Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_15.1756.19ON31231214000.0
YOR006C (TSR3)6.19ON31331213390.0
Suva_15.1816.19ON33631213170.0
Skud_15.1676.19ON31231212551e-175
TDEL0G045006.19ON30123810931e-150
SAKL0E01144g6.19ON43024010891e-148
Kpol_1037.246.19ON36631810741e-146
TPHA0J003206.19ON34232110681e-146
ZYRO0C07832g6.19ON28124010501e-144
KLLA0D01111g6.19ON31427510361e-141
CAGL0E02717g6.19ON32523710311e-141
KNAG0M011506.19ON30731310151e-138
Ecym_30236.19ON34923810131e-137
ACR007W6.19ON3132389951e-135
NDAI0D007906.19ON4012619481e-127
NCAS0H008106.19ON3233279351e-126
Kwal_56.224216.19ON3372329281e-125
KLTH0C11264g6.19ON3462389241e-124
KAFR0L003906.19ON3292288301e-110
TBLA0A072506.19ON3043148271e-110
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_15.175
         (312 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_15.175 Chr15 complement(304998..305936) [939 bp, 312 aa] {O...   543   0.0  
YOR006C Chr15 complement(337680..338621) [942 bp, 313 aa] {ON}  ...   520   0.0  
Suva_15.181 Chr15 complement(312147..313157) [1011 bp, 336 aa] {...   511   0.0  
Skud_15.167 Chr15 complement(297699..298637) [939 bp, 312 aa] {O...   488   e-175
TDEL0G04500 Chr7 (818321..819226) [906 bp, 301 aa] {ON} Anc_6.19...   425   e-150
SAKL0E01144g Chr5 complement(88424..89716) [1293 bp, 430 aa] {ON...   424   e-148
Kpol_1037.24 s1037 complement(54258..55358) [1101 bp, 366 aa] {O...   418   e-146
TPHA0J00320 Chr10 complement(71267..72295) [1029 bp, 342 aa] {ON...   416   e-146
ZYRO0C07832g Chr3 (594511..595356) [846 bp, 281 aa] {ON} similar...   409   e-144
KLLA0D01111g Chr4 complement(100315..101259) [945 bp, 314 aa] {O...   403   e-141
CAGL0E02717g Chr5 complement(257708..258685) [978 bp, 325 aa] {O...   401   e-141
KNAG0M01150 Chr13 complement(206754..207677) [924 bp, 307 aa] {O...   395   e-138
Ecym_3023 Chr3 complement(45641..46690) [1050 bp, 349 aa] {ON} s...   394   e-137
ACR007W Chr3 (367875..368816) [942 bp, 313 aa] {ON} Syntenic hom...   387   e-135
NDAI0D00790 Chr4 complement(175697..176902) [1206 bp, 401 aa] {O...   369   e-127
NCAS0H00810 Chr8 complement(146860..147831) [972 bp, 323 aa] {ON...   364   e-126
Kwal_56.22421 s56 complement(120212..121225) [1014 bp, 337 aa] {...   362   e-125
KLTH0C11264g Chr3 (925534..926574) [1041 bp, 346 aa] {ON} simila...   360   e-124
KAFR0L00390 Chr12 complement(71329..72318) [990 bp, 329 aa] {ON}...   324   e-110
TBLA0A07250 Chr1 complement(1806584..1807498) [915 bp, 304 aa] {...   323   e-110

>Smik_15.175 Chr15 complement(304998..305936) [939 bp, 312 aa] {ON}
           YOR006C (REAL)
          Length = 312

 Score =  543 bits (1400), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/312 (86%), Positives = 271/312 (86%)

Query: 1   MGKGKNKAHEPKNGRPQRGANGHSSRQNHRRMEMKYENSDKVKFPVKLAMWDFDHCDPKR 60
           MGKGKNKAHEPKNGRPQRGANGHSSRQNHRRMEMKYENSDKVKFPVKLAMWDFDHCDPKR
Sbjct: 1   MGKGKNKAHEPKNGRPQRGANGHSSRQNHRRMEMKYENSDKVKFPVKLAMWDFDHCDPKR 60

Query: 61  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDLEVVEQHGASVVECSWARLEEV 120
           CSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDLEVVEQHGASVVECSWARLEEV
Sbjct: 61  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDLEVVEQHGASVVECSWARLEEV 120

Query: 121 PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASELLSHFSWGM 180
           PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASELLSHFSWGM
Sbjct: 121 PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASELLSHFSWGM 180

Query: 181 GFLELNKELLEIYQQCTDADSVKRAEEEWLQKLEKETQERKSQAKEEDIWMMGNINRRXX 240
           GFLELNKELLEIYQQCTDADSVKRAEEEWLQKLEKETQERKSQAKEEDIWMMGNINRR  
Sbjct: 181 GFLELNKELLEIYQQCTDADSVKRAEEEWLQKLEKETQERKSQAKEEDIWMMGNINRRGG 240

Query: 241 XXXXXXXXXXXXXXXXXXXXDKQCVEYDSLGNAICIDSINSRXXXXXXXXXXXXXXXXXX 300
                               DKQCVEYDSLGNAICIDSINSR                  
Sbjct: 241 GWQSDESESGGSSGESESEGDKQCVEYDSLGNAICIDSINSRKSLSEESEDEENDLEENK 300

Query: 301 XPVSYDSLGNLI 312
            PVSYDSLGNLI
Sbjct: 301 EPVSYDSLGNLI 312

>YOR006C Chr15 complement(337680..338621) [942 bp, 313 aa] {ON}
           TSR3Protein required for correct processing of the 20S
           pre-rRNA at site D to generate mature 18S rRNA; green
           fluorescent protein (GFP)-fusion protein localizes to
           both the cytoplasm and the nucleus
          Length = 313

 Score =  520 bits (1339), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 255/312 (81%), Positives = 265/312 (84%)

Query: 1   MGKGKNKAHEPKNGRPQRGANGHSSRQNHRRMEMKYENSDKVKFPVKLAMWDFDHCDPKR 60
           MGKGKNK HEPKNGRPQRGANGHSSRQNHRRMEMKY+NS+K+KFPVKLAMWDFDHCDPKR
Sbjct: 1   MGKGKNKMHEPKNGRPQRGANGHSSRQNHRRMEMKYDNSEKMKFPVKLAMWDFDHCDPKR 60

Query: 61  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDLEVVEQHGASVVECSWARLEEV 120
           CSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDLE+VEQHGASVVECSWARLEEV
Sbjct: 61  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDLEIVEQHGASVVECSWARLEEV 120

Query: 121 PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASELLSHFSWGM 180
           PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASELLSHFSWGM
Sbjct: 121 PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASELLSHFSWGM 180

Query: 181 GFLELNKELLEIYQQCTDADSVKRAEEEWLQKLEKETQERKSQAKEEDIWMMGNINRRXX 240
           GFLELNKELLEIYQQCTD DSVKRAEEEWLQKLEKETQERKS+AKEEDIWMMGNINRR  
Sbjct: 181 GFLELNKELLEIYQQCTDCDSVKRAEEEWLQKLEKETQERKSRAKEEDIWMMGNINRRGN 240

Query: 241 XXXXXXXXXXXXXXXXXXXXDKQCVEYDSLGNAICIDSINSRXXXXXXXXXXXXXXXXXX 300
                               + QC+EYDSLGNAI ID++ SR                  
Sbjct: 241 GSQSDTSESEENSEQSDLEGNNQCIEYDSLGNAIRIDNMKSREAQSEESEDEESGSKENG 300

Query: 301 XPVSYDSLGNLI 312
            P+SYD LGNLI
Sbjct: 301 EPLSYDPLGNLI 312

>Suva_15.181 Chr15 complement(312147..313157) [1011 bp, 336 aa] {ON}
           YOR006C (REAL)
          Length = 336

 Score =  511 bits (1317), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 245/312 (78%), Positives = 263/312 (84%)

Query: 1   MGKGKNKAHEPKNGRPQRGANGHSSRQNHRRMEMKYENSDKVKFPVKLAMWDFDHCDPKR 60
           MGKGKNK HEPKNGRPQRGANGHSSRQNH+RMEMKY+NS+   FPVKLAMWDFDHCDPKR
Sbjct: 25  MGKGKNKTHEPKNGRPQRGANGHSSRQNHKRMEMKYDNSEMTNFPVKLAMWDFDHCDPKR 84

Query: 61  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDLEVVEQHGASVVECSWARLEEV 120
           CSGKKLERLGLIKSLRVGQKFQGIVVSPNG GVVCPDDLEVVEQHGASVVECSWARLEEV
Sbjct: 85  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGNGVVCPDDLEVVEQHGASVVECSWARLEEV 144

Query: 121 PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASELLSHFSWGM 180
           PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWAS LLSHFSWG+
Sbjct: 145 PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASGLLSHFSWGL 204

Query: 181 GFLELNKELLEIYQQCTDADSVKRAEEEWLQKLEKETQERKSQAKEEDIWMMGNINRRXX 240
           GFL+LN+ELLEIYQ+CTD++SVK+AEEEWLQKLEKETQERKSQ+K+EDIWMMGN+NR+  
Sbjct: 205 GFLDLNRELLEIYQKCTDSNSVKKAEEEWLQKLEKETQERKSQSKDEDIWMMGNVNRKDN 264

Query: 241 XXXXXXXXXXXXXXXXXXXXDKQCVEYDSLGNAICIDSINSRXXXXXXXXXXXXXXXXXX 300
                               DKQ +EYDSLGNAICID++ SR                  
Sbjct: 265 GAQSDESESEEDSDQSELESDKQSIEYDSLGNAICIDNVKSRKMLSEGSEDEESEFEEDE 324

Query: 301 XPVSYDSLGNLI 312
            PVSYDSLGN+I
Sbjct: 325 EPVSYDSLGNII 336

>Skud_15.167 Chr15 complement(297699..298637) [939 bp, 312 aa] {ON}
           YOR006C (REAL)
          Length = 312

 Score =  488 bits (1255), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 233/312 (74%), Positives = 258/312 (82%)

Query: 1   MGKGKNKAHEPKNGRPQRGANGHSSRQNHRRMEMKYENSDKVKFPVKLAMWDFDHCDPKR 60
           MGKGKNK HEPKN R QRGANGHS+RQNH+ MEMKY+ S+K+KFPVKLAMWDFDHCDPKR
Sbjct: 1   MGKGKNKTHEPKNERQQRGANGHSARQNHKHMEMKYDKSEKMKFPVKLAMWDFDHCDPKR 60

Query: 61  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDLEVVEQHGASVVECSWARLEEV 120
           CSGKKLERLGLI+SLRVGQKFQG+VVSPNG+GVVCP+DLE+VEQHGASVVECSWARLEEV
Sbjct: 61  CSGKKLERLGLIRSLRVGQKFQGVVVSPNGQGVVCPNDLEIVEQHGASVVECSWARLEEV 120

Query: 121 PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASELLSHFSWGM 180
           PFNKIGGK+ERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVG+MDWASELLSHFSWG+
Sbjct: 121 PFNKIGGKYERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGKMDWASELLSHFSWGL 180

Query: 181 GFLELNKELLEIYQQCTDADSVKRAEEEWLQKLEKETQERKSQAKEEDIWMMGNINRRXX 240
           GFL+LNKELLEIYQ+CTDADSVK+AE+EWL+KLE ETQERKS  K+ DIWMMGNINRR  
Sbjct: 181 GFLDLNKELLEIYQRCTDADSVKKAEKEWLEKLEMETQERKSHTKKTDIWMMGNINRRGN 240

Query: 241 XXXXXXXXXXXXXXXXXXXXDKQCVEYDSLGNAICIDSINSRXXXXXXXXXXXXXXXXXX 300
                                +Q +EYD+LGNAI +DS+ SR                  
Sbjct: 241 GVQSDELESGEDSEQSGLENSEQPIEYDALGNAIHVDSVKSRIMLSGVSEDEESDFGENE 300

Query: 301 XPVSYDSLGNLI 312
            PV+YDSLGNLI
Sbjct: 301 KPVNYDSLGNLI 312

>TDEL0G04500 Chr7 (818321..819226) [906 bp, 301 aa] {ON} Anc_6.19
           YOR006C
          Length = 301

 Score =  425 bits (1093), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 201/238 (84%), Positives = 216/238 (90%), Gaps = 1/238 (0%)

Query: 1   MGKGKNKAHEPKNGRPQRGANGHSSRQNHRRMEMKYENSDKVKFPVKLAMWDFDHCDPKR 60
           M KGKNK  E KNG   +G+NGHSSRQNH+RMEMK    D  KFPVKLAMWDFDHCDPKR
Sbjct: 1   MSKGKNKNREAKNGHSGKGSNGHSSRQNHKRMEMKRGTED-TKFPVKLAMWDFDHCDPKR 59

Query: 61  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDLEVVEQHGASVVECSWARLEEV 120
           CSGKKLERLGLIKSLRVGQKFQGIVVSPNG GVVCPDD  +VE+HGASVVECSWARL+EV
Sbjct: 60  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGSGVVCPDDKSIVEEHGASVVECSWARLDEV 119

Query: 121 PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASELLSHFSWGM 180
           PFNKIGGKHERLLPYLVAANQVNYGRPW+LNCVEALAACFAIVGRMDWASELLSHFSWG+
Sbjct: 120 PFNKIGGKHERLLPYLVAANQVNYGRPWKLNCVEALAACFAIVGRMDWASELLSHFSWGL 179

Query: 181 GFLELNKELLEIYQQCTDADSVKRAEEEWLQKLEKETQERKSQAKEEDIWMMGNINRR 238
           GFLELN+ELLEIYQQCTDADSVK AE  WL K++KE +ERKSQAK+EDIWM GN+NR+
Sbjct: 180 GFLELNQELLEIYQQCTDADSVKAAESAWLVKIQKEVEERKSQAKDEDIWMTGNVNRK 237

>SAKL0E01144g Chr5 complement(88424..89716) [1293 bp, 430 aa] {ON}
           similar to uniprot|Q12094 Saccharomyces cerevisiae
           YOR006C Hypothetical ORF
          Length = 430

 Score =  424 bits (1089), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 201/240 (83%), Positives = 220/240 (91%), Gaps = 2/240 (0%)

Query: 1   MGKGKNKAHEPKNGRPQRGANGHSSRQNHRRMEMKY--ENSDKVKFPVKLAMWDFDHCDP 58
           MGKGKNK HE ++ RP RGANGHSSR NH+RMEMK   ++S   KFPVKLAMWDFDHCDP
Sbjct: 1   MGKGKNKNHEERSSRPHRGANGHSSRLNHKRMEMKRGGDSSAGNKFPVKLAMWDFDHCDP 60

Query: 59  KRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDLEVVEQHGASVVECSWARLE 118
           KRCSGKKLERLGLIKSLRVGQKFQGIVVSPNG+GVVCP+D  +VE+HGASVVECSWARL+
Sbjct: 61  KRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGRGVVCPNDRVIVEEHGASVVECSWARLD 120

Query: 119 EVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASELLSHFSW 178
           EVPF +IGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGR D ASELLS+FSW
Sbjct: 121 EVPFGRIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLASELLSNFSW 180

Query: 179 GMGFLELNKELLEIYQQCTDADSVKRAEEEWLQKLEKETQERKSQAKEEDIWMMGNINRR 238
           G+GFLELNKELLEIYQQCTDADSVK AEE WL+K+E+E Q+RK Q+KEEDIWMMGN+NRR
Sbjct: 181 GLGFLELNKELLEIYQQCTDADSVKAAEEAWLKKIEEEAQQRKQQSKEEDIWMMGNVNRR 240

>Kpol_1037.24 s1037 complement(54258..55358) [1101 bp, 366 aa] {ON}
           complement(54258..55358) [1101 nt, 367 aa]
          Length = 366

 Score =  418 bits (1074), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 207/318 (65%), Positives = 236/318 (74%), Gaps = 17/318 (5%)

Query: 1   MGKGKNKAHEPKNGRPQRGANGHSSRQNHRRMEMKYEN---SDKVKFPVKLAMWDFDHCD 57
           M KGKNK HE + G+P RG+NGHSS+ NH+ MEMK      S   KFPVKLAMWDFDHCD
Sbjct: 1   MAKGKNKQHEARTGKPSRGSNGHSSKLNHKHMEMKKYGKNISQDDKFPVKLAMWDFDHCD 60

Query: 58  PKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDLEVVEQHGASVVECSWARL 117
           PKRCSGK+LERLGLIKSLRVGQKFQG+VVSPNGKGV+CP+D E+VE+ GASVVECSWARL
Sbjct: 61  PKRCSGKRLERLGLIKSLRVGQKFQGVVVSPNGKGVLCPNDREIVEEFGASVVECSWARL 120

Query: 118 EEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASELLSHFS 177
           +EVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWA+ELLS+FS
Sbjct: 121 DEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWAAELLSNFS 180

Query: 178 WGMGFLELNKELLEIYQQCTDADSVKRAEEEWLQKLEKETQERKSQAKEEDIWMMGNINR 237
           WG+GFLE+N+ELL+IYQQCTD++SVK+AEEEWL K+E+E QERK+QA+E DIWMMGN NR
Sbjct: 181 WGLGFLEINEELLKIYQQCTDSESVKKAEEEWLAKIEQEIQERKTQARESDIWMMGNTNR 240

Query: 238 RXX---XXXXXXXXXXXXXXXXXXXXDKQCVEYDSLGNAICIDSINSRXXXXXXXXXXXX 294
                                     + +   YD+LGN I                    
Sbjct: 241 NMNGDDDEEEGNSYEALSGDDYEEENNNKSARYDNLGNII-----------ESEEDYDDY 289

Query: 295 XXXXXXXPVSYDSLGNLI 312
                   V YDSLGN+I
Sbjct: 290 DDEEDRVEVKYDSLGNII 307

>TPHA0J00320 Chr10 complement(71267..72295) [1029 bp, 342 aa] {ON}
           Anc_6.19 YOR006C
          Length = 342

 Score =  416 bits (1068), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 207/321 (64%), Positives = 237/321 (73%), Gaps = 11/321 (3%)

Query: 1   MGKGKNKAHEPKNGRPQRGANGHSSRQNHRRMEMKYEN------SDKVKFPVKLAMWDFD 54
           M KGKNK+ E ++G+P RG+NGH +R NH+RMEMK+ N      S +  FPVKLAMWDFD
Sbjct: 1   MAKGKNKSSETRSGKPSRGSNGHHTRTNHKRMEMKFSNAGTGANSKEAGFPVKLAMWDFD 60

Query: 55  HCDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDLEVVEQHGASVVECSW 114
           HCDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDD E VE+ GASVVECSW
Sbjct: 61  HCDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDKETVEEFGASVVECSW 120

Query: 115 ARLEEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASELLS 174
           ARL+EVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGR+D A+ELL 
Sbjct: 121 ARLDEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRVDLAAELLE 180

Query: 175 HFSWGMGFLELNKELLEIYQQCTDADSVKRAEEEWLQKLEKETQERKSQAKEEDIWMMGN 234
           HFSWG+GFLELNKELLE+YQ+CTD++SVK+ EEEWL+K++KE QERKSQ++E DIW+ GN
Sbjct: 181 HFSWGLGFLELNKELLEMYQKCTDSESVKKVEEEWLEKIDKEVQERKSQSREGDIWLQGN 240

Query: 235 INRRXXXXXXXXXXXXXXXXXXXXXXDKQCVEYDSLGNAICIDSINSRXXXXXXXXXX-- 292
            NR                        K  + YD+LGN +  +  N              
Sbjct: 241 TNRDLQDMSDDEEFDSEQYYSEENTERK--IRYDNLGNVLISEEENESEEEEEVRYDALG 298

Query: 293 -XXXXXXXXXPVSYDSLGNLI 312
                      + YDSLGNLI
Sbjct: 299 NIIESEEEAAELKYDSLGNLI 319

>ZYRO0C07832g Chr3 (594511..595356) [846 bp, 281 aa] {ON} similar to
           uniprot|Q12094 Saccharomyces cerevisiae YOR006C
           Hypothetical ORF
          Length = 281

 Score =  409 bits (1050), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 189/240 (78%), Positives = 216/240 (90%), Gaps = 3/240 (1%)

Query: 1   MGKGKNKAHEPKNGRPQRGANGHSSRQNHRRMEMKY---ENSDKVKFPVKLAMWDFDHCD 57
           MGKGKNK HE ++ RP RGANGH+S+QNH+ MEMK+    NS+K  FPVKL MWDFDHCD
Sbjct: 1   MGKGKNKNHEVRSTRPGRGANGHNSKQNHKHMEMKHGGASNSNKTNFPVKLGMWDFDHCD 60

Query: 58  PKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDLEVVEQHGASVVECSWARL 117
           PKRCSGKKLERLGLI+SLRVGQKFQG+VV+PNG GVVCP+D  +VE+HGASVVECSWARL
Sbjct: 61  PKRCSGKKLERLGLIRSLRVGQKFQGVVVTPNGTGVVCPNDKSIVEEHGASVVECSWARL 120

Query: 118 EEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASELLSHFS 177
           +EVPFN+IGG+HERLLPYLVAANQVNYGRPW+LNCVEALAACFAIVGRMDWASELLS+FS
Sbjct: 121 DEVPFNRIGGRHERLLPYLVAANQVNYGRPWKLNCVEALAACFAIVGRMDWASELLSNFS 180

Query: 178 WGMGFLELNKELLEIYQQCTDADSVKRAEEEWLQKLEKETQERKSQAKEEDIWMMGNINR 237
           +G  FLE+N ELLEIYQQCTDA+SVK AE  WL+K+EKE ++RK+QAK EDIWM GN+NR
Sbjct: 181 YGPSFLEINAELLEIYQQCTDAESVKDAESAWLEKIEKEIKDRKAQAKNEDIWMTGNVNR 240

>KLLA0D01111g Chr4 complement(100315..101259) [945 bp, 314 aa] {ON}
           similar to uniprot|Q12094 Saccharomyces cerevisiae
           YOR006C Hypothetical ORF
          Length = 314

 Score =  403 bits (1036), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 199/275 (72%), Positives = 223/275 (81%), Gaps = 2/275 (0%)

Query: 1   MGKGKNKAHEPKNGRPQRGANGHSSRQNHRRMEMKYENSDKVKFPVKLAMWDFDHCDPKR 60
           MGKGKNK    +  R Q+G+NGHSSR NH+RMEMK+ +S   KFPVKLAMWDFDHCDPKR
Sbjct: 1   MGKGKNKESSTR-PRSQKGSNGHSSRLNHKRMEMKHVDSTTSKFPVKLAMWDFDHCDPKR 59

Query: 61  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDLEVVEQHGASVVECSWARLEEV 120
           CSGKKLERLGLIKSLRVGQKFQG+VVSPNGK VVCPDD  +VE++GASVVECSWARL+EV
Sbjct: 60  CSGKKLERLGLIKSLRVGQKFQGVVVSPNGKTVVCPDDKALVEENGASVVECSWARLDEV 119

Query: 121 PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASELLSHFSWGM 180
           PFNKIGGK+ERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGR D A++LLS+FSWG 
Sbjct: 120 PFNKIGGKNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLAADLLSNFSWGP 179

Query: 181 GFLELNKELLEIYQQCTDADSVKRAEEEWLQKLEKETQERKSQAKEEDIWMMGNINRRXX 240
            FLELNKELL+IYQQCTD DSVK AEE+WLQK+E+E  ERK QAK EDIWM+GN+NR   
Sbjct: 180 AFLELNKELLDIYQQCTDHDSVKAAEEKWLQKIEQEAIERKQQAKTEDIWMIGNVNRASR 239

Query: 241 XXXXXXXXXXXXXXXX-XXXXDKQCVEYDSLGNAI 274
                                D + ++YDSLGN I
Sbjct: 240 DLPGSSGEEEEEDYLNGDSLIDVRDIKYDSLGNVI 274

>CAGL0E02717g Chr5 complement(257708..258685) [978 bp, 325 aa] {ON}
           similar to uniprot|Q12094 Saccharomyces cerevisiae
           YOR006c
          Length = 325

 Score =  401 bits (1031), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 188/237 (79%), Positives = 208/237 (87%), Gaps = 1/237 (0%)

Query: 2   GKGKNKAHEPKNGRPQRGANGHSSRQNHRRMEMKY-ENSDKVKFPVKLAMWDFDHCDPKR 60
           GKGKNK+H+        G+NGH +R+NHR MEMKY   S    FPVKLAMWDFDHCDPKR
Sbjct: 4   GKGKNKSHDEGRSNKSGGSNGHHTRRNHRHMEMKYCGGSKDSSFPVKLAMWDFDHCDPKR 63

Query: 61  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDLEVVEQHGASVVECSWARLEEV 120
           CSGKKLERLGLIKSLRVGQKFQGIVVSPNGK VVCPDD E+VE HGASVVECSWARLEEV
Sbjct: 64  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGKSVVCPDDREIVEAHGASVVECSWARLEEV 123

Query: 121 PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASELLSHFSWGM 180
           PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGR D A ELLSHFSWG+
Sbjct: 124 PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLAHELLSHFSWGL 183

Query: 181 GFLELNKELLEIYQQCTDADSVKRAEEEWLQKLEKETQERKSQAKEEDIWMMGNINR 237
           GFLELNK+LLE YQQCTD++S+K+ EE+WLQ++++E QERK +A+ ED+WMMGN NR
Sbjct: 184 GFLELNKDLLERYQQCTDSESIKKVEEDWLQQIDQEVQERKLKAQTEDVWMMGNTNR 240

>KNAG0M01150 Chr13 complement(206754..207677) [924 bp, 307 aa] {ON}
           Anc_6.19 YOR006C
          Length = 307

 Score =  395 bits (1015), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 197/313 (62%), Positives = 234/313 (74%), Gaps = 23/313 (7%)

Query: 2   GKGKNKAHEPKNGR-PQRGANGHSSRQNHRRMEMKYENSDK-VKFPVKLAMWDFDHCDPK 59
           GKGKNK+   +  R   +G+NGHSSR NH+RME++  +  K  KFPVK+AMWDFDHCDPK
Sbjct: 4   GKGKNKSRGDETSRGSHKGSNGHSSRLNHKRMELRQHDGVKGTKFPVKMAMWDFDHCDPK 63

Query: 60  RCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDLEVVEQHGASVVECSWARLEE 119
           RCSGKKLERLGLI SL+VGQKFQGIVVSPNG+GVVCPDD  +VE+ GASVVECSWARL+E
Sbjct: 64  RCSGKKLERLGLITSLKVGQKFQGIVVSPNGQGVVCPDDRAIVEEFGASVVECSWARLDE 123

Query: 120 VPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASELLSHFSWG 179
           VPFN+IGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMD AS+LLS+FSWG
Sbjct: 124 VPFNRIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLASDLLSNFSWG 183

Query: 180 MGFLELNKELLEIYQQCTDADSVKRAEEEWLQKLEKETQERKSQAKEEDIWMMGNINRRX 239
           +GFLELNKELLE+YQ+CTD +SVK+AEE+WL K+E+E Q+RK++A++ DIWMMGN+NR  
Sbjct: 184 LGFLELNKELLEVYQKCTDHESVKKAEEDWLNKIEEEAQQRKNEARDGDIWMMGNVNRNM 243

Query: 240 XXXXXXXXXXXXXXXXXXXXXDKQCVEYDSLGNAICIDSINSRXXXXXXXXXXXXXXXXX 299
                                    + YD+LGNAI  +S                     
Sbjct: 244 NKMTLSDEESDEEETE------ASSIRYDNLGNAIIDES---------------DEEEPE 282

Query: 300 XXPVSYDSLGNLI 312
              + YD+LGN+I
Sbjct: 283 ISSIRYDNLGNVI 295

>Ecym_3023 Chr3 complement(45641..46690) [1050 bp, 349 aa] {ON}
           similar to Ashbya gossypii ACR007W
          Length = 349

 Score =  394 bits (1013), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 182/238 (76%), Positives = 205/238 (86%), Gaps = 2/238 (0%)

Query: 1   MGKGKNKAHEPKNGRPQRGANGHSSRQNHRRMEMKYENSDKVKFPVKLAMWDFDHCDPKR 60
           MGKG+NK ++  +   Q+G+NGHSSR NHRR+E KY      KFPV LAMWDFDHCDPKR
Sbjct: 1   MGKGRNKDYDKNHS--QKGSNGHSSRTNHRRIETKYNAIQGSKFPVTLAMWDFDHCDPKR 58

Query: 61  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDLEVVEQHGASVVECSWARLEEV 120
           CSGKKLERLGLIKSLRV QKFQGIVVSPNGK VVCP+D E+ E++G SVVECSWARLEE+
Sbjct: 59  CSGKKLERLGLIKSLRVKQKFQGIVVSPNGKTVVCPNDREIAEKYGVSVVECSWARLEEI 118

Query: 121 PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASELLSHFSWGM 180
           PF KIGG+HERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMD A  LLSHFSWG+
Sbjct: 119 PFEKIGGRHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLAETLLSHFSWGL 178

Query: 181 GFLELNKELLEIYQQCTDADSVKRAEEEWLQKLEKETQERKSQAKEEDIWMMGNINRR 238
           GFLELNKE+LEIYQ+CTD DS+K AEE WL+++E E  ER+ Q KE DIWMMGN+NR+
Sbjct: 179 GFLELNKEILEIYQKCTDHDSIKAAEEAWLKQIETEAMERRKQTKENDIWMMGNVNRK 236

>ACR007W Chr3 (367875..368816) [942 bp, 313 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR006C
          Length = 313

 Score =  387 bits (995), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 177/238 (74%), Positives = 206/238 (86%), Gaps = 1/238 (0%)

Query: 1   MGKGKNKAHEPKNGRPQRGANGHSSRQNHRRMEMKYENSDKVKFPVKLAMWDFDHCDPKR 60
           M KGKNK  E +  +P +G++ H+ + N RR E+K+ ++ + +FP KLAMWDFDHCDPKR
Sbjct: 1   MAKGKNKKTEERQ-KPAKGSSKHNGKSNQRRTELKHGHTKETEFPAKLAMWDFDHCDPKR 59

Query: 61  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDLEVVEQHGASVVECSWARLEEV 120
           CSGKKLERLGLIKSLR+GQKFQGIVVSPNGK VVCP+D E+VEQHG SVVECSWARL+E+
Sbjct: 60  CSGKKLERLGLIKSLRIGQKFQGIVVSPNGKTVVCPNDKEIVEQHGVSVVECSWARLDEI 119

Query: 121 PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASELLSHFSWGM 180
           PF+KIGG+HERLLPYLVAANQVNYGRPWRLNCVEA+AACFAIVGR D A ELLSHFSWG 
Sbjct: 120 PFSKIGGRHERLLPYLVAANQVNYGRPWRLNCVEAIAACFAIVGRTDLAEELLSHFSWGP 179

Query: 181 GFLELNKELLEIYQQCTDADSVKRAEEEWLQKLEKETQERKSQAKEEDIWMMGNINRR 238
           GFLELN+ELLE YQQCTD  S+K AEE WLQKLE+E ++R+ Q  EEDIWMMGN+NR+
Sbjct: 180 GFLELNQELLETYQQCTDHASIKAAEEAWLQKLEEEAEQRRKQTHEEDIWMMGNVNRK 237

>NDAI0D00790 Chr4 complement(175697..176902) [1206 bp, 401 aa] {ON}
           Anc_6.19 YOR006C
          Length = 401

 Score =  369 bits (948), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 175/261 (67%), Positives = 211/261 (80%), Gaps = 24/261 (9%)

Query: 1   MGKGKNKAHE--PKNGRPQRGANGHSSRQNHRRMEMKYENS--------------DKV-- 42
           MGKGKNK+ +  PKN R  RGANGHSSR NH+ MEMK  N               D++  
Sbjct: 45  MGKGKNKSRDDGPKNPRAHRGANGHSSRHNHKNMEMKKHNDFTSTQMVNDNDDGIDEIHS 104

Query: 43  --KFPVKLAMWDFDHCDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDLE 100
             K PVKL MWDFDHCDPKRCSGKKLERLGLIKSL++GQ+FQG+++SPNGK VV PDD +
Sbjct: 105 VKKIPVKLGMWDFDHCDPKRCSGKKLERLGLIKSLKIGQRFQGLIISPNGKKVVSPDDAD 164

Query: 101 VVEQHGASVVECSWARLEEVPFNKI----GGKHERLLPYLVAANQVNYGRPWRLNCVEAL 156
           ++++ GA+VVECSWARL+E+PF+K+    GGK+ERLLPYLVAANQVNYGRPW+LNCVEAL
Sbjct: 165 IIKEFGAAVVECSWARLDEIPFSKLNGGNGGKNERLLPYLVAANQVNYGRPWKLNCVEAL 224

Query: 157 AACFAIVGRMDWASELLSHFSWGMGFLELNKELLEIYQQCTDADSVKRAEEEWLQKLEKE 216
           AACFAI+GR DWAS+LLS+FSWG+ FL+LN+EL E+Y +CTD+DSVK A+EEWL K+E+E
Sbjct: 225 AACFAIIGRSDWASDLLSNFSWGLNFLKLNEELFELYSKCTDSDSVKAAQEEWLDKIEQE 284

Query: 217 TQERKSQAKEEDIWMMGNINR 237
             ERK QA+E DIWMMGN NR
Sbjct: 285 ATERKLQAQETDIWMMGNTNR 305

>NCAS0H00810 Chr8 complement(146860..147831) [972 bp, 323 aa] {ON}
           Anc_6.19 YOR006C
          Length = 323

 Score =  364 bits (935), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 185/327 (56%), Positives = 230/327 (70%), Gaps = 21/327 (6%)

Query: 1   MGKGKNKAHEPKN--GRPQRGANGHSSRQNHRRMEM-KYENSDKV---KFPVKLAMWDFD 54
           MGKGKNK  +  +  GR  RGANGHSSR NH+ MEM K+EN D     K PVKL MWDFD
Sbjct: 1   MGKGKNKKRDDGDSKGRQHRGANGHSSRHNHKNMEMRKHENEDTSNVKKIPVKLGMWDFD 60

Query: 55  HCDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDLEVVEQHGASVVECSW 114
           HCDPKRCSGKKLERLGLIKSL++GQ+FQG+++SPNGK VV P+D +++++ GA+VVECSW
Sbjct: 61  HCDPKRCSGKKLERLGLIKSLKIGQRFQGLIISPNGKKVVSPEDADIIKEFGAAVVECSW 120

Query: 115 ARLEEVPFNKI----GGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWAS 170
           ARL+E+PF+K+    GGK+ERLLPYLVAANQVNYGRPW+LNCVEALAACFAI+GR DWA+
Sbjct: 121 ARLDEIPFSKLNGGNGGKNERLLPYLVAANQVNYGRPWKLNCVEALAACFAIIGRSDWAA 180

Query: 171 ELLSHFSWGMGFLELNKELLEIYQQCTDADSVKRAEEEWLQKLEKETQERKSQAKEEDIW 230
           +LLS+FSWGM FL LN+EL E+Y QCTD+DS++ A+E WL K+++E +ERK QA++ DIW
Sbjct: 181 DLLSNFSWGMNFLTLNEELFELYSQCTDSDSIQEAQEAWLNKIDEEAKERKLQAQDNDIW 240

Query: 231 MMGNINR---RXXXXXXXXXXXXXXXXXXXXXXDKQCVEYDSLGNAI--CIDSINSRXXX 285
           +MGN NR                           ++ V+YD+LGN I    D I  R   
Sbjct: 241 LMGNTNRVNDNLRDLTLSDGDEDEEEEDAEDYLTEKSVKYDNLGNVIESSEDEITLRYDN 300

Query: 286 XXXXXXXXXXXXXXXXPVSYDSLGNLI 312
                              YD+LGNLI
Sbjct: 301 LGNVIEEEEEEKR------YDALGNLI 321

>Kwal_56.22421 s56 complement(120212..121225) [1014 bp, 337 aa] {ON}
           YOR006C - Hypothetical ORF [contig 185] FULL
          Length = 337

 Score =  362 bits (928), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 167/232 (71%), Positives = 201/232 (86%), Gaps = 5/232 (2%)

Query: 12  KNGRPQRGAN----GHSSRQNHRRMEMKY-ENSDKVKFPVKLAMWDFDHCDPKRCSGKKL 66
           K GR  +G+N    GHS+R +   +E K+  +++   FPVKLAMWDFD CDPKRCSGKKL
Sbjct: 3   KGGRSNKGSNKVRTGHSNRSSSGYVETKHGAHNNGRNFPVKLAMWDFDQCDPKRCSGKKL 62

Query: 67  ERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDLEVVEQHGASVVECSWARLEEVPFNKIG 126
           ERLG+IKSLRVGQKFQGIVVSPNGKGVVCP+D ++VE+ GA+VVECSWARL E+PFNKIG
Sbjct: 63  ERLGIIKSLRVGQKFQGIVVSPNGKGVVCPNDKQIVEESGAAVVECSWARLNEIPFNKIG 122

Query: 127 GKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASELLSHFSWGMGFLELN 186
           G++ERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMD A+ELL+HFSWG+GFLELN
Sbjct: 123 GRNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLATELLAHFSWGLGFLELN 182

Query: 187 KELLEIYQQCTDADSVKRAEEEWLQKLEKETQERKSQAKEEDIWMMGNINRR 238
           KEL+E+YQ+CTDA+SVK AE  WL+K+E+E  ER++ +  +D+WM GN+NRR
Sbjct: 183 KELIEVYQKCTDAESVKEAEASWLEKIEREANERRNHSATDDLWMTGNVNRR 234

>KLTH0C11264g Chr3 (925534..926574) [1041 bp, 346 aa] {ON} similar
           to uniprot|Q12094 Saccharomyces cerevisiae YOR006C
           Hypothetical ORF
          Length = 346

 Score =  360 bits (924), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 169/238 (71%), Positives = 203/238 (85%), Gaps = 6/238 (2%)

Query: 2   GKGKNKAHEPKNGRPQRGANGHSSRQNHRRMEMKY-ENSDKVKFPVKLAMWDFDHCDPKR 60
           GKG NK     + +P   ++GH+S   HR +E K+  N     FPVKLAMWDFD CDPKR
Sbjct: 7   GKGSNKQRGAHSSKP---SSGHTS--THRHVESKHGANKSGKNFPVKLAMWDFDQCDPKR 61

Query: 61  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDLEVVEQHGASVVECSWARLEEV 120
           CSGKKLERLG+IKSLRVGQKFQGIVVSPNGK VVCP+D  +VE++GA+VVECSWARL+EV
Sbjct: 62  CSGKKLERLGIIKSLRVGQKFQGIVVSPNGKSVVCPNDRNIVEENGAAVVECSWARLDEV 121

Query: 121 PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASELLSHFSWGM 180
           PFNKIGG++ERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGR+D A+ELLSHFSWG+
Sbjct: 122 PFNKIGGRNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRLDLATELLSHFSWGL 181

Query: 181 GFLELNKELLEIYQQCTDADSVKRAEEEWLQKLEKETQERKSQAKEEDIWMMGNINRR 238
            FLELNKELLE+YQ+CTDADS+K+AE+ WL+++EKE QERK++   +D+W+ GN+N +
Sbjct: 182 QFLELNKELLEVYQRCTDADSIKKAEDAWLEQIEKEAQERKARNPGDDLWLTGNVNHK 239

>KAFR0L00390 Chr12 complement(71329..72318) [990 bp, 329 aa] {ON}
           Anc_6.19 YOR006C
          Length = 329

 Score =  324 bits (830), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 150/228 (65%), Positives = 184/228 (80%), Gaps = 3/228 (1%)

Query: 13  NGRPQRGANGHSSRQNHRRMEMKYENSDKVKFPVKLAMWDFDHCDPKRCSGKKLERLGLI 72
           NG  +  +NGH SR N+++ME K   S +  FPVKLAMWDFDHCDPKRCSGKKLERL LI
Sbjct: 16  NGAIRTNSNGHHSRHNNKKMEFKQHVSRETSFPVKLAMWDFDHCDPKRCSGKKLERLNLI 75

Query: 73  KSLRVGQKFQGIVVSPNGKGVVCPDDLEVVEQHGASVVECSWARLEEVPFNKIGG-KHER 131
           +SL++ QKFQGI VSPNGK  V P+D E+V + G +VVECSWAR++E+PF+K    K +R
Sbjct: 76  RSLKINQKFQGITVSPNGKKFVSPEDRELVTEFGCAVVECSWARIDEIPFSKFSTPKLDR 135

Query: 132 LLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASELLSHFSWGMGFLELNKELLE 191
           LLPYLVAANQVNYGRPW+LNCVEA+AAC AIVG MD A ELLSHFSWG+ FL+LN+ELLE
Sbjct: 136 LLPYLVAANQVNYGRPWKLNCVEAIAACLAIVGFMDLAEELLSHFSWGVNFLKLNRELLE 195

Query: 192 IYQQCTDADSVKRAEEEWLQKLEKETQERKS--QAKEEDIWMMGNINR 237
           IYQQCTD+D ++ A++ W+ ++EKE QERK+   A+  DIWM GN+NR
Sbjct: 196 IYQQCTDSDEIEAAQDAWMDQIEKEVQERKASNNAQNVDIWMSGNVNR 243

>TBLA0A07250 Chr1 complement(1806584..1807498) [915 bp, 304 aa] {ON}
           Anc_6.19 YOR006C
          Length = 304

 Score =  323 bits (827), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 167/314 (53%), Positives = 205/314 (65%), Gaps = 15/314 (4%)

Query: 1   MGKGKNKAHEPKNGRPQRGANGHSSRQNHRRMEMKYENSDKVKFPVKLAMWDFDHCDPKR 60
           M KGKNK HE ++ R       ++SR+N  +  +  + S K  FPVKLAMWDFDHCDPKR
Sbjct: 1   MAKGKNKGHEERSNRKS-----NNSRRNESKHSLSIK-STKTNFPVKLAMWDFDHCDPKR 54

Query: 61  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDLEVVEQHGASVVECSWARLEEV 120
           CSGKKLER GL +SLRVGQ+F G+VVSPNGK VV P D E +EQ+G +VVECSWARL+EV
Sbjct: 55  CSGKKLERTGLAQSLRVGQRFNGMVVSPNGKRVVSPADRETIEQYGIAVVECSWARLDEV 114

Query: 121 PFNKIGGK--HERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASELLSHFSW 178
           PFNK+GGK  +E LLPYLVAAN VNYGRPWRLNCVEA AAC AIVG  ++AS++L  FSW
Sbjct: 115 PFNKLGGKPSNEVLLPYLVAANPVNYGRPWRLNCVEAFAACLAIVGFKEYASKVLEGFSW 174

Query: 179 GMGFLELNKELLEIYQQCTDADSVKRAEEEWLQKLEKETQERKSQAKEEDIWMMGNINRR 238
           G  FLELN ELL+IY  CTD+ SV++A++EWL+K+E E +ERK +    D W++GN NR+
Sbjct: 175 GHAFLELNDELLDIYGNCTDSISVEKAQDEWLEKIELENKERKEKMNSADAWLIGNTNRK 234

Query: 239 XXXXXXXXXXXXXXXXXXXXXXDKQCVEYDSLGNAICIDSINSRXXXXXXXXXXXXXXXX 298
                                 D++   YD+LGN I  DS                    
Sbjct: 235 NLNDFDNSSESTEDNISTVSSADER---YDALGNLISNDS----HSLKYDSLGNVIESEG 287

Query: 299 XXXPVSYDSLGNLI 312
              P  YD LGN+I
Sbjct: 288 DALPPKYDKLGNII 301

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.417 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 29,984,587
Number of extensions: 1183088
Number of successful extensions: 6161
Number of sequences better than 10.0: 30
Number of HSP's gapped: 6210
Number of HSP's successfully gapped: 30
Length of query: 312
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 203
Effective length of database: 40,982,805
Effective search space: 8319509415
Effective search space used: 8319509415
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)