1016829..1018727) [1899 bp, 632 aa] {ON} similar
           to uniprot|Q751K0 Ashbya gossypii AGL294W AGL294Wp and
           some similarites with YBL084C uniprot|P38042
           Saccharomyces cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 632

 Score = 32.0 bits (71), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 42/96 (43%)

Query: 109 GNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPS 168
           GN    NKD++ AI  + +A Q+ P     Y  +   +SS   +D A      +++ +  
Sbjct: 421 GNMFSLNKDHDEAIKSFQKATQLDPRFTYAYTLQGHEYSSNDAFDTAKTCYRKALATNSQ 480

Query: 169 YFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNA 204
           ++     LG      G+ EE+L  ++K   I   N 
Sbjct: 481 HYNASYGLGMCCLKLGQYEESLLHFQKAHSINPVNV 516

>Suva_11.204 Chr11 complement(378512..380893) [2382 bp, 793 aa] {ON}
           YKL022C (REAL)
          Length = 793

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 35/64 (54%), Gaps = 4/64 (6%)

Query: 132 LPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPSYFRGYSRLGFAK-YA-QGKPEEA 189
            P +AI + + A  + SL    EA K    S  +DPS+   +  LGFA  YA +G+ ++A
Sbjct: 476 FPKSAITWFSVATYYMSLDRISEAQKYYSKSSILDPSFAAAW--LGFAHTYALEGEQDQA 533

Query: 190 LEAY 193
           L AY
Sbjct: 534 LTAY 537

>AAR054C Chr1 complement(440706..441107) [402 bp, 133 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCR060W
          Length = 133

 Score = 30.4 bits (67), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 16/61 (26%), Positives = 32/61 (52%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSIS 164
           L+ +GN   +  +YE A+  Y  A    P+N ++ AN + A   L  +++A+   + ++ 
Sbjct: 11  LRSKGNDLYSKGEYETAVLYYKNASLAEPSNPVHLANMSMALLKLERWEDALSACDRALE 70

Query: 165 I 165
           I
Sbjct: 71  I 71

>KLTH0E10934g Chr5 (981831..983537) [1707 bp, 568 aa] {ON} similar
           to uniprot|P35056 Saccharomyces cerevisiae YDR244W PEX5
           Essential for import of proteins with SKL- like import
           signal into peroxisomal matrix 69-kDa protein containing
           tetratricopeptide repeat (TPR)
          Length = 568

 Score = 31.6 bits (70), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 23/117 (19%), Positives = 52/117 (44%), Gaps = 12/117 (10%)

Query: 114 ANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPSYFRGY 173
           +N DY+  ++ +  A+ V P + + +    A+ ++    +EA++    ++ + P++ R  
Sbjct: 431 SNDDYDKTVDCFRAALAVKPDDELMWNRLGASLANSNRSEEAIQAYRKALQLKPTFVRAR 490

Query: 174 SRLGFAKYAQGKPEEALEAYKKVL---DIEG---------DNATEAMKRDYESAKKK 218
             L  +    G  +EA E     L   ++EG          N  E +KR +   +++
Sbjct: 491 CNLAVSCMNMGCFKEAAEYLLTALSMHEVEGILPSETPASSNLIETLKRAFIGMERR 547

>KAFR0C01850 Chr3 (369596..371536) [1941 bp, 646 aa] {ON} Anc_5.352
           YDR320C
          Length = 646

 Score = 31.6 bits (70), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 33/64 (51%), Gaps = 4/64 (6%)

Query: 108 QGNKAMANKDYELAINKYTEAIQVLPTN----AIYYANRAAAHSSLREYDEAVKDAESSI 163
           +G+    N DY  A+ +Y +++  LP +     I Y+N  AA   + EY   VK A+ ++
Sbjct: 363 RGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSNLVKKADKAL 422

Query: 164 SIDP 167
            + P
Sbjct: 423 KLFP 426

>CAGL0H07095g Chr8 (700262..702247) [1986 bp, 661 aa] {ON} similar
           to uniprot|Q06677 Saccharomyces cerevisiae YDR320c SWA2
          Length = 661

 Score = 31.6 bits (70), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 28/113 (24%), Positives = 50/113 (44%), Gaps = 20/113 (17%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIQVL----PTNAIYYANRAAAHSSLREYDEAVKDAE 160
            K +G     N DY  A+ +Y +++  L    P   I Y+N  A+   + ++ ++V DA+
Sbjct: 365 FKARGTDYFKNGDYASAVEEYEKSLNTLPMKHPLRIIAYSNIIASRIKIGQHSQSVVDAQ 424

Query: 161 SSISIDPSY-------------FRGYSRLGFAKYA--QGKPEEALEAYKKVLD 198
            ++ + P                R Y+ + + K    Q +  EA+E YK  LD
Sbjct: 425 EAMKLLPEEKSLWTAAIQNSDPVRSYNDI-WPKIILRQAESYEAIEKYKLALD 476

>Smik_4.491 Chr4 (895429..897267) [1839 bp, 612 aa] {ON} YDR244W
           (REAL)
          Length = 612

 Score = 31.6 bits (70), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 13/50 (26%), Positives = 31/50 (62%)

Query: 151 EYDEAVKDAESSISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIE 200
           ++D+ +   ES++ ++P+    ++RLG +     + EEA++AY + L ++
Sbjct: 473 DFDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLK 522

>Skud_11.206 Chr11 complement(375601..378009) [2409 bp, 802 aa] {ON}
           YKL022C (REAL)
          Length = 802

 Score = 31.2 bits (69), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 35/64 (54%), Gaps = 4/64 (6%)

Query: 132 LPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPSYFRGYSRLGFAK-YA-QGKPEEA 189
            P +AI + + A  + SL    EA K    S  +DPS+   +  LGFA  YA +G+ ++A
Sbjct: 485 FPKSAITWFSVATYYMSLDRICEAQKYYSKSSILDPSFAAAW--LGFAHTYALEGEQDQA 542

Query: 190 LEAY 193
           L AY
Sbjct: 543 LTAY 546

>Smik_11.232 Chr11 complement(381701..384082) [2382 bp, 793 aa] {ON}
           YKL022C (REAL)
          Length = 793

 Score = 31.2 bits (69), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 35/66 (53%), Gaps = 4/66 (6%)

Query: 130 QVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPSYFRGYSRLGFAK-YA-QGKPE 187
           +  P +AI + + A  +  L    EA K    S  +DPS+   +  LGFA  YA +G+ +
Sbjct: 478 ETFPKSAITWFSVATYYMCLDRISEAQKYYSKSSILDPSFAAAW--LGFAHTYALEGEQD 535

Query: 188 EALEAY 193
           +AL AY
Sbjct: 536 QALTAY 541

>CAGL0C03289g Chr3 (328799..333745) [4947 bp, 1648 aa] {ON} similar to
            uniprot|P32386 Saccharomyces cerevisiae YLL048c YBT1
            yeast bile transporter
          Length = 1648

 Score = 31.6 bits (70), Expect = 4.2,   Method: Composition-based stats.
 Identities = 22/79 (27%), Positives = 34/79 (43%), Gaps = 3/79 (3%)

Query: 156  VKDAESSISI---DPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNATEAMKRDY 212
            +K    SI+I   DP+ F G  R     Y +   EE   A K+V  +  +    +     
Sbjct: 1442 LKRLRRSITIIPQDPTLFAGSIRSNLDPYDEYSDEEIFTALKRVNLVSTEEMEASTSEIQ 1501

Query: 213  ESAKKKVEQSLNLEKAVPE 231
             ++ K V + LNLE  + E
Sbjct: 1502 SNSSKNVNKFLNLESEIAE 1520

>Skud_4.506 Chr4 (905143..906978) [1836 bp, 611 aa] {ON} YDR244W
           (REAL)
          Length = 611

 Score = 31.2 bits (69), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 13/50 (26%), Positives = 31/50 (62%)

Query: 151 EYDEAVKDAESSISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIE 200
           ++D+ +   ES++ ++P+    ++RLG +     + EEA++AY + L ++
Sbjct: 472 DFDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLK 521

>Suva_2.410 Chr2 (729992..731827) [1836 bp, 611 aa] {ON} YDR244W
           (REAL)
          Length = 611

 Score = 31.2 bits (69), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 13/50 (26%), Positives = 31/50 (62%)

Query: 151 EYDEAVKDAESSISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIE 200
           ++D+ +   ES++ ++P+    ++RLG +     + EEA++AY + L ++
Sbjct: 472 DFDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLK 521

>Kwal_55.22039 s55 (1084478..1087192) [2715 bp, 904 aa] {ON} YNL313C
           - Protein required for cell viability [contig 124] FULL
          Length = 904

 Score = 31.2 bits (69), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 40/92 (43%), Gaps = 5/92 (5%)

Query: 113 MANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPSYFRG 172
           +  K +E  I KY  A   L   A YY N  A     ++Y   +K    S+S+ P  F  
Sbjct: 584 LWKKSWE--IGKYVNAKNSL---ARYYYNPPATSGLSKDYVACLKHLNESLSLYPLAFDT 638

Query: 173 YSRLGFAKYAQGKPEEALEAYKKVLDIEGDNA 204
           +   G      GK E A EA+ + + ++  ++
Sbjct: 639 WYFYGCVGLECGKMELAAEAFTRCVSLDSTHS 670

>KNAG0J02830 Chr10 complement(542239..543372) [1134 bp, 377 aa] {ON}
           Anc_4.27 YHL025W
          Length = 377

 Score = 30.8 bits (68), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 22/44 (50%), Gaps = 3/44 (6%)

Query: 301 GFTSGGGAPNLSDLMNNPALRNMAG--NLFGGADAPSSE-GTPD 341
           GF +G   P L    NNP    ++   N+ GGAD PS   GT D
Sbjct: 294 GFDAGQNIPQLMGPENNPVTATVSNNPNILGGADQPSVPLGTQD 337

>Ecym_1396 Chr1 (820413..822134) [1722 bp, 573 aa] {ON} similar to
           Ashbya gossypii AFR453W
          Length = 573

 Score = 31.2 bits (69), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 28/132 (21%), Positives = 58/132 (43%), Gaps = 20/132 (15%)

Query: 114 ANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPSYFRGY 173
           AN +++  I+ +  A+ V P +   +    A+ ++    +EA++    +I + P++ R  
Sbjct: 433 ANDEFDKTIDCFKAALHVRPNDECMWNRLGASLANSNRSEEAIQAYHRAIQLKPAFVRAR 492

Query: 174 SRLGFAKYAQGKPEEALEAYKKVL---DIEG------------DNATEAMKRDYESAKK- 217
             L  +    G  +EA E     L   ++EG             N  E +KR + + ++ 
Sbjct: 493 YNLAVSSMNIGCYKEAAEQLLTALSMHEVEGVVMSAGSGTVPSSNILETLKRAFMALERR 552

Query: 218 ----KVEQSLNL 225
               KV Q+++L
Sbjct: 553 DLLEKVVQNIDL 564

>YDR244W Chr4 (950563..952401) [1839 bp, 612 aa] {ON}
           PEX5Peroxisomal membrane signal receptor for the
           C-terminal tripeptide signal sequence (PTS1) of
           peroxisomal matrix proteins, required for peroxisomal
           matrix protein import; also proposed to have
           PTS1-receptor independent functions
          Length = 612

 Score = 31.2 bits (69), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 13/50 (26%), Positives = 31/50 (62%)

Query: 151 EYDEAVKDAESSISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIE 200
           ++D+ +   ES++ ++P+    ++RLG +     + EEA++AY + L ++
Sbjct: 472 DFDKTIDCFESALRVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLK 521

>NDAI0F00400 Chr6 complement(96274..98568) [2295 bp, 764 aa] {ON}
           Anc_5.689 YOR080W
          Length = 764

 Score = 30.8 bits (68), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 34/69 (49%), Gaps = 1/69 (1%)

Query: 141 NRAAAHSSLREYDEAVKDAESSISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIE 200
           NRAA    + E ++A++DA     I+P   + + R G       K ++A   YK  L   
Sbjct: 99  NRAACWEKMGELEKALRDATKMCFIEPYNLKCFIRKGKILQKLHKLKDAYNTYKTALR-N 157

Query: 201 GDNATEAMK 209
            + AT+++K
Sbjct: 158 ANFATDSLK 166

>KNAG0B02240 Chr2 complement(434466..436685) [2220 bp, 739 aa] {ON}
           Anc_7.412 YBL084C
          Length = 739

 Score = 30.8 bits (68), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 42/96 (43%)

Query: 109 GNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPS 168
           GN     KD+  AI  + +A  +    A  Y  +   H++   YD A      +I+ DP 
Sbjct: 528 GNYFSLIKDHGEAIKAFEKATSLDRKFAYAYTLQGHEHAANETYDTAKIMYRKAIACDPQ 587

Query: 169 YFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNA 204
           ++  Y  LG      GK ++AL  ++K   I   NA
Sbjct: 588 HYNAYYGLGDCASRLGKYDKALLYFEKARVINPVNA 623

>TDEL0B01660 Chr2 complement(295823..297472) [1650 bp, 549 aa] {ON}
           Anc_8.470 YDR244W
          Length = 549

 Score = 30.8 bits (68), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 31/49 (63%)

Query: 151 EYDEAVKDAESSISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDI 199
           E+D+ +   ++++S++P+    ++RLG +     + EEA++AY K L +
Sbjct: 411 EFDKTIDCFKAALSVNPNDELMWNRLGASLANSNRSEEAIQAYYKALQL 459

>KLTH0F18150g Chr6 (1462613..1464682) [2070 bp, 689 aa] {ON} weakly
           similar to uniprot|Q7LGN4 Saccharomyces cerevisiae
           YOR080W DIA2 Protein of unknown function involved in
           invasive and pseudohyphal growth
          Length = 689

 Score = 30.8 bits (68), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 39/88 (44%), Gaps = 6/88 (6%)

Query: 141 NRAAAHSSLREYDEAVKDAESSISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIE 200
           NRAA    + +  +A+KDA  +   +P   + Y R G          +ALE Y+     E
Sbjct: 76  NRAATWEKIGDLKKALKDANRATRFEPYNLKCYLRRGKILQKLRMDGQALENYE-----E 130

Query: 201 GDNATEAMKRDYE-SAKKKVEQSLNLEK 227
           G  A   M R Y     KK+ ++L  +K
Sbjct: 131 GVKAIRDMTRKYHLDPPKKLYEALEYQK 158

>ACR173W Chr3 (657718..658575) [858 bp, 285 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YJR088C
          Length = 285

 Score = 30.4 bits (67), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 23/109 (21%), Positives = 47/109 (43%), Gaps = 13/109 (11%)

Query: 119 ELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPSYFRGYSRLGF 178
           EL + K    ++  P +A  +   A  +  L ++D+A+   E  + I P  +  +++L  
Sbjct: 142 ELWMKKLLSLLEKFPLDAELWWTLAMEYYKLGQFDQAIYCFEEVLLISPLAYSAFAQLAE 201

Query: 179 AKYAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEK 227
             Y +   E+ +             +T+ ++   E+A + VE S N  K
Sbjct: 202 VLYCKAMREKPV-------------STDVLQEALENALRAVELSSNCLK 237

>KLTH0A00638g Chr1 complement(63363..67598) [4236 bp, 1411 aa] {ON}
           similar to uniprot|P17883 Saccharomyces cerevisiae
           YPR189W SKI3 dsRNA virus protection family member
           contains 8 copies of the tetratricopeptide (TPR) domain
          Length = 1411

 Score = 30.8 bits (68), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 16/66 (24%), Positives = 36/66 (54%)

Query: 139 YANRAAAHSSLREYDEAVKDAESSISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLD 198
           Y     AH   +   E+++  +S++ ++P+    +  LG A Y+ G+ E +++ ++K L+
Sbjct: 684 YRVLGIAHLEKQAESESIEWFQSALRVEPADLESWLGLGQAYYSCGRVEASVKVFEKALE 743

Query: 199 IEGDNA 204
           +   NA
Sbjct: 744 VSPGNA 749

>CAGL0E01573g Chr5 complement(149084..151798) [2715 bp, 904 aa] {ON}
           similar to uniprot|P42842 Saccharomyces cerevisiae
           YNL313c
          Length = 904

 Score = 30.8 bits (68), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 26/101 (25%), Positives = 48/101 (47%), Gaps = 5/101 (4%)

Query: 109 GNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAH---SSLREYDEAVKDAESSISI 165
           G  A+     E+A   +T    + PT+A+ ++N +AA+     L+E    +K A SS S 
Sbjct: 640 GCIALECNKMEIAAEAFTRCTALDPTHAMSWSNLSAAYVQQGKLKEAHSCLKQAISSDS- 698

Query: 166 DPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNATE 206
               +R +           + E+ L A K++++I+ D + E
Sbjct: 699 -QKNWRIWENFLLVSVKLDEWEDVLAACKQLIEIKKDKSGE 738

>KLTH0F19140g Chr6 (1550056..1552830) [2775 bp, 924 aa] {ON} similar
           to uniprot|P42842 Saccharomyces cerevisiae YNL313C
           Protein required for cell viability
          Length = 924

 Score = 30.8 bits (68), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 41/89 (46%), Gaps = 5/89 (5%)

Query: 116 KDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPSYFRGYSR 175
           K +E  I KY  A   L   A YY N  ++    ++Y+  +K    S+S+ P  F  +  
Sbjct: 607 KSWE--IGKYVNAKNSL---ARYYYNPPSSSGLTKDYNACLKHLNESLSLYPLAFDTWYF 661

Query: 176 LGFAKYAQGKPEEALEAYKKVLDIEGDNA 204
            G      GK + A EA+ + + ++  ++
Sbjct: 662 YGCIGLECGKTDLAAEAFTRCVSLDDTHS 690

>TBLA0A01690 Chr1 complement(404419..406407) [1989 bp, 662 aa] {ON}
           Anc_8.470 YDR244W
          Length = 662

 Score = 30.4 bits (67), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 19/84 (22%), Positives = 38/84 (45%)

Query: 117 DYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPSYFRGYSRL 176
           DY+  I+ +  A+ V P + + +    A+ ++    +EAV     ++++ PS+ R    L
Sbjct: 508 DYDKTIDCFKTALTVNPNDELMWNRLGASLANSNRSEEAVAAYHRALTLKPSFVRARYNL 567

Query: 177 GFAKYAQGKPEEALEAYKKVLDIE 200
             +    G  +EA E     L + 
Sbjct: 568 AVSSINIGCFKEAAEHLLTALSMH 591

>ZYRO0C17138g Chr3 complement(1330370..1331980) [1611 bp, 536 aa]
           {ON} highly similar to uniprot|P20424 Saccharomyces
           cerevisiae YPR088C SRP54 Signal recognition particle
           (SRP) subunit (homolog of mammalian SRP54) contains the
           signal sequence-binding activity of SRP interacts with
           the SRP RNA and mediates binding of SRP to signal
           receptor contains GTPase domain
          Length = 536

 Score = 30.4 bits (67), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 19/26 (73%), Gaps = 1/26 (3%)

Query: 266 NPQLMQAAQ-KMMSNPGAMQNIQKMM 290
            PQ+MQ AQ ++  NPG M+N+Q M+
Sbjct: 468 TPQMMQQAQQRLKQNPGLMKNMQNML 493

>Kwal_27.10740 s27 complement(476617..478503) [1887 bp, 628 aa] {ON}
           YBL084C (CDC27) - component of the anaphase-promoting
           complex [contig 33] FULL
          Length = 628

 Score = 30.4 bits (67), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 41/93 (44%), Gaps = 10/93 (10%)

Query: 118 YELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPSYFRGYSRLG 177
           YE  +  + +A  + P N I       A   L   + A+++ + +  + P      S L 
Sbjct: 494 YEECLLHFEKARSINPVNVILICCCGVALEKLSHQERALQNYDLACELQPM-----SSLA 548

Query: 178 FAKYAQ-----GKPEEALEAYKKVLDIEGDNAT 205
             K AQ     GK   ALE+++K++ I  D AT
Sbjct: 549 LFKRAQLLLAMGKYNYALESFEKLVKIAPDEAT 581

>CAGL0M08030g Chr13 complement(800149..801312) [1164 bp, 387 aa]
           {ON} similar to uniprot|P47103 Saccharomyces cerevisiae
           YJR032w Peptidyl-prolyl cis-trans isomerase CYP7
          Length = 387

 Score = 30.0 bits (66), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 27/116 (23%), Positives = 51/116 (43%), Gaps = 22/116 (18%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIQVLPT------------------NAIYYANRAAAH 146
           +K  G+     KDY+ +  KY +A++ + T                      Y N   A 
Sbjct: 237 IKDSGSALFKIKDYQNSYYKYMKALKYVNTYIPEQDVDEKHCLLFIELKKKLYLNICLAL 296

Query: 147 SSLREYDEAVKDAESSISID----PSYFRGYSRLGFAKYAQGKPEEALEAYKKVLD 198
            +L++YDE++K     + +D        + Y R+G + +A+ + +EAL+ Y+   D
Sbjct: 297 FNLKDYDESMKYGHYLLELDSVDDKDKAKAYYRIGNSLFAKKRYDEALKNYRLCRD 352

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.307    0.123    0.327 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 31,241,136
Number of extensions: 1181956
Number of successful extensions: 4717
Number of sequences better than 10.0: 243
Number of HSP's gapped: 4595
Number of HSP's successfully gapped: 324
Length of query: 345
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 235
Effective length of database: 40,868,139
Effective search space: 9604012665
Effective search space used: 9604012665
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 66 (30.0 bits)