Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_15.1746.18ON94594550450.0
YOR005C (DNL4)6.18ON94494541720.0
Suva_15.1806.18ON94894839020.0
Skud_15.1666.18ON94794538380.0
TDEL0G045106.18ON96994225800.0
NDAI0I022606.18ON96796225660.0
ZYRO0C07854g6.18ON94495125630.0
NCAS0D026506.18ON95094325570.0
KAFR0A050506.18ON94894625400.0
KNAG0F028706.18ON95494724630.0
TPHA0M002606.18ON96695423990.0
CAGL0E02695g6.18ON94693723560.0
Kpol_1032.76.18ON96595323540.0
Kwal_56.224146.18ON96394523030.0
TBLA0G010406.18ON97295322900.0
KLTH0C11286g6.18ON95194621900.0
ACR008W6.18ON98194420540.0
KLLA0D01089g6.18ON90793219070.0
SAKL0F10912g7.343ON6934372995e-27
ACL155W7.343ON6974092915e-26
NDAI0A019407.343ON7654182899e-26
KLLA0D12496g7.343ON7004172862e-25
Kwal_56.246167.343ON7154052782e-24
CAGL0I03410g7.343ON7244412773e-24
YDL164C (CDC9)7.343ON7554142721e-23
Smik_4.747.343ON8452582712e-23
Suva_4.827.343ON7554092692e-23
Kpol_2001.717.343ON7264272657e-23
Skud_4.937.343ON7554142612e-22
TPHA0D045707.343ON7364222612e-22
KLTH0H01408g7.343ON7234052603e-22
TBLA0E020507.343ON7204012603e-22
KAFR0B008307.343ON7104132584e-22
TDEL0C020407.343ON7054372585e-22
KNAG0C037407.343ON7274122461e-20
ZYRO0F11572g7.343ON7314042425e-20
NCAS0A141107.343ON7532832425e-20
CAGL0E05588g7.46ON887901020.002
NDAI0E039307.46ON102867920.035
KNAG0E004107.46ON817137910.036
Suva_8.4007.46ON98567890.069
KAFR0C051907.46ON89693870.11
Ecym_21886.228ON461105860.14
Ecym_63411.276ON76794850.19
NCAS0E023707.46ON89767830.33
KLLA0F23375g7.46ON829136830.34
Ecym_50527.46ON87366820.46
ZYRO0E07150g6.228ON449107810.53
TPHA0D030203.447ON588117800.82
AFR095C1.276ON67094781.2
YOR346W (REV1)7.46ON985149781.4
AEL073C1.468ON718111781.4
TDEL0E053706.228ON457107752.6
ADR369C7.46ON82773762.7
TPHA0E027706.228ON450107753.0
KLLA0B02200g6.228ON466105753.1
SAKL0B06600g3.311ON98487753.5
ZYRO0G15180g1.276ON68863734.9
KLTH0E15356g1.254ON982119735.6
NDAI0F036902.29ON911164726.6
TBLA0A020706.228ON453105726.9
CAGL0K05137g7.433ON121286728.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_15.174
         (945 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_15.174 Chr15 complement(301851..304688) [2838 bp, 945 aa] {...  1947   0.0  
YOR005C Chr15 complement(334509..337343) [2835 bp, 944 aa] {ON} ...  1611   0.0  
Suva_15.180 Chr15 complement(308983..311829) [2847 bp, 948 aa] {...  1507   0.0  
Skud_15.166 Chr15 complement(294550..297393) [2844 bp, 947 aa] {...  1483   0.0  
TDEL0G04510 Chr7 (819479..822388) [2910 bp, 969 aa] {ON} Anc_6.1...   998   0.0  
NDAI0I02260 Chr9 complement(514711..517614) [2904 bp, 967 aa] {O...   993   0.0  
ZYRO0C07854g Chr3 (595546..598380) [2835 bp, 944 aa] {ON} simila...   991   0.0  
NCAS0D02650 Chr4 (508606..511458) [2853 bp, 950 aa] {ON} Anc_6.1...   989   0.0  
KAFR0A05050 Chr1 (1003515..1006361) [2847 bp, 948 aa] {ON} Anc_6...   983   0.0  
KNAG0F02870 Chr6 (543177..546041) [2865 bp, 954 aa] {ON} Anc_6.1...   953   0.0  
TPHA0M00260 Chr13 complement(50326..53226) [2901 bp, 966 aa] {ON...   928   0.0  
CAGL0E02695g Chr5 complement(254591..257431) [2841 bp, 946 aa] {...   912   0.0  
Kpol_1032.7 s1032 complement(12295..15192) [2898 bp, 965 aa] {ON...   911   0.0  
Kwal_56.22414 s56 complement(117198..120089) [2892 bp, 963 aa] {...   891   0.0  
TBLA0G01040 Chr7 complement(258966..261884) [2919 bp, 972 aa] {O...   886   0.0  
KLTH0C11286g Chr3 (926742..929597) [2856 bp, 951 aa] {ON} simila...   848   0.0  
ACR008W Chr3 (368913..371858) [2946 bp, 981 aa] {ON} Syntenic ho...   795   0.0  
KLLA0D01089g Chr4 complement(97438..100161) [2724 bp, 907 aa] {O...   739   0.0  
SAKL0F10912g Chr6 complement(854430..856511) [2082 bp, 693 aa] {...   119   5e-27
ACL155W Chr3 (81492..83585) [2094 bp, 697 aa] {ON} Syntenic homo...   116   5e-26
NDAI0A01940 Chr1 complement(432302..434599) [2298 bp, 765 aa] {O...   115   9e-26
KLLA0D12496g Chr4 complement(1059684..1061786) [2103 bp, 700 aa]...   114   2e-25
Kwal_56.24616 s56 (1076178..1078325) [2148 bp, 715 aa] {ON} YDL1...   111   2e-24
CAGL0I03410g Chr9 complement(289606..291780) [2175 bp, 724 aa] {...   111   3e-24
YDL164C Chr4 complement(164987..167254) [2268 bp, 755 aa] {ON}  ...   109   1e-23
Smik_4.74 Chr4 complement(141744..144281) [2538 bp, 845 aa] {ON}...   108   2e-23
Suva_4.82 Chr4 complement(152544..154811) [2268 bp, 755 aa] {ON}...   108   2e-23
Kpol_2001.71 s2001 (195103..197283) [2181 bp, 726 aa] {ON} (1951...   106   7e-23
Skud_4.93 Chr4 complement(160642..162909) [2268 bp, 755 aa] {ON}...   105   2e-22
TPHA0D04570 Chr4 (996539..998749) [2211 bp, 736 aa] {ON} Anc_7.3...   105   2e-22
KLTH0H01408g Chr8 complement(129752..131923) [2172 bp, 723 aa] {...   104   3e-22
TBLA0E02050 Chr5 (498038..500200) [2163 bp, 720 aa] {ON} Anc_7.3...   104   3e-22
KAFR0B00830 Chr2 (157155..159287) [2133 bp, 710 aa] {ON} Anc_7.3...   103   4e-22
TDEL0C02040 Chr3 complement(352579..354696) [2118 bp, 705 aa] {O...   103   5e-22
KNAG0C03740 Chr3 (737968..740151) [2184 bp, 727 aa] {ON} Anc_7.3...    99   1e-20
ZYRO0F11572g Chr6 (949236..951431) [2196 bp, 731 aa] {ON} simila...    98   5e-20
NCAS0A14110 Chr1 (2774465..2776726) [2262 bp, 753 aa] {ON} Anc_7...    98   5e-20
CAGL0E05588g Chr5 (551061..553724) [2664 bp, 887 aa] {ON} simila...    44   0.002
NDAI0E03930 Chr5 (868403..871489) [3087 bp, 1028 aa] {ON} Anc_7....    40   0.035
KNAG0E00410 Chr5 complement(65732..68185) [2454 bp, 817 aa] {ON}...    40   0.036
Suva_8.400 Chr8 (717697..720654) [2958 bp, 985 aa] {ON} YOR346W ...    39   0.069
KAFR0C05190 Chr3 (1031636..1034326) [2691 bp, 896 aa] {ON} Anc_7...    38   0.11 
Ecym_2188 Chr2 (371869..373254) [1386 bp, 461 aa] {ON} similar t...    38   0.14 
Ecym_6341 Chr6 (656835..659138) [2304 bp, 767 aa] {ON} similar t...    37   0.19 
NCAS0E02370 Chr5 (464339..467032) [2694 bp, 897 aa] {ON} Anc_7.4...    37   0.33 
KLLA0F23375g Chr6 (2181986..2184475) [2490 bp, 829 aa] {ON} simi...    37   0.34 
Ecym_5052 Chr5 (112351..114972) [2622 bp, 873 aa] {ON} similar t...    36   0.46 
ZYRO0E07150g Chr5 complement(540507..541856) [1350 bp, 449 aa] {...    36   0.53 
TPHA0D03020 Chr4 (629502..631268) [1767 bp, 588 aa] {ON} Anc_3.4...    35   0.82 
AFR095C Chr6 complement(604687..606699) [2013 bp, 670 aa] {ON} S...    35   1.2  
YOR346W Chr15 (981828..984785) [2958 bp, 985 aa] {ON}  REV1Deoxy...    35   1.4  
AEL073C Chr5 complement(489107..491263) [2157 bp, 718 aa] {ON} S...    35   1.4  
TDEL0E05370 Chr5 complement(982429..983802) [1374 bp, 457 aa] {O...    33   2.6  
ADR369C Chr4 complement(1362309..1364792) [2484 bp, 827 aa] {ON}...    34   2.7  
TPHA0E02770 Chr5 (580118..581470) [1353 bp, 450 aa] {ON} Anc_6.2...    33   3.0  
KLLA0B02200g Chr2 (196341..197741) [1401 bp, 466 aa] {ON} highly...    33   3.1  
SAKL0B06600g Chr2 (569406..572360) [2955 bp, 984 aa] {ON} highly...    33   3.5  
ZYRO0G15180g Chr7 (1223984..1226050) [2067 bp, 688 aa] {ON} simi...    33   4.9  
KLTH0E15356g Chr5 (1358408..1361356) [2949 bp, 982 aa] {ON} some...    33   5.6  
NDAI0F03690 Chr6 complement(877227..879962) [2736 bp, 911 aa] {O...    32   6.6  
TBLA0A02070 Chr1 complement(499281..500642) [1362 bp, 453 aa] {O...    32   6.9  
CAGL0K05137g Chr11 (500434..504072) [3639 bp, 1212 aa] {ON} simi...    32   8.4  

>Smik_15.174 Chr15 complement(301851..304688) [2838 bp, 945 aa] {ON}
           YOR005C (REAL)
          Length = 945

 Score = 1947 bits (5045), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 945/945 (100%), Positives = 945/945 (100%)

Query: 1   MVSTLDSVPEPQNFAPSPDFKWLCEELFSKIDEVQVKGTIGTGKSRSFKYYEVLSNFVEM 60
           MVSTLDSVPEPQNFAPSPDFKWLCEELFSKIDEVQVKGTIGTGKSRSFKYYEVLSNFVEM
Sbjct: 1   MVSTLDSVPEPQNFAPSPDFKWLCEELFSKIDEVQVKGTIGTGKSRSFKYYEVLSNFVEM 60

Query: 61  WRKTVGNNIYPALILALPYRDRRIYNIKDYVLIRTICSYLKLPKNSATEGRLKDWKQRVG 120
           WRKTVGNNIYPALILALPYRDRRIYNIKDYVLIRTICSYLKLPKNSATEGRLKDWKQRVG
Sbjct: 61  WRKTVGNNIYPALILALPYRDRRIYNIKDYVLIRTICSYLKLPKNSATEGRLKDWKQRVG 120

Query: 121 KGKNLSSLLVEEIAKRRSEPNGKAITIDGINSTLDELSKDRSTSGRGFKNLVKSSPFLHC 180
           KGKNLSSLLVEEIAKRRSEPNGKAITIDGINSTLDELSKDRSTSGRGFKNLVKSSPFLHC
Sbjct: 121 KGKNLSSLLVEEIAKRRSEPNGKAITIDGINSTLDELSKDRSTSGRGFKNLVKSSPFLHC 180

Query: 181 LESMSFVELKYFFDILLKSRVIGGQEHKFLSCWHPDAQDYLSVVSDLKVVASKLYDPRVR 240
           LESMSFVELKYFFDILLKSRVIGGQEHKFLSCWHPDAQDYLSVVSDLKVVASKLYDPRVR
Sbjct: 181 LESMSFVELKYFFDILLKSRVIGGQEHKFLSCWHPDAQDYLSVVSDLKVVASKLYDPRVR 240

Query: 241 LKNDDLTIKVGFAFAPQLAKKVNLPYEKICRALHNDFLVEEKMDGERIQVHYMNYGKSVR 300
           LKNDDLTIKVGFAFAPQLAKKVNLPYEKICRALHNDFLVEEKMDGERIQVHYMNYGKSVR
Sbjct: 241 LKNDDLTIKVGFAFAPQLAKKVNLPYEKICRALHNDFLVEEKMDGERIQVHYMNYGKSVR 300

Query: 301 FYSRRGIDYTYLYGASLSSGTISHHLDFTDNVRECVLDGEMVTFDARRKVILPFGLVKGS 360
           FYSRRGIDYTYLYGASLSSGTISHHLDFTDNVRECVLDGEMVTFDARRKVILPFGLVKGS
Sbjct: 301 FYSRRGIDYTYLYGASLSSGTISHHLDFTDNVRECVLDGEMVTFDARRKVILPFGLVKGS 360

Query: 361 AKDALSFNSINNVDFHPLYVVFDLLYLNGTSLTPLPLHQRKEYLESILTPVKNVVEMVRT 420
           AKDALSFNSINNVDFHPLYVVFDLLYLNGTSLTPLPLHQRKEYLESILTPVKNVVEMVRT
Sbjct: 361 AKDALSFNSINNVDFHPLYVVFDLLYLNGTSLTPLPLHQRKEYLESILTPVKNVVEMVRT 420

Query: 421 SRCYNVESIKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPEYLEEFGENLDLV 480
           SRCYNVESIKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPEYLEEFGENLDLV
Sbjct: 421 SRCYNVESIKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPEYLEEFGENLDLV 480

Query: 481 IIGRDPGKKDSFMLGLLLLNEKEMDKRDQEVSSGIANNSKNENILYSQKKVKKILSFCSV 540
           IIGRDPGKKDSFMLGLLLLNEKEMDKRDQEVSSGIANNSKNENILYSQKKVKKILSFCSV
Sbjct: 481 IIGRDPGKKDSFMLGLLLLNEKEMDKRDQEVSSGIANNSKNENILYSQKKVKKILSFCSV 540

Query: 541 ANGISQEEFKEIDRKTRGCWKKTSEVAPPASIFEFGSKIPAEWIEPNESIVLEIKSRSLD 600
           ANGISQEEFKEIDRKTRGCWKKTSEVAPPASIFEFGSKIPAEWIEPNESIVLEIKSRSLD
Sbjct: 541 ANGISQEEFKEIDRKTRGCWKKTSEVAPPASIFEFGSKIPAEWIEPNESIVLEIKSRSLD 600

Query: 601 NTETNMQKYATSCTLYGGYCKRIRFDKDWTDCFTLNELYDSRSARFNPSYQAEKSHLKLV 660
           NTETNMQKYATSCTLYGGYCKRIRFDKDWTDCFTLNELYDSRSARFNPSYQAEKSHLKLV
Sbjct: 601 NTETNMQKYATSCTLYGGYCKRIRFDKDWTDCFTLNELYDSRSARFNPSYQAEKSHLKLV 660

Query: 661 RKKRREVLTSNTFDQKTEQIPTSIIFAGLYFYVLSDYVTNASEVRITRGELENAIVRHGG 720
           RKKRREVLTSNTFDQKTEQIPTSIIFAGLYFYVLSDYVTNASEVRITRGELENAIVRHGG
Sbjct: 661 RKKRREVLTSNTFDQKTEQIPTSIIFAGLYFYVLSDYVTNASEVRITRGELENAIVRHGG 720

Query: 721 RLIYNIILKRHYIGDVRLISCKNTTECRALINRGYDILHPSWVIDCVAYKKLIPIEPCYC 780
           RLIYNIILKRHYIGDVRLISCKNTTECRALINRGYDILHPSWVIDCVAYKKLIPIEPCYC
Sbjct: 721 RLIYNIILKRHYIGDVRLISCKNTTECRALINRGYDILHPSWVIDCVAYKKLIPIEPCYC 780

Query: 781 FNVSQKMRAVAEKRVDCLGDSFENDISETKLSLLYKSQHNLPPPEEVERDAEVQVFPLFL 840
           FNVSQKMRAVAEKRVDCLGDSFENDISETKLSLLYKSQHNLPPPEEVERDAEVQVFPLFL
Sbjct: 781 FNVSQKMRAVAEKRVDCLGDSFENDISETKLSLLYKSQHNLPPPEEVERDAEVQVFPLFL 840

Query: 841 FSNRIVYIPPRKIGMKYEKTLEMKIRLFGGKITDRQSLCNLVIIPYGDPTWRKDCIKEVN 900
           FSNRIVYIPPRKIGMKYEKTLEMKIRLFGGKITDRQSLCNLVIIPYGDPTWRKDCIKEVN
Sbjct: 841 FSNRIVYIPPRKIGMKYEKTLEMKIRLFGGKITDRQSLCNLVIIPYGDPTWRKDCIKEVN 900

Query: 901 EQIKEQVKALDTIPKIPRIVAPEWVDHSIYGNCQVPEEDFPVVTY 945
           EQIKEQVKALDTIPKIPRIVAPEWVDHSIYGNCQVPEEDFPVVTY
Sbjct: 901 EQIKEQVKALDTIPKIPRIVAPEWVDHSIYGNCQVPEEDFPVVTY 945

>YOR005C Chr15 complement(334509..337343) [2835 bp, 944 aa] {ON}
           DNL4DNA ligase required for nonhomologous end-joining
           (NHEJ), forms stable heterodimer with required cofactor
           Lif1p, interacts with Nej1p; involved in meiosis, not
           essential for vegetative growth
          Length = 944

 Score = 1611 bits (4172), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 765/945 (80%), Positives = 861/945 (91%), Gaps = 1/945 (0%)

Query: 1   MVSTLDSVPEPQNFAPSPDFKWLCEELFSKIDEVQVKGTIGTGKSRSFKYYEVLSNFVEM 60
           M+S LDS+PEPQNFAPSPDFKWLCEELF KI EVQ+ GT GTGKSRSFKYYE++SNFVEM
Sbjct: 1   MISALDSIPEPQNFAPSPDFKWLCEELFVKIHEVQINGTAGTGKSRSFKYYEIISNFVEM 60

Query: 61  WRKTVGNNIYPALILALPYRDRRIYNIKDYVLIRTICSYLKLPKNSATEGRLKDWKQRVG 120
           WRKTVGNNIYPAL+LALPYRDRRIYNIKDYVLIRTICSYLKLPKNSATE RLKDWKQRVG
Sbjct: 61  WRKTVGNNIYPALVLALPYRDRRIYNIKDYVLIRTICSYLKLPKNSATEQRLKDWKQRVG 120

Query: 121 KGKNLSSLLVEEIAKRRSEPNGKAITIDGINSTLDELSKDRSTSGRGFKNLVKSSPFLHC 180
           KG NLSSLLVEEIAKRR+EP+ KAITID +N  LD LS DR  SGRGFK+LVKS PFLHC
Sbjct: 121 KGGNLSSLLVEEIAKRRAEPSSKAITIDNVNHYLDSLSGDRFASGRGFKSLVKSKPFLHC 180

Query: 181 LESMSFVELKYFFDILLKSRVIGGQEHKFLSCWHPDAQDYLSVVSDLKVVASKLYDPRVR 240
           +E+MSFVELKYFFDI+LK+RVIGGQEHK L+CWHPDAQDYLSV+SDLKVV SKLYDP+VR
Sbjct: 181 VENMSFVELKYFFDIVLKNRVIGGQEHKLLNCWHPDAQDYLSVISDLKVVTSKLYDPKVR 240

Query: 241 LKNDDLTIKVGFAFAPQLAKKVNLPYEKICRALHNDFLVEEKMDGERIQVHYMNYGKSVR 300
           LK+DDL+IKVGFAFAPQLAKKVNL YEKICR LH+DFLVEEKMDGERIQVHYMNYG+S++
Sbjct: 241 LKDDDLSIKVGFAFAPQLAKKVNLSYEKICRTLHDDFLVEEKMDGERIQVHYMNYGESIK 300

Query: 301 FYSRRGIDYTYLYGASLSSGTISHHLDFTDNVRECVLDGEMVTFDARRKVILPFGLVKGS 360
           F+SRRGIDYTYLYGASLSSGTIS HL FTD+V+ECVLDGEMVTFDA+R+VILPFGLVKGS
Sbjct: 301 FFSRRGIDYTYLYGASLSSGTISQHLRFTDSVKECVLDGEMVTFDAKRRVILPFGLVKGS 360

Query: 361 AKDALSFNSINNVDFHPLYVVFDLLYLNGTSLTPLPLHQRKEYLESILTPVKNVVEMVRT 420
           AK+ALSFNSINNVDFHPLY+VFDLLYLNGTSLTPLPLHQRK+YL SIL+P+KN+VE+VR+
Sbjct: 361 AKEALSFNSINNVDFHPLYMVFDLLYLNGTSLTPLPLHQRKQYLNSILSPLKNIVEIVRS 420

Query: 421 SRCYNVESIKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPEYLEEFGENLDLV 480
           SRCY VESIKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPEYLEEFGENLDL+
Sbjct: 421 SRCYGVESIKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPEYLEEFGENLDLI 480

Query: 481 IIGRDPGKKDSFMLGLLLLNEKEMDKRDQEVSSGIANNSKNENILYSQKKVKKILSFCSV 540
           +IGRD GKKDSFMLGLL+L+E+E  K   + S  + ++S+ ++I  S+++VKKILSFCS+
Sbjct: 481 VIGRDSGKKDSFMLGLLVLDEEEYKKHQGDSSEIVDHSSQEKHIQNSRRRVKKILSFCSI 540

Query: 541 ANGISQEEFKEIDRKTRGCWKKTSEVAPPASIFEFGSKIPAEWIEPNESIVLEIKSRSLD 600
           ANGISQEEFKEIDRKTRG WK+TSEVAPPASI EFGSKIPAEWI+P+ESIVLEIKSRSLD
Sbjct: 541 ANGISQEEFKEIDRKTRGHWKRTSEVAPPASILEFGSKIPAEWIDPSESIVLEIKSRSLD 600

Query: 601 NTETNMQKYATSCTLYGGYCKRIRFDKDWTDCFTLNELYDSRSARFNPSYQAEKSHLKLV 660
           NTETNMQKYAT+CTLYGGYCKRIR+DK+WTDC+TLN+LY+SR+ + NPSYQAE+S L L+
Sbjct: 601 NTETNMQKYATNCTLYGGYCKRIRYDKEWTDCYTLNDLYESRTVKSNPSYQAERSQLGLI 660

Query: 661 RKKRREVLTSNTFDQKTEQIPTSIIFAGLYFYVLSDYVTNASEVRITRGELENAIVRHGG 720
           RKKR+ VL S++F Q  +Q+P S IFAGL FYVLSDYVT  + +RITR ELE  IV HGG
Sbjct: 661 RKKRKRVLISDSFHQNRKQLPISNIFAGLLFYVLSDYVTEDTGIRITRAELEKTIVEHGG 720

Query: 721 RLIYNIILKRHYIGDVRLISCKNTTECRALINRGYDILHPSWVIDCVAYKKLIPIEPCYC 780
           +LIYN+ILKRH IGDVRLISCK TTEC+ALI+RGYDILHP+WV+DC+AYK+LI IEP YC
Sbjct: 721 KLIYNVILKRHSIGDVRLISCKTTTECKALIDRGYDILHPNWVLDCIAYKRLILIEPNYC 780

Query: 781 FNVSQKMRAVAEKRVDCLGDSFENDISETKLSLLYKSQHNLPPPEEVERDAEVQVFPLFL 840
           FNVSQKMRAVAEKRVDCLGDSFENDISETKLS LYKSQ +LPP  E+E D+EV+ FPLFL
Sbjct: 781 FNVSQKMRAVAEKRVDCLGDSFENDISETKLSSLYKSQLSLPPMGELEIDSEVRRFPLFL 840

Query: 841 FSNRIVYIPPRKIGMKYEKTLEMKIRLFGGKITDRQSLCNLVIIPYGDPTWRKDCIKEVN 900
           FSNRI Y+P RKI  + +  +EMKI+LFGGKITD+QSLCNL+IIPY DP  RKDC+ EV+
Sbjct: 841 FSNRIAYVPRRKISTE-DDIIEMKIKLFGGKITDQQSLCNLIIIPYTDPILRKDCMNEVH 899

Query: 901 EQIKEQVKALDTIPKIPRIVAPEWVDHSIYGNCQVPEEDFPVVTY 945
           E+IKEQ+KA DTIPKI R+VAPEWVDHSI  NCQVPEEDFPVV Y
Sbjct: 900 EKIKEQIKASDTIPKIARVVAPEWVDHSINENCQVPEEDFPVVNY 944

>Suva_15.180 Chr15 complement(308983..311829) [2847 bp, 948 aa] {ON}
           YOR005C (REAL)
          Length = 948

 Score = 1507 bits (3902), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 718/948 (75%), Positives = 823/948 (86%), Gaps = 3/948 (0%)

Query: 1   MVSTLDSVPEPQNFAPSPDFKWLCEELFSKIDEVQVKGTIGTGKSRSFKYYEVLSNFVEM 60
           M S L ++PEP NFAPSPDF+WLCEELF+K++EV + GT GTGKS SF+YYE++SNF E+
Sbjct: 1   MASALQAIPEPHNFAPSPDFRWLCEELFAKVEEVLINGTAGTGKSVSFRYYEIISNFTEL 60

Query: 61  WRKTVGNNIYPALILALPYRDRRIYNIKDYVLIRTICSYLKLPKNSATEGRLKDWKQRVG 120
           WRKTVGNNIYPALILALPYRDRRIYNIKDYVLIRT+CSYLKLPKNS TE RLKDWKQRVG
Sbjct: 61  WRKTVGNNIYPALILALPYRDRRIYNIKDYVLIRTVCSYLKLPKNSPTEQRLKDWKQRVG 120

Query: 121 KGKNLSSLLVEEIAKRRSEPNGKAITIDGINSTLDELSKDRSTSGRGFKNLVKSSPFLHC 180
           KG++LSSLLVEEI+KRR+EP  K+IT+D +N  LDELSK+ + SGRGFKNLVKS PFLHC
Sbjct: 121 KGRSLSSLLVEEISKRRTEPTRKSITVDSVNFYLDELSKEMNASGRGFKNLVKSKPFLHC 180

Query: 181 LESMSFVELKYFFDILLKSRVIGGQEHKFLSCWHPDAQDYLSVVSDLKVVASKLYDPRVR 240
           LE+M+FVELK+FFDILLK+RVIGGQEHK L+CWHPDAQDYLSVVSDL+VV SKLYDP +R
Sbjct: 181 LENMTFVELKFFFDILLKNRVIGGQEHKLLNCWHPDAQDYLSVVSDLRVVTSKLYDPDIR 240

Query: 241 LKNDDLTIKVGFAFAPQLAKKVNLPYEKICRALHNDFLVEEKMDGERIQVHYMNYGKSVR 300
           LKNDDL+IKVGFAFAPQLAKKVNL YEKIC AL NDF VEEKMDGERIQVHYMNYGKS++
Sbjct: 241 LKNDDLSIKVGFAFAPQLAKKVNLSYEKICHALRNDFFVEEKMDGERIQVHYMNYGKSIK 300

Query: 301 FYSRRGIDYTYLYGASLSSGTISHHLDFTDNVRECVLDGEMVTFDARRKVILPFGLVKGS 360
           F+SRRGIDYTYLYG +L SGTIS +L F+D+V+ECVLDGEMVTFDA RKVILPFGLVKGS
Sbjct: 301 FFSRRGIDYTYLYGVNLLSGTISQYLKFSDSVKECVLDGEMVTFDAMRKVILPFGLVKGS 360

Query: 361 AKDALSFNSINNVDFHPLYVVFDLLYLNGTSLTPLPLHQRKEYLESILTPVKNVVEMVRT 420
           AK+ALSFN INN DFHPLY+VFDLLYLNGTSLTPLPL+QRKEYL SIL P K+VVE+VR 
Sbjct: 361 AKEALSFNDINNNDFHPLYMVFDLLYLNGTSLTPLPLYQRKEYLSSILIPSKSVVEIVRY 420

Query: 421 SRCYNVESIKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPEYLEEFGENLDLV 480
           SRCY+ ES+KKSLEVAISLGSEGVVLK+Y+SSYNVASRNNNWIKVKPEYLEEFGENLDL+
Sbjct: 421 SRCYDAESVKKSLEVAISLGSEGVVLKHYSSSYNVASRNNNWIKVKPEYLEEFGENLDLI 480

Query: 481 IIGRDPGKKDSFMLGLLLLNEKEMDKRDQEVSSGIANNSKNE-NILYSQKKVKKILSFCS 539
           IIGRD GKKDSFMLGLL+++E+E  K DQE  S I N+S  E      +K+V+K+LSFCS
Sbjct: 481 IIGRDSGKKDSFMLGLLVVDEQETGKTDQEGPSEILNDSSTERRATNPKKRVRKVLSFCS 540

Query: 540 VANGISQEEFKEIDRKTRGCWKKTSEVAPPASIFEFGSKIPAEWIEPNESIVLEIKSRSL 599
           +ANGISQEEFKEIDRKTRG WKKTS ++PP SI EFGSK+PAEWIEP+ESIVLEIKSRSL
Sbjct: 541 IANGISQEEFKEIDRKTRGHWKKTSGLSPPPSILEFGSKLPAEWIEPSESIVLEIKSRSL 600

Query: 600 DNTETNMQKYATSCTLYGGYCKRIRFDKDWTDCFTLNELYDSRSARFNPSYQAEKSHLKL 659
           DNTETNMQKYAT+CTLYGGYC+RIR+DKDWT+C+TL+ELY++R  + NPS+Q E   L+L
Sbjct: 601 DNTETNMQKYATNCTLYGGYCRRIRYDKDWTECYTLDELYENRRTKSNPSHQVENLQLQL 660

Query: 660 VRKKRREVLTSNTFDQKTEQIPTSIIFAGLYFYVLSDYVTNASEVRITRGELENAIVRHG 719
           V KKR+  L S+ F Q  EQ P S +FAGL+FYVLSDY+ + + VRITR EL + IV+HG
Sbjct: 661 VPKKRKRALVSDPFQQSREQKPISGVFAGLFFYVLSDYINSVTGVRITRSELNDVIVKHG 720

Query: 720 GRLIYNIILKRHYIGDVRLISCKNTTECRALINRGYDILHPSWVIDCVAYKKLIPIEPCY 779
           G+LI+N+ILKRH IGDVRLI CK T ECRALI+RGYDILHP W++DC AY KL+PIEP Y
Sbjct: 721 GKLIHNVILKRHCIGDVRLIGCKLTRECRALIDRGYDILHPRWIMDCTAYNKLLPIEPSY 780

Query: 780 CFNVSQKMRAVAEKRVDCLGDSFENDISETKLSLLYKSQHNLPPPEEVERDAEVQVFPLF 839
           CF+VS K+RAVA +RVDC GDSFENDISE+KLS L KSQ +L    + ++  E+Q+ PLF
Sbjct: 781 CFSVSGKLRAVARRRVDCFGDSFENDISESKLSSLQKSQPDLLSTRQADKSFELQIIPLF 840

Query: 840 LFSNRIVYIPPRKIGMKYEKTLEMKIRLFGGKITDRQSLCNLVIIPYGDPTWRKDCIKEV 899
           LFSNRIVYIP  KIG K E  LEMKIRLFGGKITD+QSL NL+IIPY DP WR DC++EV
Sbjct: 841 LFSNRIVYIPRSKIGPKDEMLLEMKIRLFGGKITDQQSLSNLIIIPYADPIWRGDCLEEV 900

Query: 900 NEQIKEQVKA--LDTIPKIPRIVAPEWVDHSIYGNCQVPEEDFPVVTY 945
           + QI E VKA   DT+P+IPRIV PEWVDHSI  NCQVPEEDFPV  Y
Sbjct: 901 HSQINEHVKASNSDTVPRIPRIVTPEWVDHSISENCQVPEEDFPVSHY 948

>Skud_15.166 Chr15 complement(294550..297393) [2844 bp, 947 aa] {ON}
           YOR005C (REAL)
          Length = 947

 Score = 1483 bits (3838), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 717/945 (75%), Positives = 828/945 (87%), Gaps = 3/945 (0%)

Query: 1   MVSTLDSVPEPQNFAPSPDFKWLCEELFSKIDEVQVKGTIGTGKSRSFKYYEVLSNFVEM 60
           M    + +PEPQNFAPSPDFKWLCEELF +ID V++ GT GTGKS SFKYYE++SNFVE 
Sbjct: 1   MTPAPEFIPEPQNFAPSPDFKWLCEELFVRIDNVRINGTAGTGKSASFKYYEIISNFVES 60

Query: 61  WRKTVGNNIYPALILALPYRDRRIYNIKDYVLIRTICSYLKLPKNSATEGRLKDWKQRVG 120
           WRK VGNNIYPAL+LALPYRDRRIYNIKDY+LIRTICSYLKLP+NS TE RLK WKQRV 
Sbjct: 61  WRKGVGNNIYPALVLALPYRDRRIYNIKDYILIRTICSYLKLPRNSVTEQRLKSWKQRVS 120

Query: 121 KGKNLSSLLVEEIAKRRSEPNGKAITIDGINSTLDELSKDRSTSGRGFKNLVKSSPFLHC 180
           + +NLSSLLVEEIAKRR EPNGK+ITIDG+N  LDELSK+RS SGRGFK+LV S PFL C
Sbjct: 121 RARNLSSLLVEEIAKRRPEPNGKSITIDGVNDYLDELSKERSISGRGFKDLVNSKPFLSC 180

Query: 181 LESMSFVELKYFFDILLKSRVIGGQEHKFLSCWHPDAQDYLSVVSDLKVVASKLYDPRVR 240
           LESMSFVELKYFFDI+LK+RVIGGQEH+FL+CWHPDAQDYLSVVSDLKVV SKLYDPRVR
Sbjct: 181 LESMSFVELKYFFDIVLKNRVIGGQEHRFLNCWHPDAQDYLSVVSDLKVVTSKLYDPRVR 240

Query: 241 LKNDDLTIKVGFAFAPQLAKKVNLPYEKICRALHNDFLVEEKMDGERIQVHYMNYGKSVR 300
           LKNDDL+IKVGFAFAPQLAKKV+LPYEKICRALHNDFL+EEKMDGERIQVHYMNYGKS++
Sbjct: 241 LKNDDLSIKVGFAFAPQLAKKVSLPYEKICRALHNDFLIEEKMDGERIQVHYMNYGKSIK 300

Query: 301 FYSRRGIDYTYLYGASLSSGTISHHLDFTDNVRECVLDGEMVTFDARRKVILPFGLVKGS 360
           F+SRRGIDYTYLYGASLSSGTIS +L  T+ V+ECVLDGEMVTFD+ RKVILPFGLVKGS
Sbjct: 301 FFSRRGIDYTYLYGASLSSGTISQYLKLTNTVKECVLDGEMVTFDSTRKVILPFGLVKGS 360

Query: 361 AKDALSFNSINNVDFHPLYVVFDLLYLNGTSLTPLPLHQRKEYLESILTPVKNVVEMVRT 420
           AK  LS + INN DF PLY+VFDLLYLN  SL PLPLHQRK+YL SILTP KNVVE+V++
Sbjct: 361 AKGVLSCSDINNSDFRPLYMVFDLLYLNEISLAPLPLHQRKKYLSSILTPFKNVVEIVQS 420

Query: 421 SRCYNVESIKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPEYLEEFGENLDLV 480
           +RCY+V+S+K SLEVAISLGSEGVVLKYYNSSYN+ASRN NWIKVKPEYLEEFGENLDL+
Sbjct: 421 TRCYDVQSVKNSLEVAISLGSEGVVLKYYNSSYNIASRNYNWIKVKPEYLEEFGENLDLI 480

Query: 481 IIGRDPGKKDSFMLGLLLLNEKEMDKRDQEVSSG-IANNSKNE-NILYSQKKVKKILSFC 538
           IIGRD GKKDSFMLGLL+++E+EM++RDQE+SS  + N+SK E +++ S+KKVKK+LSFC
Sbjct: 481 IIGRDSGKKDSFMLGLLVIDEREMEERDQELSSSEVVNDSKIEQDVINSKKKVKKVLSFC 540

Query: 539 SVANGISQEEFKEIDRKTRGCWKKTSEVAPPASIFEFGSKIPAEWIEPNESIVLEIKSRS 598
           SVANGIS EEFKEI+R+TRG WK+TS+ +PP SI +FGS+IPAEWIEP++SIVLEIKSRS
Sbjct: 541 SVANGISHEEFKEINRRTRGHWKRTSDFSPP-SILQFGSRIPAEWIEPSDSIVLEIKSRS 599

Query: 599 LDNTETNMQKYATSCTLYGGYCKRIRFDKDWTDCFTLNELYDSRSARFNPSYQAEKSHLK 658
           LDNTET++++YATSCTLYGGYC+RIR+DKDWTDC+TL +LY+ R  +  P+ Q E   L+
Sbjct: 600 LDNTETSIRRYATSCTLYGGYCRRIRYDKDWTDCYTLAQLYEDRPIKSKPNQQDENFQLQ 659

Query: 659 LVRKKRREVLTSNTFDQKTEQIPTSIIFAGLYFYVLSDYVTNASEVRITRGELENAIVRH 718
           L  KKR+  L S+ F Q  EQ   S IFAGL+FYVLSDYVT  + VRITR  LE+AIV+H
Sbjct: 660 LAHKKRKRALISDPFHQIREQKLISSIFAGLFFYVLSDYVTKDTGVRITRAGLEDAIVKH 719

Query: 719 GGRLIYNIILKRHYIGDVRLISCKNTTECRALINRGYDILHPSWVIDCVAYKKLIPIEPC 778
           GG+LI+N+ILKRH IGDVRLISCK T ECR LI+RGYDI+HPSWV+DC+AYK+LI IEP 
Sbjct: 720 GGKLIHNVILKRHCIGDVRLISCKTTIECRILIDRGYDIVHPSWVMDCIAYKQLIFIEPS 779

Query: 779 YCFNVSQKMRAVAEKRVDCLGDSFENDISETKLSLLYKSQHNLPPPEEVERDAEVQVFPL 838
           YCF+VS K+R VAEKRVDCLGDSFEN+ISE KLSLL+KS+ +L    E+  D+E QV PL
Sbjct: 780 YCFSVSHKLREVAEKRVDCLGDSFENNISERKLSLLFKSRQDLSSIGEIGIDSEAQVIPL 839

Query: 839 FLFSNRIVYIPPRKIGMKYEKTLEMKIRLFGGKITDRQSLCNLVIIPYGDPTWRKDCIKE 898
           FLFSNRIVYIP  K G++ EK LEMKIRLFGG+IT +QSLCNL+IIPY D + RKDCI++
Sbjct: 840 FLFSNRIVYIPRTKTGLREEKLLEMKIRLFGGEITGQQSLCNLIIIPYVDSSRRKDCIEK 899

Query: 899 VNEQIKEQVKALDTIPKIPRIVAPEWVDHSIYGNCQVPEEDFPVV 943
           VNEQIKEQ+KA  T+PK+ RIV+P WVDHSI  NCQVPEEDFPVV
Sbjct: 900 VNEQIKEQMKASHTVPKVARIVSPGWVDHSINENCQVPEEDFPVV 944

>TDEL0G04510 Chr7 (819479..822388) [2910 bp, 969 aa] {ON} Anc_6.18
           YOR005C
          Length = 969

 Score =  998 bits (2580), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 495/942 (52%), Positives = 660/942 (70%), Gaps = 10/942 (1%)

Query: 11  PQNFAPSPDFKWLCEELFSKIDEVQVKGTIGTG-KSRSFKYYEVLSNFVEMWRKTVGNNI 69
           P NFAPSPDF WLCEELF K+++VQ +G    G K  S +YYEV+S+F+ +WRKTVGNNI
Sbjct: 27  PPNFAPSPDFIWLCEELFVKLEDVQRQGREHLGNKPLSVRYYEVISHFIRLWRKTVGNNI 86

Query: 70  YPALILALPYRDRRIYNIKDYVLIRTICSYLKLPKNSATEGRLKDWKQRVGKGKNLSSLL 129
           +PAL+L+LPYRDRRIYNIKDY L++ ICSYL LPK SATE RL  WK+R  +G  LS+  
Sbjct: 87  FPALVLSLPYRDRRIYNIKDYTLVKAICSYLALPKQSATEKRLLKWKRRATRGVRLSNFC 146

Query: 130 VEEIAKRRSEPN-GKAITIDGINSTLDELSKDRSTSGRGFKNLVKSSPFLHCLESMSFVE 188
           VEEI KR+SEP+ G+ ITID +N  LD L ++R+  G GFK L  S  F  CL++MSF+E
Sbjct: 147 VEEIRKRKSEPSPGRRITIDKLNECLDHLVEERNAKG-GFKGLSDSPTFNFCLQNMSFIE 205

Query: 189 LKYFFDILLKSRVIGGQEHKFLSCWHPDAQDYLSVVSDLKVVASKLYDPRVRLKNDDLTI 248
           L++FFDI+LK+RVIGGQEHK L+CWHPDA DYLSVVSDL+ VAS+L+DP  RL+ DDL+I
Sbjct: 206 LRFFFDIVLKNRVIGGQEHKLLNCWHPDALDYLSVVSDLETVASRLWDPEHRLRRDDLSI 265

Query: 249 KVGFAFAPQLAKKVNLPYEKICRALHNDFLVEEKMDGERIQVHYMNYGKSVRFYSRRGID 308
            +G+AF PQLAKK+ + YEKIC  L+NDFL+EEKMDGERIQVHYM+YG  +RF SRRG+D
Sbjct: 266 NLGYAFVPQLAKKMTISYEKICTKLNNDFLIEEKMDGERIQVHYMDYGAKIRFLSRRGVD 325

Query: 309 YTYLYGASLSSGTISHHLDFTDNVRECVLDGEMVTFDARRKVILPFGLVKGSAKDALSFN 368
           YT LYG +L SGT++++L+F  NVR+CVLDGEM+TFD  R V+LPFG+VK SA+ ALS  
Sbjct: 326 YTQLYGENLQSGTVANYLNFDSNVRDCVLDGEMITFDTDRNVVLPFGMVKSSARQALSTE 385

Query: 369 SINNVDFHPLYVVFDLLYLNGTSLTPLPLHQRKEYLESILTPVKNVVEMVRTSRCYNVES 428
            I +    P+ +V DL+YLNG SL  LPL+QRKE+L  +L P  + VE++   RC    +
Sbjct: 386 GICSQGHRPMLMVLDLVYLNGVSLIKLPLYQRKEFLNRVLKPCPHAVEILPYVRCSEHTA 445

Query: 429 IKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPEYLEEFGENLDLVIIGRDPGK 488
           I+KSLE +IS+GSEG+VLK Y + Y + +RN+ WIKVKPEYLE+FGENLDLVIIGR PGK
Sbjct: 446 IRKSLEKSISMGSEGIVLKSYKARYEIGARNDYWIKVKPEYLEQFGENLDLVIIGRTPGK 505

Query: 489 KDSFMLGLLLL-NEKEMDKRDQEVSSGIAN-NSKNENI--LYSQKKVKKILSFCSVANGI 544
           KDS M GL +   E+++++ + +  S I N +S+ + +     +K +K  +SFC +ANGI
Sbjct: 506 KDSLMCGLAVYEGEEDLNEIEAKRESAIVNLDSEGDELDDTDGKKIIKYFISFCVIANGI 565

Query: 545 SQEEFKEIDRKTRGCWKKTSEVAPPASIFEFGSKIPAEWIEPNESIVLEIKSRSLDNTET 604
           SQ+EFKEIDRKTRG W K+ +  P A +  FGSKIP EWI+P  SI+LE+K+RSLDNTE+
Sbjct: 566 SQQEFKEIDRKTRGAWVKSDQRLPSADLLRFGSKIPEEWIDPKNSIMLEVKARSLDNTES 625

Query: 605 NMQKYATSCTLYGGYCKRIRFDKDWTDCFTLNELYDSRSARFNPSYQAEKSHLKLVRKKR 664
           + +K+A  CTL+GGYC+RIR DKDWT C++ +EL+  R  + +    +         K +
Sbjct: 626 SKKKFAAGCTLHGGYCRRIRDDKDWTGCYSFSELWQERLHKSSTGVGSFNKQYSKKMKSK 685

Query: 665 REVLT--SNTFDQKTEQIPTSIIFAGLYFYVLSDYVTNASEVRITRGELENAIVRHGGRL 722
           +  +   S    +K +   ++ IF GL FYVLSDY+  +  VRIT+ E ++ I+++ G+L
Sbjct: 686 KRKIDPFSGQAAKKHDVFDSTNIFKGLQFYVLSDYIDVSRNVRITKSEFDDLILQNSGKL 745

Query: 723 IYNIILKRHYIGDVRLISCKNTTECRALINRGYDILHPSWVIDCVAYKKLIPIEPCYCFN 782
           + N+I K H     R+IS K T ECRALI RGYDIL P W++DC+  + ++ +EP +CFN
Sbjct: 746 VRNLISKHHSESQFRIISGKYTAECRALIERGYDILSPQWILDCIRNRMVVKLEPRHCFN 805

Query: 783 VSQKMRAVAEKRVDCLGDSFENDISETKLSLLYKSQHNLPPPEEV-ERDAEVQVFPLFLF 841
           VS ++  +   RVD  GDSF N I+E +L  L  +      P  + E ++E+ V PLFLF
Sbjct: 806 VSSELMTIVNGRVDEYGDSFVNPITEQQLDNLIDTNMKQTEPNLMREANSELDVVPLFLF 865

Query: 842 SNRIVYIPPRKIGMKYEKTLEMKIRLFGGKITDRQSLCNLVIIPYGDPTWRKDCIKEVNE 901
           S R VYIPP+         L  K +L GG I      CNL+I+P  +       + E+ +
Sbjct: 866 STRAVYIPPQVFNAVDAYGLTSKFKLHGGSIASDIPSCNLIIMPNENQRLGTQSLVEMRQ 925

Query: 902 QIKEQVKALDTIPKIPRIVAPEWVDHSIYGNCQVPEEDFPVV 943
            + + +   D+ P IP IV P+WV+ SI  NCQVPEEDF  V
Sbjct: 926 SVLQAMGRNDSTPSIPYIVTPDWVEKSIEENCQVPEEDFTPV 967

>NDAI0I02260 Chr9 complement(514711..517614) [2904 bp, 967 aa] {ON}
           Anc_6.18 YOR005C
          Length = 967

 Score =  993 bits (2566), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 505/962 (52%), Positives = 663/962 (68%), Gaps = 42/962 (4%)

Query: 11  PQNFAPSPDFKWLCEELFSKIDEVQVKGTIGTGKSR----SFKYYEVLSNFVEMWRKTVG 66
           P NFAPSP F+WLC+ELF K++ +Q   T    K      + +YYEV+ +F+ +WRKTVG
Sbjct: 19  PHNFAPSPSFRWLCDELFVKLERIQQASTSKASKEFQKPINVQYYEVIQHFINLWRKTVG 78

Query: 67  NNIYPALILALPYRDRRIYNIKDYVLIRTICSYLKLPKNSATEGRLKDWKQRVGKGKNLS 126
           N+IYPALIL LPYRDRRIYN++DY LI+ ICSYLKLPKNS TE RL  WKQR G+   LS
Sbjct: 79  NDIYPALILILPYRDRRIYNVRDYTLIKAICSYLKLPKNSFTEKRLLSWKQRAGRSVRLS 138

Query: 127 SLLVEEIAKRRSEPN---GKAITIDGINSTLDELSKDRSTSGR-GFKNLVKSSPFLHCLE 182
           S +V EI KR+SEP     + ITID +N  LD LS++R++ G  G++ L  S  F+ CLE
Sbjct: 139 SFIVSEIKKRKSEPQVGTREEITIDKLNQCLDSLSEERNSKGSMGYRGLSDSPTFVFCLE 198

Query: 183 SMSFVELKYFFDILLKSRVIGGQEHKFLSCWHPDAQDYLSVVSDLKVVASKLYDPRVRLK 242
           +M+FVEL++FFDI+LKSRVIGG EHKFL+ WHPDAQDYLSVVSDLK VA+KL+DP V LK
Sbjct: 199 NMTFVELQFFFDIILKSRVIGGHEHKFLNVWHPDAQDYLSVVSDLKTVANKLWDPAVHLK 258

Query: 243 NDDLTIKVGFAFAPQLAKKVNLPYEKICRALHNDFLVEEKMDGERIQVHYMNYGKSVRFY 302
           NDDLTI VG  FAPQ AKK+++ YEKIC  L +DF +EEKMDGERIQ+HY +YG  + F 
Sbjct: 259 NDDLTINVGSPFAPQSAKKLSISYEKICAKLKHDFFIEEKMDGERIQLHYQDYGNKLSFL 318

Query: 303 SRRGIDYTYLYGASLSSGTISHHLDFTDNVRECVLDGEMVTFDARRKVILPFGLVKGSAK 362
           SRRG DYTYLYG S+  GT+S +L   +NV+ CVLDGEMVTFD  R  +LPFGLVK SA+
Sbjct: 319 SRRGTDYTYLYGESIKDGTVSKYLHLDNNVQNCVLDGEMVTFDKERNALLPFGLVKSSAR 378

Query: 363 DALSFNSINNVDFHPLYVVFDLLYLNGTSLTPLPLHQRKEYLESILTPVKNVVEMVRTSR 422
             ++   + N  + PL +VFDL+YLNG SL  +PL+QRK YLE I TP +++VE++R+ R
Sbjct: 379 SIITQEGVANEGYRPLLMVFDLVYLNGVSLVNIPLYQRKLYLEKIFTPERHIVELLRSKR 438

Query: 423 CYNVESIKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPEYLEEFGENLDLVII 482
           C +  SIK +LE AIS+GSEGVVLK+YNS Y VASRN++WIKVKPEYLE+FGEN+DL++I
Sbjct: 439 CSDERSIKNALEHAISIGSEGVVLKHYNSRYTVASRNDDWIKVKPEYLEQFGENMDLIVI 498

Query: 483 GRDPGKKDSFMLGLLLLNE---------KEMDKRDQEVSSGIANNSKNENILYSQKKVKK 533
           G+DPGKKDS M GL ++ E          E+   D + S G     K  N +  +K +K+
Sbjct: 499 GKDPGKKDSLMCGLAVVEEDEPEIDEDGNEIVNLDSQDSIG-EGEDKEGNEIEREKTIKR 557

Query: 534 ILSFCSVANGISQEEFKEIDRKTRGCWKKTSEVAPPASIFEFGSKIPAEWIEPNESIVLE 593
            +SFCS+ANGISQEEFK I R T+GCWKK+ E+ PP+ + EFGS++PAEWI+P +SIV+E
Sbjct: 558 FVSFCSIANGISQEEFKYIGRITKGCWKKSDEIPPPSDLLEFGSRVPAEWIDPKDSIVIE 617

Query: 594 IKSRSLDNTETNMQKYATSCTLYGGYCKRIRFDKDWTDCFTLNELYDSRSARF----NPS 649
           +K+RSL+N E   +K+ T  TLYGGYC++IR DKDW  C+TL+EL   R  RF    N  
Sbjct: 618 VKARSLNNDEEATKKFKTGITLYGGYCRQIREDKDWKTCYTLSEL--RRMKRFKLGSNKR 675

Query: 650 YQAEKSHLKLVRKKRREVLTSNTFDQKTEQIPTSI----IFAGLYFYVLSDYVTNASEVR 705
              + +H     K+R+       F++  EQ PT++    IF GLYFYV+SD V +A+  R
Sbjct: 676 ANNDATHALDSSKRRKARRIDYGFEKYFEQTPTTLDQSRIFDGLYFYVISD-VVDATGSR 734

Query: 706 ITRGELENAIVRHGGRLIYNIILKRHYIGDVRLISCKNTTECRALINRGYDILHPSWVID 765
           ++R EL + I+  GG +++N+I K H     R++  K T EC++LI+RGYDI+ P WV+D
Sbjct: 735 VSREELYDKILNRGGVIVHNVIAKHHGENQFRILCGKYTAECQSLIDRGYDIIEPQWVLD 794

Query: 766 CVAYKKLIPIEPCYCFNVSQKMRAVAEKRVDCLGDSFENDISETKLSLL----YKSQHNL 821
           C+    L+ +EP YCFNVS+++  +A++RVD  GDSFE  ISE   S L     +S  N 
Sbjct: 795 CIKDDMLLKLEPKYCFNVSEELMKIAKRRVDGFGDSFEAQISEDSFSRLIERNVRSLRNA 854

Query: 822 PPPEEVERDAEVQVFPLFLFSNRIVYIPPRKIGMKYEKTLEMKIRLFGGKITDRQSLCNL 881
           PP   ++ D  V   PLFLF  R + +  +   + + K L+++IRL+GGK T   + CNL
Sbjct: 855 PP--SIQYDM-VDTVPLFLFYGRTILLRIKDKAL-FTK-LKVQIRLYGGKTTGDLASCNL 909

Query: 882 VIIPYGDPTWRKDCIKEVNEQIKEQVKALDTIPKIPRIVAPEWVDHSIYGNCQVPEEDFP 941
           V+I   +    KD    V   + +     D  P +P IV PEW+D SI   CQVPEED P
Sbjct: 910 VVIQQNEIAVAKD----VRSSLLKLTSDTDKPPVLPYIVTPEWIDSSISEGCQVPEEDHP 965

Query: 942 VV 943
           VV
Sbjct: 966 VV 967

>ZYRO0C07854g Chr3 (595546..598380) [2835 bp, 944 aa] {ON} similar
           to uniprot|Q08387 Saccharomyces cerevisiae YOR005C DNL4
           DNA ligase required for nonhomologous end- joining
           (NHEJ) forms stable heterodimer with required cofactor
           Lif1p catalyzes DNA ligation as part of a complex with
           Lif1p and Nej1p involved in meiosis not essential for
           vegetative growth
          Length = 944

 Score =  991 bits (2563), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 499/951 (52%), Positives = 660/951 (69%), Gaps = 15/951 (1%)

Query: 1   MVSTLDSVPEPQNFAPSPDFKWLCEELFSKIDEVQVKG-TIGTGKSRSFKYYEVLSNFVE 59
           M +  D   +P NFAPSPDFKWLC+ELF KID VQ +    G  KS + KY+E++S FV+
Sbjct: 1   MSTKTDDQNKPHNFAPSPDFKWLCDELFVKIDNVQKQTRDHGAFKSLTVKYFEIISFFVK 60

Query: 60  MWRKTVGNNIYPALILALPYRDRRIYNIKDYVLIRTICSYLKLPKNSATEGRLKDWKQRV 119
           +WRKTVG+NIYPALIL LPYRDRRI+NIKDY LI+ ICS+L+LP NS TE RL  WK+R 
Sbjct: 61  LWRKTVGDNIYPALILILPYRDRRIFNIKDYTLIKAICSFLRLPANSVTEKRLLRWKRRA 120

Query: 120 GKGKNLSSLLVEEIAKRRSEP-NGKAITIDGINSTLDELSKDRSTSGRGFKNLVKSSPFL 178
           G+G  LS   VEEI +RRSEP NG+ ITID +N  LD+L+++R+T GRGFK+L  SS F 
Sbjct: 121 GRGIKLSDFCVEEIRRRRSEPLNGERITIDKLNECLDQLAEERNTKGRGFKSLADSSVFK 180

Query: 179 HCLESMSFVELKYFFDILLKSRVIGGQEHKFLSCWHPDAQDYLSVVSDLKVVASKLYDPR 238
           +CLE+MSF E+KY+FDI+LKSRVIGGQEHKFL+CWHPDA+DYLSVVSDLK VA KL+DP 
Sbjct: 181 YCLENMSFTEMKYYFDIILKSRVIGGQEHKFLNCWHPDARDYLSVVSDLKTVADKLWDPS 240

Query: 239 VRLKNDDLTIKVGFAFAPQLAKKVNLPYEKICRALHNDFLVEEKMDGERIQVHYMNYGKS 298
            RLKNDDL + +G  FAP LAK++ + Y+K+   L +DF +EEKMDGERIQ+HYM+YG+ 
Sbjct: 241 HRLKNDDLGVNLGLPFAPFLAKRLYISYDKVALRLKSDFYIEEKMDGERIQLHYMDYGRK 300

Query: 299 VRFYSRRGIDYTYLYGASLSSGTISHHLDFTDNVRECVLDGEMVTFDARRKVILPFGLVK 358
           ++++SRRG DYTYLYG  + +GT++ +L     VRECVLDGEM++FD     +LPFGLVK
Sbjct: 301 LKWFSRRGNDYTYLYGEDIGTGTVAKYLQLDPKVRECVLDGEMISFDTEENSVLPFGLVK 360

Query: 359 GSAKDALSFNSINNVDFHPLYVVFDLLYLNGTSLTPLPLHQRKEYLESILTPVKNVVEMV 418
            SA+D+L+   I    + PLY+V D LYLNG SL  +PL+ RK+YL +IL P  + VE++
Sbjct: 361 SSARDSLTAEGILTQGYRPLYMVIDFLYLNGVSLINVPLNTRKQYLSAILNPCPHAVEII 420

Query: 419 RTSRCYNVESIKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPEYLEEFGENLD 478
           ++  CY+  SIK SLE AI +GSEG++LK++ S Y + +R +NWIK+KPEYLE+FGENLD
Sbjct: 421 QSMHCYDDTSIKSSLEKAIMMGSEGIILKHFKSKYEIGARTDNWIKIKPEYLEQFGENLD 480

Query: 479 LVIIGRDPGKKDSFMLGLLLLNEKEMDKRDQEVSSGIANNSKNENILYSQKKVKKILSFC 538
           L++IGRDPGKKDS M GL +L   E D+     S     N  +E     +K VKK +SFC
Sbjct: 481 LLVIGRDPGKKDSLMCGLAVL---EGDEEPGAQSDKQVVNLDSEEEEEPRKAVKKFISFC 537

Query: 539 SVANGISQEEFKEIDRKTRGCWKKTSEVAPPASIFEFGSKIPAEWIEPNESIVLEIKSRS 598
           ++ANGISQEEFK+I+RKT G WK T +  PP  I EFGSK+P EWI P +S+VLE+K+RS
Sbjct: 538 TIANGISQEEFKQIERKTAGKWKNTEDHKPP-KILEFGSKLPEEWIYPEDSVVLEVKARS 596

Query: 599 LDNTETNMQKYATSCTLYGGYCKRIRFDKDWTDCFTLNELYDSRSARFNPSYQAEKSHLK 658
           LDNTE++ +K+   CTL+GGYC+RIR DK+WT+C+TL EL+  R  +   S  +      
Sbjct: 597 LDNTESSGRKFKVGCTLHGGYCRRIREDKNWTECYTLYELWQERRKKVPLSEDSNNQKPM 656

Query: 659 LVRKKRREVLTS--NTFDQKTEQIPTSIIFAGLYFYVLSDYVTNASEVRITRGELENAIV 716
             +K RR  + S  N      ++  TS IF GL FYV+SDY+ +    RI++ +L + I 
Sbjct: 657 KSKKIRRPRIVSRLNQTLSCDDEAKTSSIFDGLIFYVISDYMASQDSERISKEQLCDLIS 716

Query: 717 RHGGRLIYNIILKRHYIGDVRLISCKNTTECRALINRGYDILHPSWVIDCVAYKKLIPIE 776
            +GG+L +N+I      G +R+IS K T EC+ALI RGYDIL P W++DCV    L+ IE
Sbjct: 717 GNGGKLTFNVISDHRVKGGLRIISGKYTLECKALIERGYDILSPQWLMDCVNTGFLVTIE 776

Query: 777 PCYCFNVSQKMRAVAEKRVDCLGDSFENDISETKLSLLYKSQHNLPPPEEVERD--AEVQ 834
           P +CF+VS+ M  +A  RVD  GDS++ +I+E +L  +  S+           D  ++V+
Sbjct: 777 PRHCFSVSEDMEKIARTRVDHFGDSYDVEITEDRLRDILTSKEFDSDFSTGSLDVISDVE 836

Query: 835 VFPLFLFSNRIVYIPPRKIGMKYEKT--LEMKIRLFGGKITDRQSLCNLVIIPYGDPTWR 892
             PLFLFS RIV+IP    G  Y  T  L+ K+RL+GG++TD  + CNL+I+P G    R
Sbjct: 837 DIPLFLFSRRIVFIPE---GFSYLDTQLLKHKVRLYGGQLTDNVNQCNLIIVPDGKINLR 893

Query: 893 KDCIKEVNEQIKEQVKALDTIPKIPRIVAPEWVDHSIYGNCQVPEEDFPVV 943
              I ++   +       +  P IP IV P W+D SI  N QVPEEDF  V
Sbjct: 894 GRIISDLRRLLSTFAAMTELPPAIPWIVIPAWIDRSIEENIQVPEEDFLAV 944

>NCAS0D02650 Chr4 (508606..511458) [2853 bp, 950 aa] {ON} Anc_6.18
           YOR005C
          Length = 950

 Score =  989 bits (2557), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 474/943 (50%), Positives = 670/943 (71%), Gaps = 13/943 (1%)

Query: 8   VPEPQNFAPSPDFKWLCEELFSKIDEVQVK-GTIGTGKSRSFKYYEVLSNFVEMWRKTVG 66
           V  P NF+PSP F+WLC+ELF K++++Q K      GK  + +YYEV+++F+ +WRKTVG
Sbjct: 14  VMTPCNFSPSPAFQWLCDELFVKLEDIQSKRDPKNIGKPVTVRYYEVINHFIALWRKTVG 73

Query: 67  NNIYPALILALPYRDRRIYNIKDYVLIRTICSYLKLPKNSATEGRLKDWKQRVGKGKNLS 126
           N+I+PALIL LPYRDRR++NI+DY LI+ IC+YLKLP+NS TE RL  WK R GKG  LS
Sbjct: 74  NDIFPALILILPYRDRRLFNIRDYTLIKAICAYLKLPRNSFTEKRLLSWKARAGKGVKLS 133

Query: 127 SLLVEEIAKRRSEPNGK-AITIDGINSTLDELSKDRSTSGRGFKNLVKSSPFLHCLESMS 185
              V EI KR+SEP  K  ITID +N  LD+L+++R++ GRGFK L  S  F  CLE+MS
Sbjct: 134 QFCVNEIKKRKSEPKDKIEITIDRLNECLDKLAEERNSKGRGFKKLADSPTFKFCLENMS 193

Query: 186 FVELKYFFDILLKSRVIGGQEHKFLSCWHPDAQDYLSVVSDLKVVASKLYDPRVRLKNDD 245
           F+EL++FFDILLK+RVIGGQEHKFL+ WHPDAQDYLSVVSDL+ V ++L+DP +RL+N+D
Sbjct: 194 FIELQFFFDILLKNRVIGGQEHKFLNAWHPDAQDYLSVVSDLRTVTTRLWDPEIRLQNND 253

Query: 246 LTIKVGFAFAPQLAKKVNLPYEKICRALHNDFLVEEKMDGERIQVHYMNYGKSVRFYSRR 305
           L I  GFAFAPQLAKK+++ YEKIC  L NDF++EEKMDGERIQ+HY +YG+ ++F+SRR
Sbjct: 254 LVINPGFAFAPQLAKKLSISYEKICMKLKNDFIIEEKMDGERIQLHYQDYGEKLKFFSRR 313

Query: 306 GIDYTYLYGASLSSGTISHHLDFTDNVRECVLDGEMVTFDARRKVILPFGLVKGSAKDAL 365
           G DYTYLYG S+  G I  HL    +V++C+LDGEM+T+D  + +ILPFGLVK SA+  L
Sbjct: 314 GTDYTYLYGESIHDGFIGKHLKLNKDVKDCILDGEMITYDKTQNMILPFGLVKSSARSML 373

Query: 366 SFNSINNVDFHPLYVVFDLLYLNGTSLTPLPLHQRKEYLESILTPVKNVVEMVRTSRCYN 425
           + + I N  + PL++VFDL+++NGTSL  +PL+ RKEYL  I TP  +++E++ +   +N
Sbjct: 374 TKDGIMNEGYQPLFMVFDLIFMNGTSLANIPLNVRKEYLNGIFTPEPHIIELLSSYHRFN 433

Query: 426 VESIKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPEYLEEFGENLDLVIIGRD 485
            +SI+KSLE+AIS+GSEG+VLK Y+S Y VASRN++WIKVKPEYLE+FGEN+DL++IGRD
Sbjct: 434 EDSIRKSLELAISMGSEGIVLKRYDSRYTVASRNDDWIKVKPEYLEQFGENMDLIVIGRD 493

Query: 486 PGKKDSFMLGLLLLNEKEMDKRDQEVSSGIANNSKNENILYSQKK-VKKILSFCSVANGI 544
           PGKKDS M GL ++ E E    ++     +     +E+    Q++ + K +SFC +ANG+
Sbjct: 494 PGKKDSLMCGLAVVEEDEKADLNENNDDNVIILDDDEDAPVEQERTIHKFVSFCVIANGL 553

Query: 545 SQEEFKEIDRKTRGCWKKTSEVAPPASIFEFGSKIPAEWIEPNESIVLEIKSRSLDNTET 604
           SQEEFK+IDRKTRG W ++ E+ PP ++ +FG+++P EWI+P +S+V+E+K+RS+D  E+
Sbjct: 554 SQEEFKQIDRKTRGLWNRSDEIPPPDTLLQFGTRLPIEWIDPKKSVVIEVKARSIDAAES 613

Query: 605 NMQKYATSCTLYGGYCKRIRFDKDWTDCFTLNELYDSRSARFNPSYQAEKSH-LKLVRKK 663
           N +K+AT CTLYGGYC+ IR DKDW  C+TL+E   +++ +   +   +  H +K  +K 
Sbjct: 614 NGRKFATGCTLYGGYCRGIREDKDWQTCYTLSEFLRTKNVKSRRNGSDQVIHGVKRQKKN 673

Query: 664 RREVLTSNTFDQKTEQIPTSIIFAGLYFYVLSDYVTNASEVRITRGELENAIVRHGGRLI 723
           RR+ +   + +++   +  +  F  LYFYV+SD   +    RI +  +   I   GG LI
Sbjct: 674 RRKYILDQSLEEEGGLLKNTAFFRNLYFYVISDVFDDVLGTRIEKERMYKYIQEGGGTLI 733

Query: 724 YNIILKRHYIGDVRLISCKNTTECRALINRGYDILHPSWVIDCVAYKKLIPIEPCYCFNV 783
           +NII K+    ++R+IS K T EC ALI RGYD+++P W++DCV  K L+ +EP YCFNV
Sbjct: 734 HNIISKQFGTRNLRIISGKLTNECSALIERGYDVINPQWIVDCVQSKSLLKLEPKYCFNV 793

Query: 784 SQKMRAVAEKRVDCLGDSFENDISETKLSLLYKSQHNLPPPEEV---ERDAEVQVFPLFL 840
           S +++ + EKRVD  GDS+E  I+E +LS L +++ NL   + +     D E+   PLFL
Sbjct: 794 STELKKLTEKRVDTFGDSYEVPITEEQLSTLLETELNLVRVQGLVTPYADEELIKIPLFL 853

Query: 841 FSNRIVYIPPRKIGMKYEKTLEMKIRLFGGKITDRQSLCNLVIIPYGDPTWRKDCIKEVN 900
           F +RI+  P  +   K    L+ KI+L+GGK+T     CNL+I+P G+    +  ++   
Sbjct: 854 FQDRIMLFPNTE--SKTISFLQEKIKLYGGKLTTDIGKCNLIILPNGN----QQLLQRTR 907

Query: 901 EQIKEQVKALDTIPKIPRIVAPEWVDHSIYGNCQVPEEDFPVV 943
           + + + +     +P IP IV P W++ SI  N QVPEED+PV+
Sbjct: 908 DLLTKNIMNSGEVPTIPYIVNPLWIERSIEENSQVPEEDYPVI 950

>KAFR0A05050 Chr1 (1003515..1006361) [2847 bp, 948 aa] {ON} Anc_6.18
           YOR005C
          Length = 948

 Score =  983 bits (2540), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 486/946 (51%), Positives = 677/946 (71%), Gaps = 16/946 (1%)

Query: 7   SVPE---PQNFAPSPDFKWLCEELFSKIDEVQVKGTIGTGKSRSFKYYEVLSNFVEMWRK 63
           +VPE   P+NFAPSP FKWLCEELFSK++EV  +  + T K  + +YYE+++NFV +WR 
Sbjct: 4   TVPEVEVPRNFAPSPQFKWLCEELFSKLEEVPNQRHLTT-KRITLRYYEIITNFVNLWRT 62

Query: 64  TVGNNIYPALILALPYRDRRIYNIKDYVLIRTICSYLKLPKNSATEGRLKDWKQRVGKGK 123
           TVG++IYPALILALPYRDRR+YN+KDY LI+ IC+YLKLPKNS TE RL +WKQR  +  
Sbjct: 63  TVGDDIYPALILALPYRDRRMYNVKDYTLIKAICTYLKLPKNSFTEKRLLNWKQRADRSV 122

Query: 124 NLSSLLVEEIAKRRSEPNGKA-ITIDGINSTLDELSKDRSTSGRGFKNLVKSSPFLHCLE 182
            LS   V E+ KR+SEP  K+ IT+D +N+ LD LS+DR+  GRG+KNL +SS F +C+E
Sbjct: 123 KLSVSCVNEMRKRKSEPVEKSPITLDELNTLLDFLSQDRNIKGRGYKNLSESSIFTYCIE 182

Query: 183 SMSFVELKYFFDILLKSRVIGGQEHKFLSCWHPDAQDYLSVVSDLKVVASKLYDPRVRLK 242
            MSF+EL+YFFDI+LK+RVIG  EHK L+ WHPDA+DYLSVVSDLK V ++L++P +RL+
Sbjct: 183 KMSFMELRYFFDIILKARVIGPHEHKLLNAWHPDAEDYLSVVSDLKTVCTRLWNPNIRLR 242

Query: 243 NDDLTIKVGFAFAPQLAKKVNLPYEKICRALHNDFLVEEKMDGERIQVHYMNYGKSVRFY 302
           +D+L+I +G+AFAP LAKK+++ Y+KIC+ L NDF +EEKMDGERIQ+HYM+YG  ++F 
Sbjct: 243 HDELSINIGYAFAPHLAKKLSISYDKICKKLKNDFFIEEKMDGERIQIHYMDYGNDIKFL 302

Query: 303 SRRGIDYTYLYGASLSSGTISHHLDFTDNVRECVLDGEMVTFDARRKVILPFGLVKGSAK 362
           SRRG+DYTYLYG +LS+GTI+ +L    +V+ECVLDGEMVT+D  + ++LPFG+VK +A 
Sbjct: 303 SRRGVDYTYLYGENLSTGTIACYLKLNRDVKECVLDGEMVTYDEDQDILLPFGMVKSAAM 362

Query: 363 DALSFNSINNVDFHPLYVVFDLLYLNGTSLTPLPLHQRKEYLESILTPVKNVVEMVRTSR 422
           +AL+   I+  D+HPL +VFDL++LNG+SL   PL+QRK+YL S+L P +  V++V  +R
Sbjct: 363 NALTKEEISGQDYHPLLMVFDLVFLNGSSLVEFPLYQRKDYLASVLEPYRARVQIVNFTR 422

Query: 423 CYNVESIKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPEYLEEFGENLDLVII 482
           C N   I+KSLE AIS+GSEG+VLK YNS Y + SRN++WIK+KPEYLE+FGEN+DL++I
Sbjct: 423 CSNENIIRKSLEHAISVGSEGIVLKNYNSRYMIGSRNDSWIKIKPEYLEQFGENMDLIVI 482

Query: 483 GRDPGKKDSFMLGLLLLNEKEMDKR---DQEVSSGIANNSKNENILYSQKKVKKILSFCS 539
           GRD  KKDSF  GL +L+E+E       D+ V + +++ S  EN   + + +KK++SFC 
Sbjct: 483 GRDSAKKDSFYCGLTVLDEEEEKLVEEIDKGVVNLVSDESDYENP-ENNRHIKKVVSFCM 541

Query: 540 VANGISQEEFKEIDRKTRGCWKKTSEVAPPASIFEFGSKIPAEWIEPNESIVLEIKSRSL 599
           +ANGISQ E+KEI RKTRG WKKT EV PP  + EFG+++P EWIEP  S+VLEIK+RSL
Sbjct: 542 IANGISQNEYKEIYRKTRGFWKKTEEVPPPPELIEFGTQVPMEWIEPEHSVVLEIKARSL 601

Query: 600 DNTETNMQKYATSCTLYGGYCKRIRFDKDWTDCFTLNELYDSRSARFNPSYQAEKSHLKL 659
           DNTE++ +++   CTLYGGYC+RIR D DW   F+L EL   R  +  P    + + LK 
Sbjct: 602 DNTESSCKRFKAGCTLYGGYCRRIRDDVDWKSSFSLAELRRDRRIKHYPGTSEKDTLLKS 661

Query: 660 VRKKRREVLTSNTFDQKTEQI-PTSIIFAGLYFYVLSDYVTNASEVRITRGELENAIVRH 718
            +++++++LT    +     I  TS IF GL+FY+LSDY      VRI++ +L+  ++ +
Sbjct: 662 KKRRKKQLLTPLNQNLNPRDIQTTSKIFDGLFFYILSDYFDTNENVRISKDDLQKLLLEN 721

Query: 719 GGRLIYNIILKRHYIGDVRLISCKNTTECRALINRGYDILHPSWVIDCVAYKKLIPIEPC 778
           GG++ +NI+ KR    ++R++  K T EC  LI RGYDIL P WVIDCV  KK++ IEP 
Sbjct: 722 GGKISHNIVSKRESKSNLRILCGKYTAECNVLIKRGYDILSPQWVIDCVENKKIVKIEPS 781

Query: 779 YCFNVSQKMRAVAEKRVDCLGDSFENDISETKLSLLYKSQHNLPP----PEEVERDAEVQ 834
           +CF+VS  + A+A +RVD  GDS+E+ +S ++LS + +S  ++ P    P  +  D E  
Sbjct: 782 HCFSVSDDLMALAMRRVDKYGDSYESLLSVSRLSYILRSSKDISPDLLSPANMSLDFE-- 839

Query: 835 VFPLFLFSNRIVYIPPRKIGMKYEKTLEMKIRLFGGKITDRQSLCNLVIIPYGDPTWRKD 894
             P FLF  R  ++          +   +KI+L+GGK+    S CN+VI P  + T  ++
Sbjct: 840 KVPYFLFWRRKAFVMEHNFDKSSIRETILKIQLYGGKVVKNISECNIVIFPKAEITVIRE 899

Query: 895 CIKEVNEQIKEQVKALDTIPKIPRIVAPEWVDHSIYGNCQVPEEDF 940
            +K +   + + V     +P +PRIV+ EW+D SI  N QVPEED+
Sbjct: 900 SMKFIRNTLAKTVSTSVELPMLPRIVSFEWIDASIEKNVQVPEEDY 945

>KNAG0F02870 Chr6 (543177..546041) [2865 bp, 954 aa] {ON} Anc_6.18
           YOR005C
          Length = 954

 Score =  953 bits (2463), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 477/947 (50%), Positives = 649/947 (68%), Gaps = 14/947 (1%)

Query: 11  PQNFAPSPDFKWLCEELFSKIDEVQVKGTIGTGKSRSFKYYEVLSNFVEMWRKTVGNNIY 70
           P NFAPSPDF+WLC+ELF K D V  +      K  + +YYEV+SNFV++WRKTVGNN Y
Sbjct: 9   PTNFAPSPDFQWLCDELFVKFDLVATQDRRINLKPITVRYYEVVSNFVQLWRKTVGNNFY 68

Query: 71  PALILALPYRDRRIYNIKDYVLIRTICSYLKLPKNSATEGRLKDWKQRVGKGKNLSSLLV 130
           P LILALPYRDRR YNIKD  LI+ IC YL LPK S+TE +L +WKQR  + + LSS  V
Sbjct: 69  PVLILALPYRDRRTYNIKDVTLIKAICLYLDLPKRSSTEKKLLNWKQRASRNERLSSFCV 128

Query: 131 EEIAKRRSEPNG---KAITIDGINSTLDELSKDRSTSGRGFKNLVKSSPFLHCLESMSFV 187
            EI KR+S P+    +AIT+D +NS LD+L+  +S+ G+G + L  SS F  CLE+MSF+
Sbjct: 129 AEIRKRKSGPDPSKRQAITLDKLNSILDDLANGKSSRGQGSRTLADSSHFKFCLENMSFI 188

Query: 188 ELKYFFDILLKSRVIGGQEHKFLSCWHPDAQDYLSVVSDLKVVASKLYDPRVRLKNDDLT 247
           ELKYFFDILLK R+IGG EHK L+ WHPDA DY SVVSDL  V  KLY+P VRL+N+DLT
Sbjct: 189 ELKYFFDILLKVRIIGGHEHKLLNAWHPDAVDYFSVVSDLSSVTKKLYEPSVRLRNEDLT 248

Query: 248 IKVGFAFAPQLAKKVNLPYEKICRALHNDFLVEEKMDGERIQVHYMNYGKSVRFYSRRGI 307
           +K+G AFAP LAK++N+ YEKI + L +DF +EEKMDGERIQ+HYM+YG  ++F SRRG 
Sbjct: 249 LKIGSAFAPHLAKRLNISYEKILKKLGSDFSIEEKMDGERIQIHYMDYGNEIKFLSRRGT 308

Query: 308 DYTYLYGASLSSGTISHHLDFTDNVRECVLDGEMVTFDARRKVILPFGLVKGSAKDALSF 367
           DYTYLYG   S+GTI+ +L   +NV+EC+LDGEMVT+D  +++ILPFGLVK SAK+ LS 
Sbjct: 309 DYTYLYGGDTSTGTIACYLKLNENVKECILDGEMVTYDQEKQMILPFGLVKSSAKNFLSK 368

Query: 368 NSINNVDFHPLYVVFDLLYLNGTSLTPLPLHQRKEYLESILTPVKNVVEMVRTSRCYNVE 427
            SI+N  +HPL++ FDL+YLNGTSL  LPL+QRK+YL  ILT     V++V  +RC N+E
Sbjct: 369 ESISNGSYHPLFMAFDLVYLNGTSLVDLPLYQRKDYLSKILTKCNGFVDIVSFARCNNLE 428

Query: 428 SIKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPEYLEEFGENLDLVIIGRDPG 487
           SI KSL  AIS+GSEG++LK  NS Y VASRN++WIK+KP+YL++FGEN+DL+IIGRDPG
Sbjct: 429 SITKSLAAAISVGSEGIILKKLNSRYMVASRNDSWIKIKPQYLKQFGENMDLIIIGRDPG 488

Query: 488 KKDSFM--LGLLLLNEKEMDKRDQEVSSGIANNSKNENILYSQKKVKKILSFCSVANGIS 545
           KKD+FM  LG+ + + +    + +E  +   +   +E       ++ K +SFC++ANGIS
Sbjct: 489 KKDAFMCALGVTIDDPQPRVLQQEENVNLDLDTEDSEPETPKASRIVKFVSFCTIANGIS 548

Query: 546 QEEFKEIDRKTRGCWKKTSEVAPPASIFEFGSKIPAEWIEPNESIVLEIKSRSLDNTETN 605
             EFKEID+KTRG W++  +V PP+   +FG+K P EWI+P ES+VLE+KSRSLDNTE+N
Sbjct: 549 NAEFKEIDQKTRGLWRRFDQVKPPSEYLQFGTKKPVEWIDPKESLVLEVKSRSLDNTESN 608

Query: 606 MQKYATSCTLYGGYCKRIRFDKDWTDCFTLNELYDSRSARFNPSYQAEKS--HLKLVRKK 663
           ++KY    TL+GGYC+ +R+DKDWT C+T++E    R  +  P   A +S       RKK
Sbjct: 609 VKKYRAGVTLFGGYCRAVRYDKDWTTCYTVSEFERDRQYKL-PKVNAGESITTSNKGRKK 667

Query: 664 RREVLTSNTFDQKTEQIPT---SIIFAGLYFYVLSDYVTNASEVRITRGELENAIVRHGG 720
           R           + ++ P    S IF  L+F VLSDY+   +  RI R  L   I+ +GG
Sbjct: 668 RNTTSILGVISPRKKRTPEGEHSDIFQNLHFCVLSDYLDPYTGNRIDRNTLTQLIIDYGG 727

Query: 721 RLIYNIILKRHYIGDVRLISCKNTTECRALINRGYDILHPSWVIDCVAYKKLIPIEPCYC 780
           ++IYN++ K    G +R+I      EC ALI RGYDIL PSWV+DC+   +L+ +E  +C
Sbjct: 728 KVIYNVLAKEGEEGMLRIICDGFNMECNALIKRGYDILSPSWVLDCIESARLLKLERNHC 787

Query: 781 FNVSQKMRAVAEKRVDCLGDSFENDISETKLSLLYKSQ-HNLPPP--EEVERDAEVQVFP 837
           FNVS+++  ++  RVD   DSFEN+IS T+L  L     HN+P         D E++  P
Sbjct: 788 FNVSKELMELSSTRVDEYDDSFENEISTTRLDRLIDVHLHNMPSGSFSGENLDFELRGLP 847

Query: 838 LFLFSNRIVYIPPRKIGMKYEKTLEMKIRLFGGKITDRQSLCNLVIIPYGDPTWRKDCIK 897
             LF +R V+I   K+  +    +  + +LFGG++T     CNL+IIP  D   +   ++
Sbjct: 848 PLLFFDRSVFIAETKLSDRIYAKISSETKLFGGQVTHTIEDCNLIIIPNTDDEDKIQVLQ 907

Query: 898 EVNEQIKEQVKALDTIPKIPRIVAPEWVDHSIYGNCQVPEEDFPVVT 944
           ++  ++   ++ L++  +IP IV+ EW+  SI  N QVPEE++ V++
Sbjct: 908 KIRGKLASMIQKLNSTERIPPIVSEEWLYQSIKENIQVPEENYSVLS 954

>TPHA0M00260 Chr13 complement(50326..53226) [2901 bp, 966 aa] {ON}
           Anc_6.18 YOR005C
          Length = 966

 Score =  928 bits (2399), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 467/954 (48%), Positives = 652/954 (68%), Gaps = 23/954 (2%)

Query: 10  EPQNFAPSPDFKWLCEELFSKIDEVQVKGTIGTGKSRSFKYYEVLSNFVEMWRKTVGNNI 69
           EP+NF+PSPDFKWLC ELF K+DEV++K      + ++ +Y  V++NF+ +WR TVGN+I
Sbjct: 15  EPRNFSPSPDFKWLCNELFVKLDEVRLKPKSVDTRPKNIQYDIVINNFIHLWRVTVGNDI 74

Query: 70  YPALILALPYRDRRIYNIKDYVLIRTICSYLKLPKNSATEGRLKDWKQRVGKGKNLSSLL 129
           YPAL L LPYRDRR Y I+++ LIR +C YLKL KNS TE RL+ WKQ+  +  NLSS  
Sbjct: 75  YPALRLILPYRDRRNYYIREHTLIRIVCDYLKLQKNSVTEQRLRRWKQKARRSINLSSFC 134

Query: 130 VEEIAKRRSEPNGK-AITIDGINSTLDELSKDRS----TSGRGFKNLVKSSPFLHCLESM 184
           ++EI KR SEP  K  ITID +NS LD LS +RS    T+G   K L +     +C E+M
Sbjct: 135 IQEIKKRLSEPVSKEKITIDKLNSILDSLSMERSSSKITNGSSGKKLSQLESIKYCFENM 194

Query: 185 SFVELKYFFDILLKSRVIGGQEHKFLSCWHPDAQDYLSVVSDLKVVASKLYDPRVRLKND 244
           SF+EL+YFFDIL+K+R+IGG EHKFL+ WHPDA DYLSVVS+L +V  KL++P  RL + 
Sbjct: 195 SFIELEYFFDILIKARLIGGLEHKFLNAWHPDANDYLSVVSELNIVTEKLWNPNFRLNSK 254

Query: 245 DLTIKVGFAFAPQLAKKVNLPYEKICRALHNDFLVEEKMDGERIQVHYMNYGKSVRFYSR 304
           DLTI +  AF PQLAKKVNL YE + R ++N F +EEKMDGERIQ+HYM+YG  ++++SR
Sbjct: 255 DLTIALHNAFEPQLAKKVNLSYEVLSRRMNNKFTIEEKMDGERIQIHYMDYGHQIKYFSR 314

Query: 305 RGIDYTYLYGASLSSGTISHHLDFTDNVRECVLDGEMVTFDARRKVILPFGLVKGSAKDA 364
           RG DYTYLYG   S+ TIS +L   ++V+EC+LDGEMV++D  R  ILPFG+VK  A ++
Sbjct: 315 RGNDYTYLYGKDKSTATISKYLQLNEDVKECILDGEMVSYDKSRNCILPFGMVKSGAANS 374

Query: 365 LSFNSINNVDFHPLYVVFDLLYLNGTSLTPLPLHQRKEYLESILTPVKNVVEMVRTSRCY 424
           L  + + N    PL++VFD+L+LNG+ LT LPL+QRKEYL +ILTP K+ +E+++ S  +
Sbjct: 375 LKIDGLENDLCSPLFIVFDVLFLNGSPLTNLPLYQRKEYLSNILTPKKSHIEILKFSIAH 434

Query: 425 NVESIKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPEYLEEFGENLDLVIIGR 484
           + ESI+ +L+ AIS+GSEG+VLK Y+S Y+V  RNN+WIKVKPEYLE+FGENLDL++IGR
Sbjct: 435 DSESIRSALQAAISVGSEGIVLKKYDSLYSVGDRNNDWIKVKPEYLEQFGENLDLIVIGR 494

Query: 485 DPGKKDSFMLGLLLL-NEKEMDK-RDQEVSSGIANNSKNENIL-----YSQKKVKKILSF 537
           DPGKKDS M G+ +L NE+  +K   +EV +  +++  ++N +        K++ K +SF
Sbjct: 495 DPGKKDSLMCGVAVLENEESYEKILQEEVITLTSDDDDSQNNIPEDKPIRTKRITKFISF 554

Query: 538 CSVANGISQEEFKEIDRKTRGCWKKTSEVAPPASIFEFGSKIPAEWIEPNESIVLEIKSR 597
           C +ANGIS EEFKEIDRKT GCWKK S+ APP    EFG+++P EWI P++S+VLE+K+R
Sbjct: 555 CVIANGISNEEFKEIDRKTFGCWKKFSDEAPPTDYLEFGTRLPVEWINPHDSVVLEVKAR 614

Query: 598 SLDNTETNMQKYATSCTLYGGYCKRIRFDKDWTDCFTLNELY-DSRSARFNPSYQAEKSH 656
           SL+N E    K+ T  TLYG YC+RIR DKD+ DC+T ++L   +   R +       SH
Sbjct: 615 SLENNEALRDKFKTGYTLYGAYCRRIRTDKDFNDCYTFSDLVIATNKKRSSSELYGNHSH 674

Query: 657 LKLVRKKRREV--LTSNTFDQKTEQIPTSIIFAGLYFYVLSDYVTNASEVRITRGELENA 714
           +K  R +  +V  L      Q  +   TS IF GL F+V+SDYV + S  R+   EL N 
Sbjct: 675 IKKKRSRTSKVNMLNQTLSIQDDDTGFTSKIFDGLSFFVISDYVDSNSSFRLRIDELINI 734

Query: 715 IVRHGGRLIYNIILKRHYIGDVRLISCKNTTECRALINRGYDILHPSWVIDCVAYKKLIP 774
           I  +GG+LI+N++ +      VR++SCK T EC  LI RGYDI+HP W++DC+A  KL+ 
Sbjct: 735 IKVNGGQLIFNLVSQNLNEKYVRIMSCKKTFECNELIKRGYDIIHPKWILDCIANDKLLD 794

Query: 775 IEPCYCFNVSQKMRAVAEKRVDCLGDSFENDISETKLSLLYKSQHNLPPPEE-----VER 829
            EP +CFNVSQ +  ++++RVD LGDS++  I+E +L LL  S+    P E+     ++ 
Sbjct: 795 FEPSHCFNVSQSLSTISKQRVDLLGDSYQKYITEEELELLISSK---TPKEQLYSNPLQF 851

Query: 830 DAEVQVFPLFLFSNRIVYIPPRKIGMKYEKTLEMKIRLFGGKITDRQSLCNLVIIPYGDP 889
           D +++  P+FLFSN+  Y P +    K  K   + I+L+GG   +  + CN++II     
Sbjct: 852 DQQIEKIPIFLFSNKKAYTPKQCFSEKLLKETNLYIKLYGGTSVNNINDCNVIIIGDEHS 911

Query: 890 TWRKDCIKEVNEQIKEQVKALDTIPKIPRIVAPEWVDHSIYGNCQVPEEDFPVV 943
               + I  + +++     + + +  IPRIV+ +W++ SI    QV EEDFP++
Sbjct: 912 KSSNEKISSIRKELSIHAVSSNNVIPIPRIVSYKWIEKSIAQGTQVVEEDFPII 965

>CAGL0E02695g Chr5 complement(254591..257431) [2841 bp, 946 aa] {ON}
           similar to uniprot|Q08387 Saccharomyces cerevisiae
           YOR005c DNL4 DNA ligase IV
          Length = 946

 Score =  912 bits (2356), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 457/937 (48%), Positives = 638/937 (68%), Gaps = 26/937 (2%)

Query: 13  NFAPSPDFKWLCEELFSKIDEVQV-KGTIGTGKSRSFKYYEVLSNFVEMWRKTVGNNIYP 71
           NFAPSPDF WLCE+LF+KID VQ  +      K  + +YYEV+SNF  +WR TVGNNIYP
Sbjct: 24  NFAPSPDFLWLCEQLFAKIDHVQFERANNLLTKPVTARYYEVISNFTTLWRTTVGNNIYP 83

Query: 72  ALILALPYRDRRIYNIKDYVLIRTICSYLKLPKNSATEGRLKDWKQRVGKGKNLSSLLVE 131
           AL L LPYRDRR++NIKDY LI+ IC++LKLPK+S+TE +L +WKQ  G+   LS   VE
Sbjct: 84  ALRLILPYRDRRVFNIKDYTLIKAICAFLKLPKDSSTEKKLINWKQDAGRSVRLSKFCVE 143

Query: 132 EIAKRRSEPN---GKAITIDGINSTLDELSKDRSTSGRGFKNLVKSSPFLHCLESMSFVE 188
           EI KRRSEP     + ITID +N  LD+L+ +R+  GR FKNL  S     CL SM+F+E
Sbjct: 144 EIKKRRSEPQIDRNERITIDDLNGYLDQLAIERTEQGRSFKNLANSDIMNKCLTSMTFLE 203

Query: 189 LKYFFDILLKSRVIGGQEHKFLSCWHPDAQDYLSVVSDLKVVASKLYDPRVRLKNDDLTI 248
           ++YFFDILLK+R +GG EHK L+CWHPDAQDYLSVVSDL+ VA +L+DP  RL N DL I
Sbjct: 204 MQYFFDILLKNRPLGGHEHKLLNCWHPDAQDYLSVVSDLETVAKRLWDPSQRLGNQDLKI 263

Query: 249 KVGFAFAPQLAKKVNLPYEKICRALHNDFLVEEKMDGERIQVHYMNYGKSVRFYSRRGID 308
            +G AFAPQLA K+++ Y+KI   L  DF +EEKMDGERIQ+HY N+G  ++FYSRR  D
Sbjct: 264 NIGLAFAPQLATKLHVSYQKIGEKLGWDFFIEEKMDGERIQMHYTNFGSDIKFYSRRATD 323

Query: 309 YTYLYGASLSSGTISHHLDFTDNVRECVLDGEMVTFDARRKVILPFGLVKGSAKDALSFN 368
           YTYLYG +L +GT+++ ++   NV++CVLD E+VTFD+  K++LPFG+VK SAK+ LS +
Sbjct: 324 YTYLYGNNLKTGTLANFINLNKNVKDCVLDCEVVTFDSNNKIVLPFGMVKSSAKNMLSQD 383

Query: 369 SINNVDFHPLYVVFDLLYLNGTSLTPLPLHQRKEYLESILTPVKNVVEMVRTSRCYNVES 428
            I+   FHPL +VFD+LYLNG +L  LP ++R+EYL+ ILTP  + +E++++ R  + + 
Sbjct: 384 GIDTQGFHPLLMVFDVLYLNGATLVDLPYYKRREYLKQILTPTAHRIEIIKSIRANDEQM 443

Query: 429 IKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPEYLEEFGENLDLVIIGRDPGK 488
           IKKSLE A+S+GSEG++LK Y+S Y +ASR+++WIK+KPEYLE+FGEN+DLV++GRDP K
Sbjct: 444 IKKSLEKALSVGSEGIILKRYDSRYVIASRSDDWIKIKPEYLEQFGENMDLVLMGRDPSK 503

Query: 489 KDSFMLGLLLLNEKEMDKRDQEVSSGIANNSKNENILYSQKKVKKILSFCSVANGISQEE 548
           KDS MLGLL   E   D      S  + N+  +E    + ++ +  +S C +ANGIS EE
Sbjct: 504 KDSLMLGLLDYEEVIQD------SPIMVNSQSSEE---NSQRFRGFVSLCIIANGISNEE 554

Query: 549 FKEIDRKTRGCWKKTSEVAPPASIFEFGSKIPAEWIEPNESIVLEIKSRSLDNTETNMQK 608
           +KEIDRKT+G W   SE  PP    +FGSK+P +WI+P +S++LEIK+RSLDNT ++ +K
Sbjct: 555 YKEIDRKTKGLW-NDSEKIPPLEYMKFGSKVPRQWIDPKKSLILEIKARSLDNTRSSERK 613

Query: 609 YATSCTLYGGYCKRIRFDKDWTDCFTLNELYDSRSARFNPSYQAEKSHLKLVRKKRREVL 668
           +A  CTL+GGYC++IR DK+W  C+TL E   ++S   N   +      K++ KKRR  +
Sbjct: 614 FAAGCTLFGGYCRQIREDKNWKTCYTLQEFERAKSGN-NWRKRGSSKPQKVISKKRRYNI 672

Query: 669 TSN---TFDQKTEQIPTSIIFAGLYFYVLSDYVTNASEVRITRGELENAIVRHGGRLIYN 725
            S+     +   E    S IF G+YFYVLSDY       RI + E++  IV +GG+L+ N
Sbjct: 673 ISSVNKALEDFAELEHRSDIFDGMYFYVLSDYFDGVKRKRIKKSEIQKVIVANGGQLVQN 732

Query: 726 IILKRHYIGDVRLISCKNTTECRALINRGYDILHPSWVIDCVAYKKLIPIEPCYCFNVSQ 785
           +I + + + D+R+IS +NT EC +LI RGYDI+ P WV DC+   K++ +EP +CFN S+
Sbjct: 733 VITRNYNLNDLRIISSRNTVECNSLIVRGYDIISPKWVFDCLLSGKIMKLEPSHCFNFSK 792

Query: 786 KMRAVAEKRVDCLGDSFENDISETKLSLLYKSQHNLPPPEE--VERDAEVQVFPLFLFSN 843
           ++   A KR+D  GD +E DI++ + S L   +      ++  V+ D  +   P FLF  
Sbjct: 793 QLMDYAYKRIDQYGDPYERDINKYEWSSLTSEKICTTAKQQPDVQFDNSLMDVPHFLFHG 852

Query: 844 RIVYIPPRKIGMKYEKTLEMKIRLFGGKITDRQSLCNLVIIPYGDPTWRKDCIKEVNEQI 903
           RIV++      ++ E  +   +  +GGK+T+  S  NLVI+  G  T R+  I ++ +QI
Sbjct: 853 RIVFLLSDNNNIQKESFM---VDAYGGKVTNELSSANLVIV-VGAVTQRR--INDIRKQI 906

Query: 904 KEQVKALDTIPKIPRIVAPEWVDHSIYGNCQVPEEDF 940
             +V   D  P+IP +V+  W+   I  N QV E+++
Sbjct: 907 SSEVIKQDHPPRIPDMVSEGWLYDCIKQNTQVAEDNY 943

>Kpol_1032.7 s1032 complement(12295..15192) [2898 bp, 965 aa] {ON}
           complement(12295..15192) [2898 nt, 966 aa]
          Length = 965

 Score =  911 bits (2354), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/953 (48%), Positives = 641/953 (67%), Gaps = 28/953 (2%)

Query: 6   DSVPEPQNFAPSPDFKWLCEELFSKIDEVQVK-GTIGTGKSRSFKYYEVLSNFVEMWRKT 64
           + + EP NF+PSPDFKWLC+ELF K+D++Q +   +   K +  +YY++++NF+++WR+T
Sbjct: 26  NDIEEPHNFSPSPDFKWLCDELFVKLDQIQFRPKELNGSKPKYIEYYDIINNFIDIWRRT 85

Query: 65  VGNNIYPALILALPYRDRRIYNIKDYVLIRTICSYLKLPKNSATEGRLKDWKQRVGKGKN 124
           VGN+IYPALIL +PYRDRR+YNIK+  LIR +C YLKLPKNS TE RL  WK R  +   
Sbjct: 86  VGNDIYPALILTIPYRDRRMYNIKESKLIRIVCDYLKLPKNSETERRLMRWKHRADRNVR 145

Query: 125 LSSLLVEEIAKRRSEPNGK-AITIDGINSTLDELSKDRSTSGRGFKNLVKSSPFLHCLES 183
           LS+  VEEI KR+ EP  K  ITID +N  LD L  +R   G   + + +S  F  C E+
Sbjct: 146 LSTFCVEEIKKRKGEPREKIKITIDKLNECLDNLVLERGYKGSKSQKISESETFKFCFEN 205

Query: 184 MSFVELKYFFDILLKSRVIGGQEHKFLSCWHPDAQDYLSVVSDLKVVASKLYDPRVRLKN 243
           M++VELKYFFDILLK +++GG EHKFL+CWHPDAQDYLSVVSDLK+V+SKL++P  RLK 
Sbjct: 206 MTYVELKYFFDILLKDKIVGGLEHKFLNCWHPDAQDYLSVVSDLKIVSSKLWNPEFRLKY 265

Query: 244 DDLTIKVGFAFAPQLAKKVNLPYEKICRALHNDFLVEEKMDGERIQVHYMNYGKSVRFYS 303
           DDLTI +  AF P+ AK++   Y+ I R L NDF +EEKMDGERIQ+HYMNYG  ++F S
Sbjct: 266 DDLTINIDHAFTPETAKRLTYSYDTIARRLKNDFFIEEKMDGERIQLHYMNYGAKLKFLS 325

Query: 304 RRGIDYTYLYGASLSSGTISHHLDFTDNVRECVLDGEMVTFDARRKVILPFGLVKGSAKD 363
           RRG+DY+YLYG + ++G I  +L+F  +V+EC+LDGEMVT+D+ +  ILPFGLVK SA  
Sbjct: 326 RRGLDYSYLYGDNRNNGAIGRYLNFHKDVKECILDGEMVTYDSVKNCILPFGLVKSSAMQ 385

Query: 364 ALSFNSINNVDFHPLYVVFDLLYLNGTSLTPLPLHQRKEYLESILTPVKNVVEMVRTSRC 423
           +LS + I    +HPLY+ FDL+YLNG+SL+ LPLHQRK YL+ +L P  + VE++    C
Sbjct: 386 SLSVSDIEPDGYHPLYMAFDLVYLNGSSLSTLPLHQRKNYLDKLLIPCPDFVEILPALHC 445

Query: 424 YNVESIKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPEYLEEFGENLDLVIIG 483
            +   IK SLE AI LGSEG++LK ++S Y VA R+++WIK+KPEYLE+FGEN+DL++IG
Sbjct: 446 NDSSLIKSSLEKAIELGSEGIILKRFDSQYLVAKRSDDWIKIKPEYLEQFGENMDLIVIG 505

Query: 484 RDPGKKDSFMLGLLLLNEKEMDKRDQEVSSGIANNSKN-ENILYSQKKVKKILSFCSVAN 542
           RDPGKKDS M GL+L  + E     +E++S  +N +   E+ L   K  +KI+SFC++AN
Sbjct: 506 RDPGKKDSLMCGLILTGDNE----PEEITSLDSNPTDTAESFLKPDK--RKIISFCNIAN 559

Query: 543 GISQEEFKEIDRKTRGCWKKTSEVAPPASIFEFGSKIPAEWIEPNESIVLEIKSRSLDNT 602
           GISQ+EF++IDR T G W K  +  PP  +FEFG+K P EWI P  S+VLEIK+RSL+  
Sbjct: 560 GISQKEFRDIDRYTFGHWIKFDDELPPQDLFEFGTKHPIEWIYPEHSVVLEIKARSLETN 619

Query: 603 ETNMQKYATSCTLYGGYCKRIRFDKDWTDCFTLNELYDSRSARFNPSYQAEKSHLKLVRK 662
           E+   KY T  TL+GGYC++IR+DKDW  CFT NE  +SR+ +       +  +L + RK
Sbjct: 620 ESARIKYGTGSTLFGGYCRQIRYDKDWVSCFTYNEFMESRNLKNALVNYPDNKNL-IGRK 678

Query: 663 KRREVLTSNTFD---QKTEQIP--TSIIFAGLYFYVLSDYVTNASEVRITRGELENAIVR 717
           KR +    N+     + T+  P  +++IF GL+FYV+SDY+      R+++ +L N ++ 
Sbjct: 679 KRPKKRMFNSLTEIFENTKDAPDESNVIFRGLHFYVISDYIDETDGSRLSKSDLCNLVLE 738

Query: 718 HGGRLIYNIILKRHYIGDVRLISCKNTTECRALINRGYDILHPSWVIDCVAYKKLIPIEP 777
           H G+L++N I +   +  +R+IS K T E  +LI RGYDI+HP W++DC++ +KL+ + P
Sbjct: 739 HNGKLVHNPISRIDILNRLRIISMKYTRETTSLIERGYDIIHPQWILDCISNRKLVRLLP 798

Query: 778 CYCFNVSQKMRAVAEKRVDCLGDSFENDISETKLSLLYKSQ--HNLPPPEEVERDAEVQV 835
            +CFNVS  +  V + RVD  GDS+E  ++E    +L   Q   +    + +        
Sbjct: 799 SHCFNVSSSLMEVTKTRVDRYGDSYETSLTEKDFEILINRQVLKSESADKRITEGENHLK 858

Query: 836 FPLFLFSNRIVYIPPRKIGMK-YEKTLEMKIRLFGGKITDRQSLCNLVIIPYGDPTWRKD 894
            P+ LF NR  +IP        YE  L+ K+ L+GGK+ ++ S CN+++        R  
Sbjct: 859 IPILLFCNRRFFIPETLPSTPIYE--LKSKVELYGGKLVNKISDCNVIVFTNTHTENR-- 914

Query: 895 CIKEVNEQIKEQVKALD----TIPKIPRIVAPEWVDHSIYGNCQVPEEDFPVV 943
             KEV ++I+  +  LD     +P +PRIV   W+D  I    QVPEED+P V
Sbjct: 915 --KEVMKKIRRALVCLDPNSMQVPVLPRIVDANWIDACISECVQVPEEDYPAV 965

>Kwal_56.22414 s56 complement(117198..120089) [2892 bp, 963 aa] {ON}
           YOR005C (DNL4) - ATP dependent DNA ligase [contig 185]
           FULL
          Length = 963

 Score =  891 bits (2303), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/945 (47%), Positives = 622/945 (65%), Gaps = 25/945 (2%)

Query: 7   SVPEPQNFAPSPDFKWLCEELFSKIDEVQVKGTIGTGKSRSFKYYEVLSNFVEMWRKTVG 66
           S  +PQNFAPSPDF+WLC+ELFSK++E+  +     GK+ + K  EV+  F+++WR TVG
Sbjct: 32  SQKKPQNFAPSPDFRWLCDELFSKLEEI-TEDRQKLGKAVTVKRVEVIMYFIKLWRTTVG 90

Query: 67  NNIYPALILALPYRDRRIYNIKDYVLIRTICSYLKLPKNSATEGRLKDWKQRVGKGKNLS 126
           +NIYP L L LPYRD R YNIKDY L++ +C  L LPK+S TE RL +WKQ   +G +LS
Sbjct: 91  DNIYPVLRLILPYRDSRAYNIKDYTLVKAVCRSLNLPKDSLTEKRLLNWKQYAPRGTSLS 150

Query: 127 SLLVEEIAKRRSEPNG-KAITIDGINSTLDELSKDRSTSGRGFKNLVKSSPFLHCLESMS 185
              VEEI KRR EP G + +TID +N  LDELSK+ S    GF  L KS  F +CL++MS
Sbjct: 151 KFCVEEIMKRRKEPQGSQRLTIDALNKCLDELSKEASAKKWGFNGLSKSPSFQNCLQNMS 210

Query: 186 FVELKYFFDILLKSRVIGGQEHKFLSCWHPDAQDYLSVVSDLKVVASKLYDPRVRLKNDD 245
           F E +YFFDI+LK+RVIGG EHKFL+CWHPDAQDYL VVSDLKV++  L++P +RL  ++
Sbjct: 211 FSEQRYFFDIILKTRVIGGLEHKFLNCWHPDAQDYLGVVSDLKVLSETLWNPTMRLGKNE 270

Query: 246 LTIKVGFAFAPQLAKKVNLPYEKICRALHNDFLVEEKMDGERIQVHYMNYGKSVRFYSRR 305
           L+I +G AFAP LAK+++L YE++C  L  DF++EEKMDGERIQ+HY+  G  +RF SRR
Sbjct: 271 LSINIGRAFAPHLAKRLHLSYERVCAKLKQDFIIEEKMDGERIQLHYIERGAKIRFLSRR 330

Query: 306 GIDYTYLYGASLSSGTISHHLDFTDNVRECVLDGEMVTFDARRKVILPFGLVKGSAKDAL 365
           G D+T+LYG SL  G IS HL F ++V++CVLDGEMV+FD  + V+LPFG+VK +A + L
Sbjct: 331 GTDFTHLYGDSLEHGVISQHLKFKNDVQDCVLDGEMVSFDKEKNVVLPFGIVKSTAMEEL 390

Query: 366 SFNSINNVD---FHPLYVVFDLLYLNGTSLTPLPLHQRKEYLESILTPVKNVVEMVRTSR 422
             NS   VD   + PLY++FDL+YLNG SLT LPLH RK YL SIL+PV N+VE++   R
Sbjct: 391 -MNSDTKVDTDGYRPLYMIFDLVYLNGVSLTRLPLHLRKSYLRSILSPVANIVEILSDVR 449

Query: 423 CYNVESIKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPEYLEEFGENLDLVII 482
                +IK SLE AI +GSEG++LK ++S Y + +RN++WIK+KPEY EE GE +DLV+I
Sbjct: 450 ASEPNAIKVSLERAIEMGSEGIILKQFSSPYEIGARNDSWIKIKPEYFEELGETMDLVVI 509

Query: 483 GRDPGKKDSFMLGLLLLNEKEMDKRDQEVSSGIANNSKNENILYSQKKVKKILSFCSVAN 542
           GRDPGKKDS M GL+L +E +             N +  ++ L  +++  K++SFC++AN
Sbjct: 510 GRDPGKKDSLMCGLILADETD---------GSSVNLASQDDPLRPKQRNPKVISFCNIAN 560

Query: 543 GISQEEFKEIDRKTRGCWKKTSEVAPPASIFEFGSKIPAEWIEPNESIVLEIKSRSLDNT 602
           G+S  EFKEI+RKTRG W  T+   PP+ + EFG+K+P EWI+P  S+VLE+K+RS+D  
Sbjct: 561 GVSDAEFKEIERKTRGLWNLTTACPPPSGLLEFGTKLPTEWIDPRSSLVLEVKARSVDTD 620

Query: 603 ETNMQKYATSCTLYGGYCKRIRFDKDWTDCFTLNELYDSRSARFNPSYQAEKSHLKLVRK 662
           E + +KY T  TL G YC+ +RF+KDW+ C T+ +   ++ A  N      KSH    RK
Sbjct: 621 ELSSKKYKTGSTLRGAYCRALRFNKDWSTCATVQQYEQAKRAH-NYHKGKRKSHQISPRK 679

Query: 663 KRREVLTSNTF----DQKTEQIPTSIIFAGLYFYVLSDYVTNASEVRITRGELENAIVRH 718
           +R+    S  +    D   E I  S IF GL FY+LSDY+ ++ + R  + ++   + ++
Sbjct: 680 QRKLANVSELYPLLADDSRESIFESNIFQGLQFYILSDYI-DSQKKRYEKDQIGTLVRKN 738

Query: 719 GGRLIYNIILKRHYIGDVRLISCKNTTECRALINRGYDILHPSWVIDCVAYKKLIPIEPC 778
            G +++N  ++R     +R+IS KNT ECR+L  +GYDI+HPSW+ DC+ Y  L+ +EP 
Sbjct: 739 SGHVLHNNFVRREEFSRLRIISGKNTVECRSLTEKGYDIIHPSWIFDCLNYGSLVKLEPR 798

Query: 779 YCFNVSQKMRAVAEKRVDCLGDSFENDISETKLSLLYKSQHNLPPPEEVERDAEVQVFPL 838
           +CF  S+K+   + +RVD  GDSF   +S T+   L   Q  + P   +    E+   PL
Sbjct: 799 HCFRTSRKLLENSRQRVDRFGDSFCRPLSYTEFDELVNGQSVVSP--HLSAPEELDGIPL 856

Query: 839 FLFSNRIVYIPPRKIGMKYEKTLEMKIRLFGGKITDRQSLCNLVIIPYGDPTWRK--DCI 896
           FLF N  +Y          E+ LE  +RLFGG+ +     CNLV++       +K    +
Sbjct: 857 FLFQNFKIYFARVGNDPDQEEYLEKTLRLFGGERSLTLDCCNLVVVRVSFKEQKKLFKLV 916

Query: 897 KEVNEQIKEQVKALDTIPKIPRIVAPEWVDHSIYGNCQVPEEDFP 941
           + + ++I     + +   +IP +V+  W++  I   C VPEEDFP
Sbjct: 917 EGLRKRIASTAYSSEVDHRIPHLVSSNWLEACINEQCLVPEEDFP 961

>TBLA0G01040 Chr7 complement(258966..261884) [2919 bp, 972 aa] {ON}
           Anc_6.18 YOR005C
          Length = 972

 Score =  886 bits (2290), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/953 (46%), Positives = 646/953 (67%), Gaps = 23/953 (2%)

Query: 11  PQNFAPSPDFKWLCEELFSKIDEV--QVKGTIG---TGKSRSFKYYEVLSNFVEMWRKTV 65
           P+NFAPSPDFKWLC+ELF KID++  Q+K       + K  S +Y++ +++F+++WR T+
Sbjct: 23  PKNFAPSPDFKWLCDELFVKIDKIREQIKNKTANTISNKPISTRYFDTITHFIKLWRTTI 82

Query: 66  GNNIYPALILALPYRDRRIYNIKDYVLIRTICSYLKLPKNSATEGRLKDWKQRVGKGKNL 125
           G++I+PAL L LPYRDRR+YNIKD  LIR ICSYLKLPKNS  E RL  WK +  + + L
Sbjct: 83  GDDIFPALRLILPYRDRRVYNIKDLTLIRAICSYLKLPKNSVVERRLIRWKYKADRYETL 142

Query: 126 SSLLVEEIAKRRSEPNG---KAITIDGINSTLDELSKDRST-SGRGFKNLVKSSPFLHCL 181
           ++  + EI+KR++EP     + I+ID +N  LD+L  +R   + +   NL++   F  CL
Sbjct: 143 ATFCIHEISKRKNEPQVTQVERISIDKLNEILDDLVVNRQNWNNKKRSNLLQVETFKFCL 202

Query: 182 ESMSFVELKYFFDILLKSRVIGGQEHKFLSCWHPDAQDYLSVVSDLKVVASKLYDPRVRL 241
           E+M+F+ELKYFFDI++K++++G  E+ FL  WHPD+++YLSVVSDL+ +++KL++P +++
Sbjct: 203 ENMTFIELKYFFDIIVKNKILGSLENMFLKIWHPDSKEYLSVVSDLRTLSNKLWNPSIKI 262

Query: 242 KNDDLTIKVGFAFAPQLAKKVNLPYEKICRALHNDFLVEEKMDGERIQVHYMNYGKSVRF 301
            N DL+IKVG+ FAPQLAK++ L Y+ I   L+NDF +EEKMDGERIQ+HYMNYG++V+F
Sbjct: 263 NNSDLSIKVGYIFAPQLAKRLMLSYDTISNRLNNDFFIEEKMDGERIQLHYMNYGETVKF 322

Query: 302 YSRRGIDYTYLYGASLSSGTISHHLDFTDNVRECVLDGEMVTFDARRKVILPFGLVKGSA 361
           +SR G DYTYLYG   S+GTI+  L    NV+ECVLDGEMVTFD+  K +LPFGLVK SA
Sbjct: 323 FSRHGTDYTYLYGNDKSAGTIAKFLRLHKNVKECVLDGEMVTFDSTSKKVLPFGLVKSSA 382

Query: 362 KDALSFNSINNVDFHPLYVVFDLLYLNGTSLTPLPLHQRKEYLESILTPVKNVVEMVRTS 421
              L+   I+N  FHPL++VFD+LYLNG+SL  LPL +RKE+L ++LTP K+ VE++ + 
Sbjct: 383 SSQLNKKDIDNDSFHPLFMVFDILYLNGSSLIDLPLFKRKEFLNTVLTPYKDYVEILSSI 442

Query: 422 RCYNVESIKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPEYLEEFGENLDLVI 481
           RC +   IKK L+ AIS+GSEG+VLK Y S Y   +R+NNWIKVKPEYLEEFGEN+DL++
Sbjct: 443 RCTDSIQIKKGLDAAISVGSEGIVLKQYISKYIPNARHNNWIKVKPEYLEEFGENMDLIV 502

Query: 482 IGRDPGKKDSFMLGLLLLNEK----EMDKRDQEVSSGIANNSKNENI-LYSQKKVKKILS 536
           IGRD GKKD  + G+L+  EK    E  KR+ E+   I ++S ++++     + +KK++S
Sbjct: 503 IGRDSGKKDCLICGILVTEEKQELSENMKRESEIE--IISDSGDDDLDTKPSQGIKKVIS 560

Query: 537 FCSVANGISQEEFKEIDRKTRGCWKKTSEVAPPASIFEFGSKIPAEWIEPNESIVLEIKS 596
           FC++ANG+SQ E KEI+R TRG WK  +   PP  + EFG+K P EWI P +S+VLEIK+
Sbjct: 561 FCTIANGLSQNELKEINRITRGAWKNYNNETPPIDVLEFGTKKPVEWIYPQDSVVLEIKA 620

Query: 597 RSLDNTETNMQKYATSCTLYGGYCKRIRFDKDWTDCFTLNELYDSRSARFNPSYQAEKSH 656
           RSLD T+    KYAT CTLYGGYC++IR DKDWT C+TL++L  +   R     + +++ 
Sbjct: 621 RSLDRTDQTQYKYATGCTLYGGYCRQIRQDKDWTSCYTLHDLTYNEIKRHEKKNKNKQTL 680

Query: 657 LKLVRKKRREVLT-SNTFDQKTEQIPTSIIFAGLYFYVLSDYVTNASEVRITRGELENAI 715
           ++   +K+ ++++ +      T+    S +F GLYFY++SDY+ ++   RI R ++ + I
Sbjct: 681 IRSYSRKKSKIISPAGMLPNGTDLRLISDLFHGLYFYIISDYIPDSDAQRIDREDICSLI 740

Query: 716 VRHGGRLIYNIILKRHYIGDVRLISCKNTTECRALINRGYDILHPSWVIDCVAYKKLIPI 775
           +++GGR+IYN+I K + I  +R++S K+T EC  L+ RGYD+++ SW+ DC+    ++P+
Sbjct: 741 IKNGGRVIYNVIAKTYTISKLRILSSKSTIECTDLVRRGYDVINLSWLFDCLQAGVILPL 800

Query: 776 EPCYCFNVSQKMRAVAEKRVDCLGDSFENDISETKLSLLYKSQHNLPPPEE-----VERD 830
           EP +C  VS ++ A+A  R+D  GDS+E  + ++KL  L  S  N           + +D
Sbjct: 801 EPAHCLFVSNELLAIATDRIDKFGDSYEATLIDSKLLKLLDSNINKVNRSNSNLLLINKD 860

Query: 831 AEVQVFPLFLFSNRIVYIPPRKIGMKYEKTLEMKIRLFGGKITDRQSLCNLVIIPYGDPT 890
             V   P+FLF+NR  ++    I +    TL  +I+L+GG +  +   CN+++   G   
Sbjct: 861 EGVDSIPIFLFTNRKFFLIKEDILLGDRDTLIFQIKLYGGSLVTKLEDCNIIVGVCGSQL 920

Query: 891 WRKDCIKEVNEQIKEQVKALDTIPKIPRIVAPEWVDHSIYGNCQVPEEDFPVV 943
             K       + +K+ V A    P IPR V   W+  SI    Q+  ED+P++
Sbjct: 921 VNKKLGDLRCKLVKQYVDANFPQP-IPRAVNVSWITESIKAGYQLSPEDYPIL 972

>KLTH0C11286g Chr3 (926742..929597) [2856 bp, 951 aa] {ON} similar
           to uniprot|Q08387 Saccharomyces cerevisiae YOR005C DNL4
           DNA ligase required for nonhomologous end- joining
           (NHEJ) forms stable heterodimer with required cofactor
           Lif1p catalyzes DNA ligation as part of a complex with
           Lif1p and Nej1p involved in meiosis not essential for
           vegetative growth
          Length = 951

 Score =  848 bits (2190), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/946 (45%), Positives = 624/946 (65%), Gaps = 26/946 (2%)

Query: 10  EPQNFAPSPDFKWLCEELFSKIDEVQVKGTIGTGKSRSFKYYEVLSNFVEMWRKTVGNNI 69
           EP NFAPSPDF+WLCEELF ++D +  +     GK+ + K  E+++ F+++WR TVG++ 
Sbjct: 20  EPHNFAPSPDFRWLCEELFHRLDAIN-EHRQELGKAVTVKRVEIITCFIKLWRTTVGDDF 78

Query: 70  YPALILALPYRDRRIYNIKDYVLIRTICSYLKLPKNSATEGRLKDWKQRVGKGKNLSSLL 129
           +PAL L  PYRD R Y+IKD+ LI+ +C  L L ++S TE RL +WKQ  G+G +LS   
Sbjct: 79  FPALRLMFPYRDPRAYHIKDFTLIKAVCKALNLSRDSLTERRLLNWKQYAGRGTSLSKFC 138

Query: 130 VEEIAKRRSEP-NGKAITIDGINSTLDELSKDRS-TSGRGFKNLVKSSPFLHCLESMSFV 187
           V+EI+KRR EP   + +TIDG+N  LDEL+K+ S     G   L +S  F  CL+++SF+
Sbjct: 139 VQEISKRRKEPLPERQLTIDGLNEKLDELAKEASGKKAWGTTGLSESHSFQFCLKNLSFL 198

Query: 188 ELKYFFDILLKSRVIGGQEHKFLSCWHPDAQDYLSVVSDLKVVASKLYDPRVRLKNDDLT 247
           EL+YFFDI+LK+RVIGG EHKFL+CWHPDAQ YL VV+DLK+++ KL++P VRL   DL+
Sbjct: 199 ELRYFFDIVLKNRVIGGLEHKFLACWHPDAQIYLGVVTDLKILSKKLWNPSVRLDKRDLS 258

Query: 248 IKVGFAFAPQLAKKVNLPYEKICRALHNDFLVEEKMDGERIQVHYMNYGKSVRFYSRRGI 307
           I +G AFAP LAK++++ YE+IC  L +DF++EEKMDGERIQ+HY+N G  ++F SRRGI
Sbjct: 259 INIGHAFAPHLAKRLHVSYERICSKLKHDFILEEKMDGERIQLHYVNGGSVLKFLSRRGI 318

Query: 308 DYTYLYGASLSSGTISHHLDFTDNVRECVLDGEMVTFDARRKVILPFGLVKGSAKDALSF 367
           D+++LYG  ++ G IS +L    +VR+CVLDGEMV++D +RK+ILPFG+VK +A D L  
Sbjct: 319 DFSHLYGQEVARGVISQYLKLKSDVRDCVLDGEMVSYDKKRKIILPFGIVKSAAVDELIN 378

Query: 368 NSINNVD--FHPLYVVFDLLYLNGTSLTPLPLHQRKEYLESILTPVKNVVEMVRTSRCYN 425
           + + N +  + PLY+VFDL+YLNG SLT +PLH RKEYL+ IL+PV +VVE+++  R  +
Sbjct: 379 SEVGNENDGYRPLYMVFDLVYLNGVSLTKVPLHIRKEYLKEILSPVPDVVEILKGIRACD 438

Query: 426 VESIKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPEYLEEFGENLDLVIIGRD 485
            ++IK  ++ AI +GSEGV++K  +S+Y V +RN++W+K+KPEY E+ GE +DLV+IGRD
Sbjct: 439 AKAIKNFMQRAIEMGSEGVIVKQASSTYEVGARNDHWVKIKPEYFEDLGETMDLVVIGRD 498

Query: 486 PGKKDSFMLGLLLLNEKEMDKRDQEVSSGIANNSKNENILYSQKKVKKILSFCSVANGIS 545
           PGKKDS M GLL+ + + +     E    I +  + + I+       K +SFC+VANG+S
Sbjct: 499 PGKKDSLMCGLLVSDSEHI----LENFGPIEHGKEGDPII-------KCVSFCNVANGVS 547

Query: 546 QEEFKEIDRKTRGCWKKTSEVAPPASIFEFGSKIPAEWIEPNESIVLEIKSRSLDNTETN 605
            EEFKEI+RKTRG W    E  PP S+ EFGSKIP EWI+P  S+V+E+K+RS++N+E +
Sbjct: 548 DEEFKEINRKTRGSWVSYKEKPPPLSLLEFGSKIPVEWIDPKNSVVIEVKARSVENSEYS 607

Query: 606 MQKYATSCTLYGGYCKRIRFDKDWTDCFTLNELYDSRSARFNPSYQAEKSHLKLVRKKR- 664
            ++Y    TL+  YC+RIR DKDWT C ++ +   +++A     Y+  K H    R+KR 
Sbjct: 608 SKRYRAGSTLHSAYCRRIRNDKDWTTCTSVAQYQQAKAAHNYHRYK-RKVHQVSPRRKRN 666

Query: 665 -REVLTSNTFDQKTE-QIPTSIIFAGLYFYVLSDYVTNASEVRITRGELENAIVRHGGRL 722
             E+      + K+E     S IF GL+FY+LSDYVT+    R  RG +   +V+HGG +
Sbjct: 667 VHEIFEYCAGEAKSELDTEGSSIFEGLHFYILSDYVTSQRR-RYERGMVAAKVVKHGGLI 725

Query: 723 IYNIILKRHYIGDVRLISCKNTTECRALINRGYDILHPSWVIDCVAYKKLIPIEPCYCFN 782
           + NI ++  ++  +R++S K T ECR L+NRGYDI+ P W+ DC++    + IEP +CF 
Sbjct: 726 VKNIDMRPEHLSYLRIVSGKTTIECRNLVNRGYDIIDPCWIFDCISAGFQLGIEPKHCFQ 785

Query: 783 VSQKMRAVAEKRVDCLGDSFENDISETKLSLLYKSQHNLPPPEEVERDAEVQ----VFPL 838
            S+++   + +RVD  GDSF   +  T+   L+K   + P        + +Q      PL
Sbjct: 786 TSRRLLDNSRQRVDQYGDSFSRPLDTTEFQQLFKFFCSSPSDFSSRISSMLQDDLDEAPL 845

Query: 839 FLFSNRIVYIPPRKIGMKYEKTLEMKIRLFGGKITDRQSLCNLVIIPYGDPTWRKD-CIK 897
           FL     +Y+    +  +    L  KI L+GG +++     NLV++P    T R    ++
Sbjct: 846 FLLQRFKIYVLAADLIPQQFSILRRKIELYGGVVSETLEGANLVLVPSALSTARTAYYVQ 905

Query: 898 EVNEQIKEQVKALDTIPKIPRIVAPEWVDHSIYGNCQVPEEDFPVV 943
           E+ ++I     A +T  +IP IV  EW+D      C VPEEDF  +
Sbjct: 906 ELRQKIAGNAFAGNTNTRIPHIVRSEWLDTCTTEQCLVPEEDFSSI 951

>ACR008W Chr3 (368913..371858) [2946 bp, 981 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR005C (DNL4)
          Length = 981

 Score =  795 bits (2054), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/944 (43%), Positives = 586/944 (62%), Gaps = 24/944 (2%)

Query: 11  PQNFAPSPDFKWLCEELFSKIDEVQVKGTIGTGKSRSFKYYEVLSNFVEMWRKTVGNNIY 70
           P NF+PSPDF WLC+ELF K++EV +K     GK R  +  E+ SNFV +WRKTVGN+IY
Sbjct: 51  PINFSPSPDFCWLCDELFIKLEEVALKKK-DLGKPRKVRNLEITSNFVSLWRKTVGNDIY 109

Query: 71  PALILALPYRDRRIYNIKDYVLIRTICSYLKLPKNSATEGRLKDWKQRVGKGKNLSSLLV 130
           PAL+L+LPY DRR Y +KD  L++ +C ++KLP+NS TE RL  WKQ   +G  LS+  V
Sbjct: 110 PALVLSLPYNDRRSYRVKDVTLVKALCKHMKLPRNSETERRLLHWKQNAPRGVKLSTFCV 169

Query: 131 EEIAKRRSEPN-GKAITIDGINSTLDELSKDRSTSGRGFKNLVKSSPFLHCLESMSFVEL 189
           EE+ KRR EP   K ++ID +N  LD+L  + +     + +L +S  F +CLE MS+VEL
Sbjct: 170 EELQKRRREPVVPKRMSIDEVNGMLDKLEHESNVGKWSYISLAESPAFNYCLEHMSYVEL 229

Query: 190 KYFFDILLKSRVIGGQEHKFLSCWHPDAQDYLSVVSDLKVVASKLYDPRVRLKNDDLTIK 249
           ++FFDI+LK  ++ G E   LSCWHPDA+ Y  VVSDL++VA  LYDP  RL+ +DL+++
Sbjct: 230 RFFFDIVLKVPIVSGLESLLLSCWHPDAESYFKVVSDLRIVAHTLYDPNERLEKNDLSVR 289

Query: 250 VGFAFAPQLAKKVNLPYEKICRALHNDFLVEEKMDGERIQVHYMNYGKSVRFYSRRGIDY 309
           +G+AFAP +A++V +PYEK+   L NDF VEEKMDG+RIQVHYM+YG S+ ++SR GI+Y
Sbjct: 290 IGYAFAPHMAQRVKIPYEKVSTKLGNDFYVEEKMDGDRIQVHYMDYGNSIAYFSRNGINY 349

Query: 310 TYLYGASLSSGTISHHLDFTDNVRECVLDGEMVTFDARRKVILPFGLVKGSAKDALSFNS 369
           TYLYG + S G+IS+HL F + V+EC+LDGEMV++D   + ILPFGL K  A   ++F +
Sbjct: 350 TYLYGENSSKGSISNHLKFVEGVKECILDGEMVSYDKEMQCILPFGLTKSGASHQVNFET 409

Query: 370 INNVD--FHPLYVVFDLLYLNGTSLTPLPLHQRKEYLESILTPVKNVVEMVRTSRCYNVE 427
             + +  + PLY VFDLLYLNG  LT   + +RKEYLE IL P KNVV ++   RC + E
Sbjct: 410 TGHTEPTYRPLYAVFDLLYLNGQLLTNQDVVKRKEYLEKILIPSKNVVHLLSGPRCSDAE 469

Query: 428 SIKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPEYLEEFGENLDLVIIGRDPG 487
           +I  +L  A++ GSEG+VLK   S Y+V  R+++WIK+KPEYLE FGEN+DLV+IGRD G
Sbjct: 470 AITAALGAAVAHGSEGIVLKKARSKYSVGKRDDSWIKIKPEYLENFGENMDLVVIGRDKG 529

Query: 488 KKDSFMLGLLLLNEKEMDKRDQEVSSGIANNSKNENILYSQKKVKKILSFCSVANGISQE 547
           +KDSF+  L + ++ E  K +       +++  +   +  Q K++K +SFCS+ANGIS E
Sbjct: 530 RKDSFICALAVTDDSE--KNNPSSYESGSDSDSDSEPIIVQPKIEKFISFCSIANGISNE 587

Query: 548 EFKEIDRKTRGCWKKTSEVAPPASIFEFGSKIPAEWIEPNESIVLEIKSRSLDNTETNMQ 607
           EFKEIDR TRG W    E  PP    EFG+K P EWI+P  S+VLE+K+RS+DN E+   
Sbjct: 588 EFKEIDRLTRGNWFPYDERKPPTDWVEFGTKTPREWIDPKNSVVLEVKARSIDNEESKSD 647

Query: 608 KYATSCTLYGGYCKRIRFDKDWTDCFTLNELYDSRSAR--FNPSYQAEKSHLKLVRKKRR 665
            Y T  TLY  YCKRIR DK+W+   T+ E   +R AR  FN S  A+    +   +KRR
Sbjct: 648 LYKTGSTLYNAYCKRIRHDKNWSTASTVAEYDTAREARSYFNVSQNAKFGKDRSSPRKRR 707

Query: 666 EVLTSNTFDQKTEQIPTSIIFAGLYFYVLSDYVTNASEVRITRGELENAIVRHGGRLIYN 725
                   D    +   +    G YFYV S Y    S+  I   E+  A+V  GG  I+N
Sbjct: 708 TFHLVGDID--VTKPSKADFLKGYYFYVTSGYFDLQSKKNIDASEIGEAVVSCGGTYIHN 765

Query: 726 IILKRHYIGDVRLISCKNTTECRALINRGYDILHPSWVIDCVAYKKLIPIEPCYCFNVSQ 785
           + + R  +  + ++ CK+T E + LI RGYDI+HP W++DCV Y  ++ IEP Y ++ S+
Sbjct: 766 LRI-RASLDKLYILGCKDTRELKMLIERGYDIIHPEWLMDCVKYGTMLQIEPKYVYSASE 824

Query: 786 KMRAVAEKRVDCLGDSFENDISETKLSLLYKSQHNLPPPEEVERDAEVQVFPLFLFSNRI 845
           ++   A  + D  G+S++  ++E  L  L   Q       E+  DA  +   L +F   +
Sbjct: 825 ELMKQARNQEDKYGESYQLPVTEDTLKALANKQVEEGYASEMGTDAVSEYERLLIFKGWL 884

Query: 846 VYI-PPRKIGMKYEKTLEMKIRLFGGKITDRQSLCNLVIIPYGDPTWRKDCIKEVNEQ-- 902
            YI         +   ++  I   GG++T+   L  +V+         KDC  +++ Q  
Sbjct: 885 FYILDDYAYHSSWSDIVKWNIESCGGEVTNDLELATIVVAV-------KDCFSQLSLQAV 937

Query: 903 ---IKEQVKALDTIPKIPRIVAPEWVDHSIYGNCQVPEEDFPVV 943
              I  ++   + +  IP+IV  EWV+  +     V E+++  +
Sbjct: 938 RNNIGARITGSNDVQPIPKIVTSEWVEACMEAQYLVDEDEYAAI 981

>KLLA0D01089g Chr4 complement(97438..100161) [2724 bp, 907 aa] {ON}
           similar to uniprot|Q08387 Saccharomyces cerevisiae
           YOR005C DNL4 DNA ligase required for nonhomologous end-
           joining (NHEJ) forms stable heterodimer with required
           cofactor Lif1p catalyzes DNA ligation as part of a
           complex with Lif1p and Nej1p involved in meiosis not
           essential for vegetative growth
          Length = 907

 Score =  739 bits (1907), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/932 (42%), Positives = 570/932 (61%), Gaps = 51/932 (5%)

Query: 12  QNFAPSPDFKWLCEELFSKIDEVQVKGTIGTGKSRSFKYYEVLSNFVEMWRKTVGNNIYP 71
           +NF+PSP+FKWLC+EL  KI E   K  +  GK  + +Y E+++NF+++WR TVGN IYP
Sbjct: 5   ENFSPSPEFKWLCDELLGKIYETSSKKHL-IGKPVTVRYLEIITNFIKLWRSTVGNYIYP 63

Query: 72  ALILALPYRDRRIYNIKDYVLIRTICSYLKLPKNSATEGRLKDWKQRVGKGKNLSSLLVE 131
           AL L +P+RDRRIYN+K+  LI+ +C YL+LPK+S TE RL  WKQR  +G  LS   VE
Sbjct: 64  ALRLIVPFRDRRIYNVKENTLIKALCRYLRLPKSSETENRLLRWKQRAARGVKLSDFCVE 123

Query: 132 EIAKRRSEPNG-KAITIDGINSTLDELSKDRSTSGRGFKNLVKSSPFLHCLESMSFVELK 190
           EI KR+ +  G   ITID +N  LDE+S++ +    G+  L  S  F +CL  M+F+E+K
Sbjct: 124 EIRKRQKDYEGANRITIDELNGYLDEVSQEGNGKRMGYMALTDSRAFNYCLNHMTFMEMK 183

Query: 191 YFFDILLKSRVIGGQEHKFLSCWHPDAQDYLSVVSDLKVVASKLYDPRVRLKNDDLTIKV 250
           +FFDI+LK+RV+ G E+ FL+ WHPDA DYLSVVSDL V++ +LY+P  RL+  DL+I +
Sbjct: 184 FFFDIILKTRVLSGLENMFLTAWHPDATDYLSVVSDLDVLSQRLYNPNERLRQTDLSITI 243

Query: 251 GFAFAPQLAKKVNLPYEKICRALHNDFLVEEKMDGERIQVHYMNYGKSVRFYSRRGIDYT 310
             AF PQLAK+ +L YE++   L +DF++EEKMDGER+Q+HY+NYG+ +++ SRRG+D++
Sbjct: 244 SHAFEPQLAKRTHLSYERVASKLQHDFIIEEKMDGERLQIHYINYGEQIKYLSRRGVDFS 303

Query: 311 YLYGASLSSGTISHHLDFTDNVRECVLDGEMVTFDARRKVILPFGLVKGSAKDALSFNSI 370
           YLYG + SSG IS  L    NV++C+LDGEM+T+D  + ++LPFGLVK SA + +     
Sbjct: 304 YLYGENSSSGPISPSLKLHFNVKDCILDGEMITYDTEKDIVLPFGLVKSSAMNQIQSELA 363

Query: 371 N---NVDFHPLYVVFDLLYLNGTSLTPLPLHQRKEYLESILTPVKNVVEMVRTSRCYNVE 427
                  + PL+V FDL+YLNG SLT L L +RK+YL  ILTPV+  VE+++  +  N E
Sbjct: 364 GIAPTESYKPLFVAFDLVYLNGKSLTNLALERRKDYLTKILTPVERSVEIIQYMKAINAE 423

Query: 428 SIKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPEYLEEFGENLDLVIIGRDPG 487
           +IK SLE AIS+GSEG+VLK+ +S Y V SRN +WIK+KPEYLE+FGEN+DL+IIGR+ G
Sbjct: 424 AIKDSLEQAISMGSEGIVLKHLHSKYFVGSRNTDWIKIKPEYLEQFGENMDLLIIGREQG 483

Query: 488 KKDSFMLGLLLLNEKEMDKRDQEVSSGIANNSKNENILYSQKKVKKILSFCSVANGISQE 547
           KKDSF  GL + +  E+ ++                         + +SFC++ANG+S E
Sbjct: 484 KKDSFFCGLSISDPNEVAEK------------------------PRFISFCTIANGLSNE 519

Query: 548 EFKEIDRKTRGCWKKTSEVAPPASIFEFGSKIPAEWIEPNESIVLEIKSRSLDNTETNMQ 607
           EFK+I+RKT G W   SE  P  ++  FG+K+P EWI P +S+VLE+K+R++D  E+  +
Sbjct: 520 EFKDIERKTWGKWHIFSEDPPSPNLLGFGTKVPYEWIHPEDSVVLEVKARAIDTKESEKR 579

Query: 608 KYATSCTLYGGYCKRIRFDKDWTDCFTLNELYDSRSARFNPSYQAEKSHL----KLVRKK 663
           KY + CTL+ GYCK+IR+DKDW    + +E  D + AR    Y   KSH     K    K
Sbjct: 580 KYRSGCTLHFGYCKQIRYDKDWKTVASFSEFEDMKDAR--NFYNKRKSHQVTDGKKRASK 637

Query: 664 RREVLTSNTFDQKTEQIPTSIIFAGLYFYVLSDYVTNASEVRITRGELENAIVRHGGRLI 723
           R ++   N+ +      P S  F+   F V+SDY  +    RI++ +L + I+ HGG ++
Sbjct: 638 RAKIGIVNSSEPTALVAPVSNTFSNCRFRVISDYFDSTKRRRISQEDLCSVILEHGGEIV 697

Query: 724 YNIILKRHYIGDVRLISCKNTTECRALINRGYDILHPSWVIDCVAYKKLIPIEPCYCFNV 783
           Y          ++ +I  K T EC+ L+N    I+ PSW+  C+      P      F  
Sbjct: 698 YTSDENNLPQDNLYIIGEKLTRECKILLNAKNLIIRPSWIFSCIEEGYKTP------FTE 751

Query: 784 SQKMRAVAEKRVDCLGDSFENDISETKLS-LLYKSQHNLPPPEEVERDAEVQVFPLFLFS 842
           S   R   E  +DC    F  D +   L+ LL  +   +  P+    D  +   PLFLFS
Sbjct: 752 SDIFRGELESSMDC--SQFYTDFNTASLNHLLETANRGIKNPDS---DLLLPEVPLFLFS 806

Query: 843 N-RIVYIPPRKIGMKYEKTLEMKIRLFGGKITDRQSLCNLVIIPYGDPTWRKDCIKEVNE 901
           N ++  +    +       +E  I+  GG++   ++    +II + D   R+D      +
Sbjct: 807 NLKLAVLNSENVLDTSILEVEFAIKCHGGELVHIENAS--IIIVFNDFISREDLFSLRQK 864

Query: 902 QIKEQVK-ALDTIPKIPRIVAPEWVDHSIYGN 932
              + VK + ++ P+IPR+V   W   SI  N
Sbjct: 865 IASKAVKESTESTPRIPRMVDISWALDSIKDN 896

>SAKL0F10912g Chr6 complement(854430..856511) [2082 bp, 693 aa] {ON}
           similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination
          Length = 693

 Score =  119 bits (299), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 116/437 (26%), Positives = 181/437 (41%), Gaps = 53/437 (12%)

Query: 218 QDYLSVVSDLKVVASKLYDPRVRLKNDDLTIKVGFAFAPQLAKKVNLPYEKICRALHNDF 277
           +D    V + ++V +   +  +   N    +K G    P LAK      E + R     F
Sbjct: 293 RDAFCQVPNYEIVINTCLEHGIMEVNKHCVLKPGIPLKPMLAKPSKSITEVLDRFHGEKF 352

Query: 278 LVEEKMDGERIQVHYMNYGKSVRFYSRRGIDYTYLYGASLSSGTISHHLDFTDNVRECVL 337
             E K DGER QVH +  G S+  YSR G + T  Y        I  +L   +     +L
Sbjct: 353 TCEYKYDGERAQVHLLPDG-SMNIYSRNGENMTERY----PELHIRDYLADPETTHSLIL 407

Query: 338 DGEMVTFDARRKVILPFGLVKGSAKDALSFNSINNVDFHPLYVVFDLLYLNGTSLTPLPL 397
           D E V +D  +  ILPF ++    +  +      +V        FD+L  NG SL    L
Sbjct: 408 DCEAVAWDTEQGKILPFQILSTRKRKGVE---AKDVKVRVCLFAFDMLCYNGQSLINNSL 464

Query: 398 HQRKEYLESILTPVKNVVEMVRTSRCYNVESIKKSLEVAISLGSEGV---VLKYYNSSYN 454
            +R+EYL+ +L PV    +        N+E ++K LE ++    EG+   VL+   S Y 
Sbjct: 465 LERREYLQRVLKPVTGQFQFANELNSSNLEDVQKYLEQSVKDACEGLMVKVLEGEESHYE 524

Query: 455 VASRNNNWIKVKPEYLEEFGENLDLVIIGR--DPGKKDSFMLGLLLLNEKEMDKRDQEVS 512
            + R+ NW+K+K +YL+  G++LDL ++G     GK+     G LL              
Sbjct: 525 PSKRSRNWLKLKKDYLQGVGDSLDLCVLGAYYGRGKRTGTYGGFLL-------------- 570

Query: 513 SGIANNSKNENILYSQKKVKKILSFCSVANGISQEEFKEIDRKTRGCWKKTSEVAPPASI 572
            G  N    E             + C +  G S E    +  K      K S +  P + 
Sbjct: 571 -GCYNQDTGE-----------FETCCKIGTGFSDEMLVSLYEKL-----KPSSLEQPKAF 613

Query: 573 FEFGSKI-PAEWIEPNESIVLEIKSRSLDNT---ETNMQKYATSCTLYGGYCKRIRFDKD 628
           + + S   P  W EP  +++ E+ +  L  +   +     Y    +L      RIR DKD
Sbjct: 614 YVYDSSAEPDVWFEP--TMLFEVLTADLSLSPIYKAGNSAYGKGISLRFPRFIRIRDDKD 671

Query: 629 WTDCFT---LNELYDSR 642
             D  +   + ELY+S+
Sbjct: 672 VEDATSSEQIVELYESQ 688

>ACL155W Chr3 (81492..83585) [2094 bp, 697 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDL164C (CDC9)
          Length = 697

 Score =  116 bits (291), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 109/409 (26%), Positives = 170/409 (41%), Gaps = 52/409 (12%)

Query: 251 GFAFAPQLAKKVNLPYEKICRALHNDFLVEEKMDGERIQVHYMNYGKSVRFYSRRGIDYT 310
           G    P LAK      E + R     F  E K DGER QVH M  G ++R YSR   + T
Sbjct: 330 GIPLKPMLAKPTKSITEVLDRFQGQRFTCEYKYDGERAQVHLMEDG-TIRIYSRNSENMT 388

Query: 311 YLYGASLSSGTISHH--LDFTDNVRECVLDGEMVTFDARRKVILPFGLVKGSAKDALSFN 368
             Y        I  H  L      R  ++D E V +D  ++ ILPF ++    +  +   
Sbjct: 389 ERYP------EIQFHQFLANPQTTRSLIIDCEAVAWDNEKQKILPFQVLSTRKRKGVE-- 440

Query: 369 SINNVDFHPLYVVFDLLYLNGTSLTPLPLHQRKEYLESILTPVKNVVEMVRTSRCYNVES 428
            + +V        FDLLYLNG SL    L  R+++L S+L  V   ++         +  
Sbjct: 441 -LKDVKVRVCLFAFDLLYLNGESLLKCSLADRRKHLYSVLKVVPGELQFANEITTMELSE 499

Query: 429 IKKSLEVAISLGSEGVVLKYYN---SSYNVASRNNNWIKVKPEYLEEFGENLDLVIIGR- 484
           ++  LE ++S   EG+++K  +   S Y  + R+ NW+K+K +YLE  G++LDL ++G  
Sbjct: 500 LQTYLEQSVSASCEGLMVKMLDGEESQYEPSKRSRNWLKLKKDYLEGVGDSLDLAVLGAY 559

Query: 485 -DPGKKDSFMLGLLLLNEKEMDKRDQEVSSGIANNSKNENILYSQKKVKKILSFCSVANG 543
              GK+     G LL               G  N    E             + C +  G
Sbjct: 560 YGRGKRTGTYGGFLL---------------GCYNPDLEE-----------FETCCKIGTG 593

Query: 544 ISQEEFKEIDRKTRGCWKKTSEVAPPASIFEFGSKIPAEWIEPNESIVLEIKSRSLDNT- 602
            S+E  + +  +     K T   AP   +    S  P  W EP  +++ E+ +  L  + 
Sbjct: 594 FSEEVLQSLHAQ----LKDTVIAAPRGDVSYDDSSPPDVWFEP--AMLFEVLTADLSLSP 647

Query: 603 --ETNMQKYATSCTLYGGYCKRIRFDKDWTDCFTLNELYDSRSARFNPS 649
             +     Y    +L      RIR DK  TD  + +++ +    + N S
Sbjct: 648 VYKAGRDVYGKGISLRFPRFLRIREDKSVTDATSSDQIVEFYQRQANSS 696

>NDAI0A01940 Chr1 complement(432302..434599) [2298 bp, 765 aa] {ON}
           Anc_7.343 YDL164C
          Length = 765

 Score =  115 bits (289), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 114/418 (27%), Positives = 177/418 (42%), Gaps = 59/418 (14%)

Query: 243 NDDLTIKVGFAFAPQLAKKVNLPYEKICRALHNDFLVEEKMDGERIQVHYMNYGKSVRFY 302
           N+  +++ G    P LAK      E + R     F  E K DGER QVH +  G ++R Y
Sbjct: 390 NEHCSLRPGIPLKPMLAKPTKAINEILDRFQGETFTSEYKYDGERAQVHLLEDG-TMRIY 448

Query: 303 SRRGIDYTYLYGASLSSGTISHHLDFTDNVREC---VLDGEMVTFDARRKVILPFGLVKG 359
           SR G + T  Y          H  DF  +  E    +LD E V +D  ++ ILPF ++  
Sbjct: 449 SRNGENMTERYPEI-------HIGDFVKDRNETKTLILDCEAVAWDKEQQKILPFQVLST 501

Query: 360 SA-KDALSFNSINNVDFHPLYVVFDLLYLNGTSLTPLPLHQRKEYLESILTPVKNVVEMV 418
              KD L+     +V        FD+L  N   L    L +R+E L  + TP     +  
Sbjct: 502 RKRKDVLA----KDVKVRVCLFAFDILCHNSNKLINYSLKERREILHRVTTPAPGEFQYA 557

Query: 419 RTSRCYNVESIKKSLEVAISLGSEGVVLKYYN---SSYNVASRNNNWIKVKPEYLEEFGE 475
                 N++ ++K L+ +++   EG+++K      S Y  + R+ NW+K+K +YLE  G+
Sbjct: 558 TELTTSNLDELQKFLDQSVNDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGIGD 617

Query: 476 NLDLVIIGR--DPGKKDSFMLGLLLLNEKEMDKRDQEVSSGIANNSKNENILYSQKKVKK 533
           +LDL ++G     GK+     G LL               G  N++  E           
Sbjct: 618 SLDLCVLGAYYGRGKRTGTYGGFLL---------------GCYNDNTGE----------- 651

Query: 534 ILSFCSVANGISQEEFKEIDRKTRGCWKKTSEVAPPASIFEFGSKIPAEWIEPNESIVLE 593
             + C +  G S E  +++  K     K T    P A+     S  P  W EP  S++ E
Sbjct: 652 FETCCKIGTGFSDEMLQQLHEK----LKATVIDGPKATYIYDSSAEPDVWFEP--SLLFE 705

Query: 594 IKSRSLDNT---ETNMQKYATSCTLYGGYCKRIRFDK---DWTDCFTLNELYDSRSAR 645
           + +  L  +   +     Y    +L      RIR DK   D T    + ELY+++S R
Sbjct: 706 VLTADLSLSPIYKAGSSAYDKGVSLRFPRFIRIREDKGVEDATSSEQIIELYENQSHR 763

>KLLA0D12496g Chr4 complement(1059684..1061786) [2103 bp, 700 aa]
           {ON} similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination,
          Length = 700

 Score =  114 bits (286), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 102/417 (24%), Positives = 176/417 (42%), Gaps = 61/417 (14%)

Query: 243 NDDLTIKVGFAFAPQLAKKVNLPYEKICRALHNDFLVEEKMDGERIQVHYMNYGKSVRFY 302
           N  + ++ G    P LAK      E + R     F  E K DGER QVH    G S++ Y
Sbjct: 326 NQHIKLRPGIPLQPMLAKPTKSISEVLDRFQGTKFTCEYKYDGERAQVHLCRDG-SMKIY 384

Query: 303 SRRGIDYTYLYGASLSSGTISHHLDFTDNVRECVLDGEMVTFDARRKVILPFGLVKGSAK 362
           SR G D T  Y        + H++      +  ++D E V +D  +  ILPF ++    +
Sbjct: 385 SRNGEDMTERY----PEIDVKHYVKDLGATKSFIVDSEAVAWDQEQGKILPFQVLSTRKR 440

Query: 363 DALSFNSINNVDFHPLYVVFDLLYLNGTSLTPLPLHQRKEYLESILTPVKNVVEMVRTSR 422
             +    + +V        FD+L LN   L     H+R++ L       +   +      
Sbjct: 441 KGVE---LKDVKVRVCLYAFDILCLNDEPLINKSFHERRQILLDTFNGTQGQFDFANELT 497

Query: 423 CYNVESIKKSLEVAISLGSEGVVLKYYN---SSYNVASRNNNWIKVKPEYLEEFGENLDL 479
             N + ++K L+ ++    EG+++K      S Y  + R+ NW+K+K +YLE  G++LDL
Sbjct: 498 TTNFDELQKYLDQSVKDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGVGDSLDL 557

Query: 480 VII------GRDPGKKDSFMLGLLLLNEKEMDKRDQEVSSGIANNSKNENILYSQKKVKK 533
           V++      G+  G    F+LG   L+ +E +                            
Sbjct: 558 VVLGAYYGRGKRTGTYGGFLLGCYNLDSEEFE---------------------------- 589

Query: 534 ILSFCSVANGISQEEFKEIDRKTRGCWKKTSEVAPPASIFEFGSKIPAE-WIEPNESIVL 592
             + C +  G S E  +++  K      K + V  P++   + S  PA+ W EP  S++ 
Sbjct: 590 --TCCKIGTGFSDEMLQDLYTKL-----KDTTVEHPSTNVIYDSSAPADVWFEP--SMLF 640

Query: 593 EIKSRSLDNT---ETNMQKYATSCTLYGGYCKRIRFDKDWTDCFTLN---ELYDSRS 643
           E+ +  L  +   +   + +    +L      RIR DK+ TD  + +   E Y+S++
Sbjct: 641 EVLTADLSLSPVYKAGFEAFGKGISLRFPRFVRIRDDKNVTDATSSDQVIEFYESQA 697

>Kwal_56.24616 s56 (1076178..1078325) [2148 bp, 715 aa] {ON} YDL164C
           (CDC9) - DNA ligase [contig 161] FULL
          Length = 715

 Score =  111 bits (278), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 108/405 (26%), Positives = 171/405 (42%), Gaps = 53/405 (13%)

Query: 251 GFAFAPQLAKKVNLPYEKICRALHNDFLVEEKMDGERIQVHYMNYGKSVRFYSRRGIDYT 310
           G    P LAK      E + R     F  E K DGER QVH +  G S+R YSR G + T
Sbjct: 349 GIPLKPMLAKPSKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDG-SMRIYSRNGENMT 407

Query: 311 YLYGASLSSGTISHHLDFTDNVRECVLDGEMVTFDARRKVILPFGLVKGSAKDALSFNSI 370
             Y     S  ++H     D     +LD E V +D  + VILPF ++    +  +     
Sbjct: 408 ERYPEINISDFVAH----PDETHTLILDCEAVAWDKDKNVILPFQVLSTRKRKGVV---A 460

Query: 371 NNVDFHPLYVVFDLLYLNGTSLTPLPLHQRKEYLESILTPVKNVVEMVRTSRCYNVESIK 430
            +V        FD+L  N   L    L +R+ YLE IL PV   +++       +++ ++
Sbjct: 461 EDVKVRVCLFAFDILCYNDEPLINKSLAERRTYLERILKPVPGELQLASEVTTMSLDEMQ 520

Query: 431 KSLEVAISLGSEGVVLKYYN---SSYNVASRNNNWIKVKPEYLEEFGENLDLVIIGR--D 485
             L+ ++    EG+++K  +   S Y  + R+ NW+K+K +YL+  G++LDL ++G    
Sbjct: 521 LYLDQSVKDCCEGLMVKVLDGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLGAYYG 580

Query: 486 PGKKDSFMLGLLLLNEKEMDKRDQEVSSGIANNSKNENILYSQKKVKKILSFCSVANGIS 545
            GK+     G LL               G  N    E             + C +  G S
Sbjct: 581 RGKRTGTYGGFLL---------------GCYNQDTGE-----------FETCCKIGTGFS 614

Query: 546 QEEFKEIDRKTRGCWKKTSEVAPPASIFEFG-SKIPAEWIEPNESIVLEIKSRSLDNT-- 602
            E  + +  K        +E+  P + + +  S  P  W+EP  S++ E+ +  L  +  
Sbjct: 615 DEMLQNLYEKL-----SPTEIPEPKAFYVYSESAQPDVWLEP--SMLFEVLTADLSLSPV 667

Query: 603 -ETNMQKYATSCTLYGGYCKRIRFDK---DWTDCFTLNELYDSRS 643
            +     Y    +L      RIR DK   D T    + E Y+S+S
Sbjct: 668 YKAGGSSYGKGISLRFPRFIRIRDDKSVEDATSSEQVIEFYESQS 712

>CAGL0I03410g Chr9 complement(289606..291780) [2175 bp, 724 aa] {ON}
           highly similar to uniprot|P04819 Saccharomyces
           cerevisiae YDL164c CDC9 DNA ligase
          Length = 724

 Score =  111 bits (277), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 113/441 (25%), Positives = 184/441 (41%), Gaps = 51/441 (11%)

Query: 218 QDYLSVVSDLKVVASKLYDPRVRLKNDDLTIKVGFAFAPQLAKKVNLPYEKICRALHNDF 277
           +D    V + ++V +   D  +   ++  TI+ G    P LAK      E + R     F
Sbjct: 324 RDAFCQVPNYELVINACLDYGIMKLDEHCTIQPGIPLKPMLAKPTKAINEVLDRFQGQTF 383

Query: 278 LVEEKMDGERIQVHYMNYGKSVRFYSRRGIDYTYLYGASLSSGTISHHLDFTDNVRECVL 337
             E K DGER QVH +  G ++R YSR G + T  Y        I   L    +    +L
Sbjct: 384 TSEYKYDGERAQVHLLKDG-TMRIYSRNGENMTERY----PEIQIKDFLADPASTTSLIL 438

Query: 338 DGEMVTFDARRKVILPFGLVKGSAKDALSFNSINNVDFHPLYVVFDLLYLNGTSLTPLPL 397
           D E V +D  +  ILPF ++    +  ++   IN V        FD+L  N   L   PL
Sbjct: 439 DCEAVAWDKEQNKILPFQVLTTRKRKDVN---INEVKVRVCLFAFDILLHNDMRLINEPL 495

Query: 398 HQRKEYLESILTPVKNVVEMVRTSRCYNVESIKKSLEVAISLGSEGVVLKYYN---SSYN 454
            +R+E L  +  PV+   +        N++ ++K L+ ++    EG+++K  +   S Y 
Sbjct: 496 SKRREVLHEVTKPVEGEFQYATQMTTSNLDELQKFLDESVKNSCEGLMVKMMDGVESYYE 555

Query: 455 VASRNNNWIKVKPEYLEEFGENLDLVIIGRDPGK-KDSFMLGLLLLNEKEMDKRDQEVSS 513
            + R+ NW+K+K +YLE  G++LDL ++G   G+ K +   G  LL     D  D E   
Sbjct: 556 PSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYFGRGKRTGTYGGFLLGCYNADSEDFE--- 612

Query: 514 GIANNSKNENILYSQKKVKKILSFCSVANGISQEEFKEIDRKTRGCWKKTSEVAPPASIF 573
                                 + C +  G S+E  + +  K        + +  P   +
Sbjct: 613 ----------------------TCCKIGTGFSEEMLQTLYEKL-----SPTVIDGPKGTY 645

Query: 574 EFGSKI-PAEWIEPNESIVLEIKSRSLDNT---ETNMQKYATSCTLYGGYCKRIRFDK-- 627
            F S   P  W EP  +++ E+ +  L  +   +     Y    +L      RIR DK  
Sbjct: 646 VFDSSAEPDVWFEP--TMLFEVLTADLSLSPIYKAGSSVYDKGISLRFPRFLRIRDDKSV 703

Query: 628 -DWTDCFTLNELYDSRSARFN 647
            D T    + E+Y ++S   N
Sbjct: 704 EDATSSEQIIEMYQNQSHVAN 724

>YDL164C Chr4 complement(164987..167254) [2268 bp, 755 aa] {ON}
           CDC9DNA ligase found in the nucleus and mitochondria, an
           essential enzyme that joins Okazaki fragments during DNA
           replication; also acts in nucleotide excision repair,
           base excision repair, and recombination
          Length = 755

 Score =  109 bits (272), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 112/414 (27%), Positives = 174/414 (42%), Gaps = 55/414 (13%)

Query: 247 TIKVGFAFAPQLAKKVNLPYEKICRALHNDFLVEEKMDGERIQVHYMNYGKSVRFYSRRG 306
           T++ G    P LAK      E + R     F  E K DGER QVH +N G ++R YSR G
Sbjct: 384 TLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDG-TMRIYSRNG 442

Query: 307 IDYTYLYGASLSSGTISHHLDFTDNVRECVLDGEMVTFDARRKVILPFGLVKGSAKDALS 366
            + T  Y        I+  +   D  +  +LD E V +D  +  ILPF ++    +  + 
Sbjct: 443 ENMTERY----PEINITDFIQDLDTTKNLILDCEAVAWDKDQGKILPFQVLSTRKRKDVE 498

Query: 367 FNSINNVDFHPLYVVFDLLYLNGTSLTPLPLHQRKEYLESILTPVKNVVEMVRTSRCYNV 426
              +N+V        FD+L  N   L    L +R+EYL  +   V    +        N+
Sbjct: 499 ---LNDVKVKVCLFAFDILCYNDERLINKSLKERREYLTKVTKVVPGEFQYATQITTNNL 555

Query: 427 ESIKKSLEVAISLGSEGVVLKYYN---SSYNVASRNNNWIKVKPEYLEEFGENLDLVIIG 483
           + ++K L+ +++   EG+++K      S Y  + R+ NW+K+K +YLE  G++LDL ++G
Sbjct: 556 DELQKFLDESVNHSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLG 615

Query: 484 R--DPGKKDSFMLGLLLLNEKEMDKRDQEVSSGIANNSKNENILYSQKKVKKILSFCSVA 541
                GK+     G LL               G  N    E             + C + 
Sbjct: 616 AYYGRGKRTGTYGGFLL---------------GCYNQDTGE-----------FETCCKIG 649

Query: 542 NGISQEEFKEI-DRKTRGCWKKTSEVAPPASIFEFGSKI-PAEWIEPNESIVLEIKSRSL 599
            G S E  + + DR T       + +  P + F F S   P  W EP  + + E+ +  L
Sbjct: 650 TGFSDEMLQLLHDRLT------PTIIDGPKATFVFDSSAEPDVWFEP--TTLFEVLTADL 701

Query: 600 DNTETNMQKYAT---SCTLYGGYCKRIRFDK---DWTDCFTLNELYDSRSARFN 647
             +       AT     +L      RIR DK   D T    + ELY+++S   N
Sbjct: 702 SLSPIYKAGSATFDKGVSLRFPRFLRIREDKGVEDATSSDQIVELYENQSHMQN 755

>Smik_4.74 Chr4 complement(141744..144281) [2538 bp, 845 aa] {ON}
           YDL164C (REAL)
          Length = 845

 Score =  108 bits (271), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 78/258 (30%), Positives = 125/258 (48%), Gaps = 17/258 (6%)

Query: 247 TIKVGFAFAPQLAKKVNLPYEKICRALHNDFLVEEKMDGERIQVHYMNYGKSVRFYSRRG 306
           T++ G    P LAK      E + R     F  E K DGER QVH +N G ++R YSR G
Sbjct: 474 TLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDG-TMRIYSRNG 532

Query: 307 IDYTYLYGASLSSGTISHHLDFTDNVRECVLDGEMVTFDARRKVILPFGLVKGSAKDALS 366
            + T  Y   +        LD T N+   +LD E V +D  +  ILPF ++    +  + 
Sbjct: 533 ENMTERY-PEIKITDFIQDLDITKNL---ILDCEAVAWDKDQAKILPFQVLSTRKRKDVE 588

Query: 367 FNSINNVDFHPLYVVFDLLYLNGTSLTPLPLHQRKEYLESILTPVKNVVEMVRTSRCYNV 426
              +N+V        FD+L  N   L  + L +R+EYL  +   V    +        N+
Sbjct: 589 ---LNDVKVRVCLFAFDILCHNDERLINMSLRERREYLTKVTKVVPGEFQYATQIITNNL 645

Query: 427 ESIKKSLEVAISLGSEGVVLKYYNSS---YNVASRNNNWIKVKPEYLEEFGENLDLVII- 482
           + ++K L+ +++   EG+++K  + S   Y  + R+ NW+K+K +YLE  G++LDL ++ 
Sbjct: 646 DELQKFLDESVNHSCEGLMVKMLDGSESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLG 705

Query: 483 -----GRDPGKKDSFMLG 495
                G+  G    F+LG
Sbjct: 706 AYYGRGKRTGTYGGFLLG 723

>Suva_4.82 Chr4 complement(152544..154811) [2268 bp, 755 aa] {ON}
           YDL164C (REAL)
          Length = 755

 Score =  108 bits (269), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 108/409 (26%), Positives = 174/409 (42%), Gaps = 53/409 (12%)

Query: 247 TIKVGFAFAPQLAKKVNLPYEKICRALHNDFLVEEKMDGERIQVHYMNYGKSVRFYSRRG 306
           T+K G    P LAK      E + R     F  E K DGER QVH ++ G ++R YSR G
Sbjct: 384 TLKPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLDDG-TMRIYSRNG 442

Query: 307 IDYTYLYGASLSSGTISHHLDFTDNVRECVLDGEMVTFDARRKVILPFGLVKGSAKDALS 366
            + T  Y   +        LD T N+   +LD E V +D  +  ILPF ++    +  + 
Sbjct: 443 ENMTERY-PEIKITDFIQDLDATKNL---ILDCEAVAWDKEQGKILPFQVLSTRKRKDVE 498

Query: 367 FNSINNVDFHPLYVVFDLLYLNGTSLTPLPLHQRKEYLESILTPVKNVVEMVRTSRCYNV 426
              +++V        FD+L  NG  L    L +R+E L  +   V    +        N+
Sbjct: 499 ---LSDVKVRVCLFAFDVLCHNGERLINKSLRERRECLTKVTKVVPGEFQYATQIVTDNL 555

Query: 427 ESIKKSLEVAISLGSEGVVLKYYN---SSYNVASRNNNWIKVKPEYLEEFGENLDLVIIG 483
           + ++K L+ +++   EG+++K      S Y  + R+ NW+K+K +YLE  G++LDL ++G
Sbjct: 556 DELQKFLDESVNQSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLG 615

Query: 484 R--DPGKKDSFMLGLLLLNEKEMDKRDQEVSSGIANNSKNENILYSQKKVKKILSFCSVA 541
                GK+     G LL               G  N    E             + C + 
Sbjct: 616 AYYGRGKRTGTYGGFLL---------------GCYNQDTGE-----------FETCCKIG 649

Query: 542 NGISQEEFKEIDRKTRGCWKKTSEVAPPASIFEFGSKI-PAEWIEPNESIVLEIKSRSLD 600
            G S E  +++  +        + +  P + F F S   P  W EP  + + E+ +  L 
Sbjct: 650 TGFSDESLQQLHERL-----TPTIIDGPKATFVFDSSAEPDVWFEP--TTLFEVLTADLS 702

Query: 601 NT---ETNMQKYATSCTLYGGYCKRIRFDK---DWTDCFTLNELYDSRS 643
            +   +     +A   +L      RIR DK   D T    + ELY+++S
Sbjct: 703 LSPIYKAGSTTFAKGVSLRFPRFLRIREDKGVEDATSSEQIVELYENQS 751

>Kpol_2001.71 s2001 (195103..197283) [2181 bp, 726 aa] {ON}
           (195103..197283) [2181 nt, 727 aa]
          Length = 726

 Score =  106 bits (265), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 110/427 (25%), Positives = 177/427 (41%), Gaps = 50/427 (11%)

Query: 229 VVASKLYDPRVRLKNDDLTIKVGFAFAPQLAKKVNLPYEKICRALHNDFLVEEKMDGERI 288
           ++ S L D  + L N+   ++ G    P LAK      E +      +F  E K DGER 
Sbjct: 334 IIQSCLNDGIMELDNN-CKLRPGIPLKPMLAKPTKAINEVLDAFQGEEFTCEYKYDGERG 392

Query: 289 QVHYMNYGKSVRFYSRRGIDYTYLYGASLSSGTISHHLDFTDNVRECVLDGEMVTFDARR 348
           QVH ++ G+ +R YSR G + T  Y        +      TD     +LD E+V +D  +
Sbjct: 393 QVHLLSNGE-MRIYSRNGENMTERYPELHIEDFLVKDESNTDKEVSLILDCEVVAWDNEQ 451

Query: 349 KVILPFGLVKGSAKDALSFNSINNVDFHPLYVVFDLLYLNGTSLTPLPLHQRKEYLESIL 408
             ILPF ++    +  +    + +V        FD+LY NG  L    L +R++ L  + 
Sbjct: 452 NKILPFQVLSTRKRKGVE---LKDVKVRVCLFAFDILYYNGEGLITKTLRERRKILHEVT 508

Query: 409 TPVKNVVEMVRTSRCYNVESIKKSLEVAISLGSEGVVLKYYN---SSYNVASRNNNWIKV 465
             V    +   +     ++ I+K L+ AI    EG+++K  +   S Y  + R+ NW+K+
Sbjct: 509 KCVPGEFQYATSLITAELDEIQKFLDQAIKDSCEGLMVKILDGEESRYEPSKRSRNWLKL 568

Query: 466 KPEYLEEFGENLDLVIIGR--DPGKKDSFMLGLLLLNEKEMDKRDQEVSSGIANNSKNEN 523
           K +YL   G++LDL ++G     GK+     G LL               G  N    E 
Sbjct: 569 KKDYLAGVGDSLDLCVMGAYYGKGKRTGTYGGFLL---------------GCYNQDSGE- 612

Query: 524 ILYSQKKVKKILSFCSVANGISQEEFKEIDRKTRGCWKKTSEVAPPASIFEFGSKI-PAE 582
                       + C +  G S E   ++    R       E+  P S + F S   P  
Sbjct: 613 ----------YETCCKIGTGFSDEMLTKLYELFR-----EEEIEVPKSFYNFDSSAEPDI 657

Query: 583 WIEPNESIVLEIKSRSLDNT---ETNMQKYATSCTLYGGYCKRIRFDK---DWTDCFTLN 636
           W EP   ++ E+ +  L  +   +     Y    +L      RIR DK   D T    + 
Sbjct: 658 WFEPK--VLFEVLTADLSLSPIYKAGSATYDKGISLRFPRFLRIRDDKSVEDATSSDQII 715

Query: 637 ELYDSRS 643
           E+Y+++S
Sbjct: 716 EMYENQS 722

>Skud_4.93 Chr4 complement(160642..162909) [2268 bp, 755 aa] {ON}
           YDL164C (REAL)
          Length = 755

 Score =  105 bits (261), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 110/414 (26%), Positives = 175/414 (42%), Gaps = 63/414 (15%)

Query: 247 TIKVGFAFAPQLAKKVNLPYEKICRALHNDFLVEEKMDGERIQVHYMNYGKSVRFYSRRG 306
           T++ G    P LAK      E + R     F  E K DGER QVH +N G ++R YSR G
Sbjct: 384 TLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDG-TMRIYSRNG 442

Query: 307 IDYTYLYGASLSSGTISHHLDFTDNVRECVLDGEMVTFDARRKVILPFGLVKGSAKDALS 366
            + T  Y        I+  +   ++ +  +LD E V +D  +K ILPF +        LS
Sbjct: 443 ENMTERY----PEIKITDFIQDLNSTKNLILDCEAVAWDKEQKKILPFQI--------LS 490

Query: 367 FNSINNVDFHPLYV-----VFDLLYLNGTSLTPLPLHQRKEYLESILTPVKNVVEMVRTS 421
                +V+ H + V      FD+L  N   L    L +R+E+L  +   V    +     
Sbjct: 491 TRKRKDVELHDVKVKVCLFAFDILCYNDERLINKSLRERREHLAKVTKVVPGEFQYATQI 550

Query: 422 RCYNVESIKKSLEVAISLGSEGVVLKYYN---SSYNVASRNNNWIKVKPEYLEEFGENLD 478
              N++ ++K L+ +++   EG+++K  +   S Y  + R+ NW+K+K +YLE  G++LD
Sbjct: 551 ITNNLDELQKFLDESVNNSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLEGVGDSLD 610

Query: 479 LVIIGR--DPGKKDSFMLGLLLLNEKEMDKRDQEVSSGIANNSKNENILYSQKKVKKILS 536
           L ++G     GK+     G LL               G  N    E             +
Sbjct: 611 LCVLGAYYGRGKRTGTYGGFLL---------------GCYNQDTGE-----------FET 644

Query: 537 FCSVANGISQEEFKEIDRKTRGCWKKTSEVAPPASIFEF-GSKIPAEWIEPNESIVLEIK 595
            C +  G S E  + +  +        + +  P + F F  S  P  W EP  + + E+ 
Sbjct: 645 CCKIGTGFSDEMLQLLHERL-----TPTIIDGPKATFVFDASAEPDVWFEP--TTLFEVL 697

Query: 596 SRSLDNTETNMQKYAT---SCTLYGGYCKRIRFDK---DWTDCFTLNELYDSRS 643
           +  L  +       AT     +L      RIR DK   D T    + ELY+++S
Sbjct: 698 TADLSLSPIYKAGSATFDKGVSLRFPRFLRIREDKGVEDATSSDQIIELYENQS 751

>TPHA0D04570 Chr4 (996539..998749) [2211 bp, 736 aa] {ON} Anc_7.343
           YDL164C
          Length = 736

 Score =  105 bits (261), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 109/422 (25%), Positives = 173/422 (40%), Gaps = 66/422 (15%)

Query: 247 TIKVGFAFAPQLAKKVNLPYEKICRALHNDFLVEEKMDGERIQVHYMNYGKSVRFYSRRG 306
           T++ G    P LAK      E +      +F+ E K DGER QVH +  G  +R YSR G
Sbjct: 352 TLRPGIPLKPMLAKPTKAITEVLNAFQGKEFISEYKYDGERAQVHLLE-GGEMRIYSRNG 410

Query: 307 IDYTYLYGASLSSGTISHHLDFTDN---------VRECVLDGEMVTFDARRKVILPFGLV 357
            + T  Y        +      T++         V++ +LD E+V +D  +K ILPF   
Sbjct: 411 ENMTERYPELDVKDFLCVVKAITNDQEGENAIQPVKDIILDCEVVAWDVEQKKILPF--- 467

Query: 358 KGSAKDALSFNSINNVDFHPLYV-----VFDLLYLNGTSLTPLPLHQRKEYLESILTPVK 412
                  L+     NVD   + V      FDLLYLN   +    L +R+E L  +   V 
Sbjct: 468 -----QVLTTRKRKNVDLKDVKVRVCLFAFDLLYLNNEGMINKSLRERQEILRKVTVLVP 522

Query: 413 NVVEMVRTSRCYNVESIKKSLEVAISLGSEGVVLKYYN---SSYNVASRNNNWIKVKPEY 469
              +   +    +++ ++  L+ A+    EG+++K  +   S Y  + R+ NW+K+K +Y
Sbjct: 523 GEFQYATSLITSDMDELQTFLDQAVKNSCEGLMVKMLDGEESHYEPSKRSRNWLKLKKDY 582

Query: 470 LEEFGENLDLVIIGR--DPGKKDSFMLGLLLLNEKEMDKRDQEVSSGIANNSKNENILYS 527
           L+  G++LDLV++G     GK+     G LL               G  N    E     
Sbjct: 583 LDGVGDSLDLVVMGAYFGKGKRTGSYGGFLL---------------GCYNEDTQE----- 622

Query: 528 QKKVKKILSFCSVANGISQEEFKEIDRKTRGCWKKTSEVAPPASIFEFGSKIPAEWIEPN 587
                   + C +  G S E    +        + T    PP +     S  P  W +  
Sbjct: 623 ------FETCCKIGTGFSDEMLGNL----HTLLQPTEIDNPPMTYIYDSSAEPDVWFQAK 672

Query: 588 ESIVLEIKSRSLDNT---ETNMQKYATSCTLYGGYCKRIRFDKDWTDCFT---LNELYDS 641
             ++ E+ +  L  +   +    +Y    +L      RIR DKD TD  T   + E Y+S
Sbjct: 673 --VLFEVLTADLSLSPVYKAGNSRYDKGISLRFPRFLRIREDKDVTDGTTSEDIIEFYES 730

Query: 642 RS 643
           +S
Sbjct: 731 QS 732

>KLTH0H01408g Chr8 complement(129752..131923) [2172 bp, 723 aa] {ON}
           similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination
          Length = 723

 Score =  104 bits (260), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 106/405 (26%), Positives = 167/405 (41%), Gaps = 53/405 (13%)

Query: 251 GFAFAPQLAKKVNLPYEKICRALHNDFLVEEKMDGERIQVHYMNYGKSVRFYSRRGIDYT 310
           G    P LAK      E + R     F  E K DGER QVH +  G S+R YSR G + T
Sbjct: 357 GIPLKPMLAKPSKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDG-SMRIYSRNGENMT 415

Query: 311 YLYGASLSSGTISHHLDFTDNVRECVLDGEMVTFDARRKVILPFGLVKGSAKDALSFNSI 370
             Y        IS  +         +LD E V +D  +  ILPF ++    +  ++   +
Sbjct: 416 ERY----PEIRISDFIADPARTHTLILDCEAVAWDKEKNTILPFQVLSTRKRKGVA---V 468

Query: 371 NNVDFHPLYVVFDLLYLNGTSLTPLPLHQRKEYLESILTPVKNVVEMVRTSRCYNVESIK 430
            +V        FD+L  N   L   PL +R+  LE  L PV   +++       +++ ++
Sbjct: 469 EDVKVRVCLFAFDILCYNDEPLITRPLAERRACLERALVPVPGELQLASEVTTMSLDELQ 528

Query: 431 KSLEVAISLGSEGVVLKYYN---SSYNVASRNNNWIKVKPEYLEEFGENLDLVIIGR--D 485
             L+ A+    EG+++K      S Y  + R+ NW+K+K +YL+  G++LDL ++G    
Sbjct: 529 HYLDQAVRDCCEGLMVKILEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLGAYYG 588

Query: 486 PGKKDSFMLGLLLLNEKEMDKRDQEVSSGIANNSKNENILYSQKKVKKILSFCSVANGIS 545
            GK+     G LL               G  N    E   Y         + C +  G S
Sbjct: 589 RGKRTGTYGGFLL---------------GCYNQDSGE---YE--------TCCKIGTGFS 622

Query: 546 QEEFKEI-DRKTRGCWKKTSEVAPPASIFEFGSKIPAEWIEPNESIVLEIKSRSLDNT-- 602
           +E  + + DR        T+   P A      S  P  W EP  +++ E+ +  L  +  
Sbjct: 623 EEMLQTLFDR-----LSPTAIPTPKAFYVHSESAPPDVWFEP--TLLFEVLTADLSLSPV 675

Query: 603 -ETNMQKYATSCTLYGGYCKRIRFDK---DWTDCFTLNELYDSRS 643
            +     Y    +L      R+R DK   + T    + E Y+S+S
Sbjct: 676 YKAGTSSYGKGISLRFPRFIRLRDDKTPEEATSSEQVVEFYESQS 720

>TBLA0E02050 Chr5 (498038..500200) [2163 bp, 720 aa] {ON} Anc_7.343
           YDL164C
          Length = 720

 Score =  104 bits (260), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 103/401 (25%), Positives = 164/401 (40%), Gaps = 54/401 (13%)

Query: 251 GFAFAPQLAKKVNLPYEKICRALHNDFLVEEKMDGERIQVHYMNYGKSVRFYSRRGIDYT 310
           G    P LAK      E +    +  F  E K DGER QVH +  G S+R YSR G D T
Sbjct: 353 GIPLKPMLAKPTKSISEVLDTFQNIQFTSEYKYDGERAQVHLLPDG-SMRIYSRNGEDMT 411

Query: 311 YLYGASLSSGTISHHLDFTDNVRECVLDGEMVTFDARRKVILPFGLVKGSAKDALSFNSI 370
             Y        I  +L  +    + +LD E V +D   + ILPF ++    + ++    +
Sbjct: 412 QRY----PELNIQDYLVDSTTTTQLILDCEAVAWDVELQKILPFQVLSTRKRKSVD---L 464

Query: 371 NNVDFHPLYVVFDLLYLNGTSLTPLPLHQRKEYLESILTPVKNVVEMVRTSRCYNVESIK 430
            ++        FD+L  N  SL    L +R++ L SI  P     +        N++ ++
Sbjct: 465 KDIKVRVCLFAFDILRHNNDSLINNTLRERRDILHSITKPCPGQFQFATELTTSNLDELQ 524

Query: 431 KSLEVAISLGSEGVVLKYYN---SSYNVASRNNNWIKVKPEYLEEFGENLDLVIIGRDPG 487
             L+ AI    EG+++K  +   S Y  + R+ NW+K+K +YL+  G++LDL ++G   G
Sbjct: 525 TFLDKAIKDSCEGLMVKSLDGTDSHYEPSKRSRNWLKLKKDYLQGMGDSLDLCVLGAYYG 584

Query: 488 K-KDSFMLGLLLLNEKEMDKRDQEVSSGIANNSKNENILYSQKKVKKILSFCSVANGISQ 546
           + K +   G  LL     D  + E                           C +  G S 
Sbjct: 585 RGKRTGTYGGFLLACYNQDTEEFETC-------------------------CKIGTGFSD 619

Query: 547 EEFKEIDRKTRGCWKKTSEVAPPASIFEFGSKIPAEWIEPNESIVLEIKSRSLDNTETNM 606
           E  + +        K+T+  +P A+     S  P  W  P  ++V E+ +  L  +    
Sbjct: 620 EMLQTL----YNGLKETAIESPRANFVFDSSAEPDVWFNP--TMVFEVLTADLSLSPI-- 671

Query: 607 QKYATSCTLYGGYCK-------RIRFDKDWTDCFTLNELYD 640
             Y    T+YG           RIR DK   D  +  ++ D
Sbjct: 672 --YKAGSTVYGKGISLRFPRFIRIRTDKSVNDATSSEQVID 710

>KAFR0B00830 Chr2 (157155..159287) [2133 bp, 710 aa] {ON} Anc_7.343
           YDL164C
          Length = 710

 Score =  103 bits (258), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 106/413 (25%), Positives = 176/413 (42%), Gaps = 53/413 (12%)

Query: 243 NDDLTIKVGFAFAPQLAKKVNLPYEKICRALHNDFLVEEKMDGERIQVHYMNYGKSVRFY 302
           ++  +++ G    P LAK      E   R  +  F  E K DGER QVH MN G S+R Y
Sbjct: 335 DEHCSLRPGIPLKPMLAKPTKTIMEVFDRFQNIHFTSEYKYDGERAQVHLMNDG-SMRIY 393

Query: 303 SRRGIDYTYLYGASLSSGTISHHLDFTDNVRECVLDGEMVTFDARRKVILPFGLVKGSAK 362
           SR G + T  Y   ++       L+ T ++   ++D E V +D   K ILPF ++    +
Sbjct: 394 SRNGENMTERY-PEINVTDFIKDLNLTKSL---IIDCEAVAWDREEKKILPFQVLSTRKR 449

Query: 363 DALSFNSINNVDFHPLYVVFDLLYLNGTSLTPLPLHQRKEYLESILTPVKNVVEMVRTSR 422
             +    I ++        FD+L  N   L    L +R+E L S+   V       +   
Sbjct: 450 KDVD---IKDIKVRICLFAFDILCHNDEKLINKSLRERREILHSVTREVHGEFTYAKELS 506

Query: 423 CYNVESIKKSLEVAISLGSEGVVLKYYN---SSYNVASRNNNWIKVKPEYLEEFGENLDL 479
             N++ ++  L+ ++    EG+++K  +   S Y  + R+ NW+K+K +YL+  G++LDL
Sbjct: 507 TNNLDELQLFLDQSVKDSCEGLMVKVLDGEDSHYEPSKRSRNWLKLKKDYLDGVGDSLDL 566

Query: 480 VIIGR--DPGKKDSFMLGLLLLNEKEMDKRDQEVSSGIANNSKNENILYSQKKVKKILSF 537
            ++G     GK+     G LL               G  N    E             + 
Sbjct: 567 CVLGAFYGRGKRTGTYGGFLL---------------GCYNQDTGE-----------FETA 600

Query: 538 CSVANGISQEEFKEI-DRKTRGCWKKTSEVAPPASIFEFGSKIPAEWIEPNESIVLEIKS 596
           C +  G S E  + + DR      K T+   P A+     S  P  W EP  +++ E+ +
Sbjct: 601 CKIGTGFSDEVLQSLYDR-----LKSTTIDGPKATYIYDSSAQPDVWFEP--TLLFEVLT 653

Query: 597 RSLDNT---ETNMQKYATSCTLYGGYCKRIRFDK---DWTDCFTLNELYDSRS 643
             L  +   +     Y+   +L      R+R DK   + T    + ELY+++S
Sbjct: 654 ADLSMSPIYKAGASTYSKGISLRFPRFIRLREDKSVEEATSSEQIIELYENQS 706

>TDEL0C02040 Chr3 complement(352579..354696) [2118 bp, 705 aa] {ON}
           Anc_7.343 YDL164C
          Length = 705

 Score =  103 bits (258), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 106/437 (24%), Positives = 180/437 (41%), Gaps = 51/437 (11%)

Query: 218 QDYLSVVSDLKVVASKLYDPRVRLKNDDLTIKVGFAFAPQLAKKVNLPYEKICRALHNDF 277
           +D    V + ++V +   D  +   +    ++ G    P LAK      E + R     F
Sbjct: 306 RDAFCQVPNYEIVINACLDYGIMELDKHCRLRPGIPLKPMLAKPTKSITEVLDRFQGQTF 365

Query: 278 LVEEKMDGERIQVHYMNYGKSVRFYSRRGIDYTYLYGASLSSGTISHHLDFTDNVRECVL 337
             E K DGER QVH +  G ++R YSR G + T  Y       +I   +   ++ +  +L
Sbjct: 366 TSEYKYDGERAQVHLLEDG-TMRIYSRNGENMTERY----PEISIRDFVADLEHTKTLIL 420

Query: 338 DGEMVTFDARRKVILPFGLVKGSAKDALSFNSINNVDFHPLYVVFDLLYLNGTSLTPLPL 397
           D E V +D  ++ ILPF ++    +  +      +V        FD++  NG       L
Sbjct: 421 DCEAVAWDKVQQKILPFQVLSTRKRKDVE---AKDVKVRVCLFAFDIICHNGERQINKSL 477

Query: 398 HQRKEYLESILTPVKNVVEMVRTSRCYNVESIKKSLEVAISLGSEGVVLKYYN---SSYN 454
            +R+E L  +  PV    +        +VE ++K L+ ++    EG+++K  +   S Y 
Sbjct: 478 RERRELLAQVTKPVAGEFQYAVELTTSSVEELQKFLDQSVKDSCEGLMVKMLDGPESHYE 537

Query: 455 VASRNNNWIKVKPEYLEEFGENLDLVIIGR--DPGKKDSFMLGLLLLNEKEMDKRDQEVS 512
            + R+ NW+K+K +YL+  G++LDL ++G     GK+     G LL              
Sbjct: 538 PSKRSRNWLKLKKDYLDGVGDSLDLCVLGAYYGRGKRTGTYGGFLL-------------- 583

Query: 513 SGIANNSKNENILYSQKKVKKILSFCSVANGISQEEFKEIDRKTRGCWKKTSEVAPPASI 572
            G  N    E             + C +  G S E  +++  +    + KT+   P A+ 
Sbjct: 584 -GCYNQDSGE-----------FETCCKIGTGFSDEMLQQLYER----FSKTTLDGPKATY 627

Query: 573 FEFGSKIPAEWIEPNESIVLEIKSRSLDNT---ETNMQKYATSCTLYGGYCKRIRFDK-- 627
               S  P  W EP  + + E+ +  L  +   +     Y    +L      R+R DK  
Sbjct: 628 VFDSSAEPDVWFEP--TTLFEVLTADLSLSPVYKAGASTYDKGVSLRFPRFVRLRDDKSV 685

Query: 628 -DWTDCFTLNELYDSRS 643
            D T    + ELY  +S
Sbjct: 686 EDATSSAQIVELYQDQS 702

>KNAG0C03740 Chr3 (737968..740151) [2184 bp, 727 aa] {ON} Anc_7.343
           YDL164C
          Length = 727

 Score = 99.4 bits (246), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 101/412 (24%), Positives = 169/412 (41%), Gaps = 59/412 (14%)

Query: 247 TIKVGFAFAPQLAKKVNLPYEKICRALHNDFLVEEKMDGERIQVHYMNYGKSVRFYSRRG 306
           +++      P LAK      E   R     F  E K DGER QVH +  G ++R YSR G
Sbjct: 356 SLRPAIPLKPMLAKPTKSISEIFDRFQDQKFTCEYKYDGERAQVHLLEDG-TMRIYSRNG 414

Query: 307 IDYTYLYGASLSSGTISHHLDFTDNV---RECVLDGEMVTFDARRKVILPFGLVKGSAKD 363
            + T  Y          H  DF  ++   +  +LD E V +D  +  ILPF ++    + 
Sbjct: 415 ENMTERYPEI-------HIRDFVTDLSHTKSLILDCEAVAWDKEQNKILPFQVLSTRKRK 467

Query: 364 ALSFNSINNVDFHPLYVVFDLLYLNGTSLTPLPLHQRKEYLESILTPVKNVVEMVRTSRC 423
            +    IN +        FD+L  N   L    L +R++ L SI   V    +       
Sbjct: 468 DVD---INEIKVRVCLFAFDILLHNDEKLINKSLQERRDILHSITKEVTGEFQFATEMTT 524

Query: 424 YNVESIKKSLEVAISLGSEGVVLKYYN---SSYNVASRNNNWIKVKPEYLEEFGENLDLV 480
            N+E ++  L+ ++    EG+++K      S Y  + R+ NW+K+K +YL   G++LDL 
Sbjct: 525 TNLEELQSFLDQSVKNSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLAGVGDSLDLC 584

Query: 481 IIGR--DPGKKDSFMLGLLLLNEKEMDKRDQEVSSGIANNSKNENILYSQKKVKKILSFC 538
           ++G     GK+     G LL               G  N    E             + C
Sbjct: 585 VLGAYFGRGKRTGNYGGFLL---------------GCYNQDTGE-----------FETAC 618

Query: 539 SVANGISQEEFKEIDRKTRGCWKKTSEVAPPASIFEFG-SKIPAEWIEPNESIVLEIKSR 597
            +  G S E  +++  +      K++ +  P + + F  S  P  W EP  +++ E+ + 
Sbjct: 619 KIGTGFSDEVLQQLHERL-----KSTVIDLPKATYVFDPSAEPDVWFEP--TLLFEVLTA 671

Query: 598 SLDNT---ETNMQKYATSCTLYGGYCKRIRFDK---DWTDCFTLNELYDSRS 643
            L  +   +     Y    +L      R+R DK   D T    + E+Y++++
Sbjct: 672 DLSLSPVYKAGSSTYDKGVSLRFPRFLRLREDKGVEDATSSEQIVEMYENQA 723

>ZYRO0F11572g Chr6 (949236..951431) [2196 bp, 731 aa] {ON} similar
           to uniprot|P04819 Saccharomyces cerevisiae YDL164C CDC9
           DNA ligase found in the nucleus and mitochondria an
           essential enzyme that joins Okazaki fragments during DNA
           replication also acts in nucleotide excision repair base
           excision repair and recombination
          Length = 731

 Score = 97.8 bits (242), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 101/404 (25%), Positives = 165/404 (40%), Gaps = 61/404 (15%)

Query: 251 GFAFAPQLAKKVNLPYEKICRALHNDFLVEEKMDGERIQVHYMNYGKSVRFYSRRGIDYT 310
           G    P LAK      E + R     F+ E K DGER Q+H +  G ++R YSR G + T
Sbjct: 366 GIPLKPMLAKPTKAITEVLDRFQGQLFVSEYKYDGERAQLHLLPDG-TMRIYSRNGENMT 424

Query: 311 YLYGASLSSGTISHHLDFTD-----NVRECVLDGEMVTFDARRKVILPFGLVKGSAKDAL 365
             Y            +D  D     +    +LD E V +D  +  ILPF ++    +  +
Sbjct: 425 ERY----------PEIDIRDFLSDPSTESLILDCEAVAWDKEQGKILPFQVLSTRKRKDV 474

Query: 366 SFNSINNVDFHPLYVVFDLLYLNGTSLTPLPLHQRKEYLESILTPVKNVVEMVRTSRCYN 425
                 +V        FDLL  NG  L    L +R++ L+ +  PV             N
Sbjct: 475 D---AKDVKVRVCLFAFDLLCHNGEPLINKSLRERQDDLQKVTKPVDGEFRYANKLITAN 531

Query: 426 VESIKKSLEVAISLGSEGVVLKYYN---SSYNVASRNNNWIKVKPEYLEEFGENLDLVII 482
           +E ++  L+ ++    EG+++K  +   S Y  + R+ NW+K+K +YL   G++LDL ++
Sbjct: 532 IEELQHFLDQSVKDSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLNGVGDSLDLCVL 591

Query: 483 GR--DPGKKDSFMLGLLLLNEKEMDKRDQEVSSGIANNSKNENILYSQKKVKKILSFCSV 540
           G     GK+     G LL               G  N    E             + C +
Sbjct: 592 GAYYGRGKRTGTYGGFLL---------------GCYNQDTGE-----------YETCCKI 625

Query: 541 ANGISQEEFKEI-DRKTRGCWKKTSEVAPPASIFEFGSKIPAEWIEPNESIVLEIKSRSL 599
             G S+E  +++ DR      K T+  AP A      ++ P  W EP  +++ E+ +  L
Sbjct: 626 GTGFSEELLQQLYDR-----LKPTAMEAPAAFYVYDSAQQPDVWFEP--TLLFEVLAADL 678

Query: 600 DNT---ETNMQKYATSCTLYGGYCKRIRFDKDWTDCFTLNELYD 640
             +   +    +Y    +L      RIR DK   +  +  ++ D
Sbjct: 679 SLSPVYKAGSAQYDKGISLRFPRFLRIRDDKSVEEATSSEQVVD 722

>NCAS0A14110 Chr1 (2774465..2776726) [2262 bp, 753 aa] {ON}
           Anc_7.343 YDL164C
          Length = 753

 Score = 97.8 bits (242), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 79/283 (27%), Positives = 128/283 (45%), Gaps = 18/283 (6%)

Query: 247 TIKVGFAFAPQLAKKVNLPYEKICRALHNDFLVEEKMDGERIQVHYMNYGKSVRFYSRRG 306
           +++ G    P LAK      E + R     F  E K DGER QVH ++ G ++R YSR G
Sbjct: 383 SLRPGIPLKPMLAKPTKAINEILDRFQGEIFTSEYKYDGERAQVHLLSDG-TMRIYSRNG 441

Query: 307 IDYTYLYGASLSSGTISHHLDFTDN---VRECVLDGEMVTFDARRKVILPFGLVKGSAKD 363
            + T  Y          H  DF  +       +LD E V +D  +  ILPF ++    + 
Sbjct: 442 ENMTERYPEI-------HIRDFIADPLVTSTLILDCEAVAWDNEQNKILPFQVLSTRKRK 494

Query: 364 ALSFNSINNVDFHPLYVVFDLLYLNGTSLTPLPLHQRKEYLESILTPVKNVVEMVRTSRC 423
            +    + +V        FD+L  N   L    L +R++ L+ +   V    +       
Sbjct: 495 DVD---LKDVKVKVCLFAFDILCHNDEKLINKSLRERRQILQEVTKSVTGEFQYATEMTS 551

Query: 424 YNVESIKKSLEVAISLGSEGVVLKYYN---SSYNVASRNNNWIKVKPEYLEEFGENLDLV 480
            N++ ++K L+ ++    EG+++K  +   S Y  + R+ NW+K+K +YLE  G++LDL 
Sbjct: 552 SNLDELQKFLDQSVHDSCEGLMVKMLDGIESHYEPSKRSRNWLKLKKDYLEGIGDSLDLC 611

Query: 481 IIGRDPGK-KDSFMLGLLLLNEKEMDKRDQEVSSGIANNSKNE 522
           +IG   G+ K + M G  LL     D  + E    I     +E
Sbjct: 612 VIGAYYGRGKRTGMYGGFLLGCYNQDTGEFETCCKIGTGFSDE 654

>CAGL0E05588g Chr5 (551061..553724) [2664 bp, 887 aa] {ON} similar
           to uniprot|P12689 Saccharomyces cerevisiae YOR346w REV1
           DNA repair protein
          Length = 887

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 44/90 (48%), Gaps = 11/90 (12%)

Query: 685 IFAGLYFYVLSDYVTNASEVRITRGELENAIVRHGGRLIYNIILKRHYIGDVRLISCKNT 744
           IF GL  Y+ + + T        R EL   IV HGG+ ++++  KR     V  I   N 
Sbjct: 84  IFQGLVLYI-NGFTTPG------RFELHQMIVVHGGKFLHHMSAKR----SVTHIIASNL 132

Query: 745 TECRALINRGYDILHPSWVIDCVAYKKLIP 774
              + +    Y ++ P+W++D +  KKL+P
Sbjct: 133 PLKKRIEFANYKVVKPNWIVDSIQQKKLLP 162

>NDAI0E03930 Chr5 (868403..871489) [3087 bp, 1028 aa] {ON} Anc_7.46
           YOR346W
          Length = 1028

 Score = 40.0 bits (92), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 35/67 (52%), Gaps = 4/67 (5%)

Query: 708 RGELENAIVRHGGRLIYNIILKRHYIGDVRLISCKNTTECRALINRGYDILHPSWVIDCV 767
           R +L  +IV HGG+ I+++  K+     +  I   N T  + L    Y ++ P W++  +
Sbjct: 195 RLQLHESIVLHGGKFIHHLSAKKK----ITHIIASNLTLKKKLEFEKYKVVKPDWIVKSI 250

Query: 768 AYKKLIP 774
             KKL+P
Sbjct: 251 ESKKLLP 257

>KNAG0E00410 Chr5 complement(65732..68185) [2454 bp, 817 aa] {ON}
           Anc_7.46 YOR346W
          Length = 817

 Score = 39.7 bits (91), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 38/137 (27%), Positives = 55/137 (40%), Gaps = 17/137 (12%)

Query: 685 IFAGLYFYVLSDYVTNASEVRITRGELENAIVRHGGRLIYNIILKRHYIGDVRLISCKNT 744
           IFAGL  YV      N       R +L   IV+HGG   + +  KR     V  I   N 
Sbjct: 41  IFAGLVVYV------NGYTRPWDRLKLHAEIVKHGGEFCHYMSGKRQ----VTHIIASNL 90

Query: 745 TECRALINRGYDILHPSWVIDCVAYKKLIPIEPCYCFNVSQKMRAV------AEKRVDCL 798
           T  + +  R Y ++   WV+D +   +L+P +           + +      A    DC 
Sbjct: 91  TLKKFVEFRNYKVVSAQWVVDSIQRGRLLPWQDYRVEGQGDDQQKLDLKALRATSTTDCN 150

Query: 799 GDSF-ENDISETKLSLL 814
           G  F  N  S ++L LL
Sbjct: 151 GPDFITNYFSNSRLHLL 167

>Suva_8.400 Chr8 (717697..720654) [2958 bp, 985 aa] {ON} YOR346W
           (REAL)
          Length = 985

 Score = 38.9 bits (89), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 35/67 (52%), Gaps = 4/67 (5%)

Query: 708 RGELENAIVRHGGRLIYNIILKRHYIGDVRLISCKNTTECRALINRGYDILHPSWVIDCV 767
           R +L   IV HGG+ ++++  K+     V  I   N    + +    Y +++P W+ DC+
Sbjct: 182 RLQLHEMIVLHGGKFLHHLSAKKR----VTHIVASNLPLKKRIEFANYKVVNPDWITDCI 237

Query: 768 AYKKLIP 774
             ++L+P
Sbjct: 238 KERRLLP 244

>KAFR0C05190 Chr3 (1031636..1034326) [2691 bp, 896 aa] {ON} Anc_7.46
           YOR346W
          Length = 896

 Score = 38.1 bits (87), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 43/93 (46%), Gaps = 11/93 (11%)

Query: 682 TSIIFAGLYFYVLSDYVTNASEVRITRGELENAIVRHGGRLIYNIILKRHYIGDVRLISC 741
           TS +F  L  Y+           R +R +L   IV +GG+ ++++  KR     V  I  
Sbjct: 106 TSNLFKDLTVYI-------NGYTRPSRFQLHEMIVLNGGKFLHHLSAKRS----VTHIIA 154

Query: 742 KNTTECRALINRGYDILHPSWVIDCVAYKKLIP 774
              T  + +    Y ++ P W++D +  KKL+P
Sbjct: 155 STLTLKKKIEFANYKVVKPEWLVDSIKVKKLLP 187

>Ecym_2188 Chr2 (371869..373254) [1386 bp, 461 aa] {ON} similar to
           Ashbya gossypii AFL107W
          Length = 461

 Score = 37.7 bits (86), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 50/105 (47%), Gaps = 16/105 (15%)

Query: 379 YVVFDLLYLNGTSLTPLPLHQRKEYL-ESILTPVKNV--------------VEMVRTSRC 423
           Y++FD L +NG SL   P   R  +L +    P  ++              + M   +  
Sbjct: 144 YLMFDCLAINGRSLVQSPTSSRLAHLGKEFFKPYYDLRSVYPDHCSNFPFKLSMKHMNFS 203

Query: 424 YNVESIKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPE 468
           Y++  I  +L+  +   S+G++    N+SYNV  +++N +K KP+
Sbjct: 204 YDLVKIASTLD-KLPHVSDGLIFTPVNTSYNVGGKDSNLLKWKPQ 247

>Ecym_6341 Chr6 (656835..659138) [2304 bp, 767 aa] {ON} similar to
           Ashbya gossypii AFR095C
          Length = 767

 Score = 37.4 bits (85), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 23/94 (24%), Positives = 40/94 (42%), Gaps = 16/94 (17%)

Query: 691 FYVLSDYVTNASEVRITRGELENAI-VRHGGRLIYNIILKRHYIGDVR-------LISCK 742
           FY+   ++   S   ++ GEL+    + H  R + N     H+I D+        +  C 
Sbjct: 112 FYM---FIGRISAPEVSTGELQQLCEIGHSYRCLTN-----HFIKDIECSAQSVFITDCA 163

Query: 743 NTTECRALINRGYDILHPSWVIDCVAYKKLIPIE 776
                +A    G  I+HP WV+DC     ++ +E
Sbjct: 164 TGARAKAAREEGVPIVHPKWVMDCTKRGAVLEME 197

>NCAS0E02370 Chr5 (464339..467032) [2694 bp, 897 aa] {ON} Anc_7.46
           YOR346W
          Length = 897

 Score = 36.6 bits (83), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 34/67 (50%), Gaps = 4/67 (5%)

Query: 708 RGELENAIVRHGGRLIYNIILKRHYIGDVRLISCKNTTECRALINRGYDILHPSWVIDCV 767
           R +L   IV HGG+ ++++  K+     V  I   N    + L  + Y ++ P W++  +
Sbjct: 148 RLQLHEMIVLHGGKFLHHLSAKKK----VTHIIASNLPLKKRLEFQNYKVVKPDWIVQSI 203

Query: 768 AYKKLIP 774
           A  KL+P
Sbjct: 204 AQGKLLP 210

>KLLA0F23375g Chr6 (2181986..2184475) [2490 bp, 829 aa] {ON} similar
           to uniprot|P12689 Saccharomyces cerevisiae YOR346W REV1
           Deoxycytidyl transferase forms a complex with the
           subunits of DNA polymerase zeta Rev3p and Rev7p involved
           in repair of abasic sites in damaged DNA
          Length = 829

 Score = 36.6 bits (83), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 33/136 (24%), Positives = 54/136 (39%), Gaps = 21/136 (15%)

Query: 675 QKTEQIPTSIIFAGLYFYVLSDYVTNASEVRITRGELENAIVRHGGRLIYNIILKRHYIG 734
           QK  ++    +F G   YV             TR +L   I+ HGG         +HY+ 
Sbjct: 55  QKEHRVSNPTLFQGCTIYV-------NGRTNPTRFQLHKLIILHGGTF-------KHYLS 100

Query: 735 DVRLISCKNTTECRALINRGY---DILHPSWVIDCVAYKKLIPIEPCYCFNVSQ---KMR 788
               ++    TE  A     +    ++ P WV + +A  KL+P +      VS+   K+ 
Sbjct: 101 GKTAVTHILATELNASKKSSFANFKVVSPEWVTESIARGKLLPWQDFRIVQVSRLQGKIT 160

Query: 789 AVAEKRVDCLGDSFEN 804
             A  R +C+  +F N
Sbjct: 161 DFATVR-NCMDPNFIN 175

>Ecym_5052 Chr5 (112351..114972) [2622 bp, 873 aa] {ON} similar to
           Ashbya gossypii ADR369C
          Length = 873

 Score = 36.2 bits (82), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 32/66 (48%), Gaps = 4/66 (6%)

Query: 708 RGELENAIVRHGGRLIYNIILKRHYIGDVRLISCKNTTECRALINRGYDILHPSWVIDCV 767
           R +L   IV HGG+ +  +  K     DV  I  +N +  + +  R + ++ P W+  CV
Sbjct: 106 REQLRKEIVLHGGQFVQYLTKK----SDVTHIVAQNLSAAKCIEFRNFKVVQPGWIGACV 161

Query: 768 AYKKLI 773
              K++
Sbjct: 162 RIGKML 167

>ZYRO0E07150g Chr5 complement(540507..541856) [1350 bp, 449 aa] {ON}
           highly similar to uniprot|Q01159 Saccharomyces
           cerevisiae YGL130W CEG1 mRNA guanylyltransferase (mRNA
           capping enzyme), alpha subunit
          Length = 449

 Score = 35.8 bits (81), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 47/107 (43%), Gaps = 20/107 (18%)

Query: 379 YVVFDLLYLNGTSLTPLPLHQRKEYL-----------------ESILTPVKNVVEMVRTS 421
           Y++FD L +NG  LTP P   R  +L                 + +  P K  + M   S
Sbjct: 144 YLMFDCLAINGRCLTPSPTSSRLAHLGKEFFKPYFDLRLVYPDQCVTFPFK--ISMKHMS 201

Query: 422 RCYNVESIKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPE 468
             Y++  +  SLE    + S+G++     + Y V  +++  +K KPE
Sbjct: 202 FSYDLLKVANSLEKLPHM-SDGLIFTPVKTPYFVGGKDSLLLKWKPE 247

>TPHA0D03020 Chr4 (629502..631268) [1767 bp, 588 aa] {ON} Anc_3.447
           YGR103W
          Length = 588

 Score = 35.4 bits (80), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 29/117 (24%), Positives = 47/117 (40%), Gaps = 17/117 (14%)

Query: 661 RKKRREVLTSNTFDQKTEQIPTSIIFAGLYFYVLSDYVTNASEVRITRGELENAIVRHGG 720
           + K  E+   + FD      P + +F+   FYV         EV I   E    I+  GG
Sbjct: 329 KNKGDELAQPSQFDS-----PIATLFSDFVFYV-------GREVPIDIVEF--LILSSGG 374

Query: 721 RLIYNIILKRHYIGDVRLISCKNTTECRALINR---GYDILHPSWVIDCVAYKKLIP 774
            +I    L +    D+   +  +    R ++N    G   + P W+ DC+  K L+P
Sbjct: 375 SVISEAALDQVDAKDLDFSNVTHQIVDRPVLNNKVPGRTYVQPQWIFDCINKKSLVP 431

>AFR095C Chr6 complement(604687..606699) [2013 bp, 670 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL090C
           (DPB11)
          Length = 670

 Score = 34.7 bits (78), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 24/94 (25%), Positives = 35/94 (37%), Gaps = 8/94 (8%)

Query: 686 FAGLYFYVLSDYVTNASEVRITRGELENAIVRHGGRLIYNIILKRHYIGDVR---LISCK 742
           F G  FYV    V      R++  EL+      G R +      R      R   +  C 
Sbjct: 111 FGG--FYVFIGRVAGG---RVSAAELQQLCESGGARRVVTSHFVRDTASSARSVFVTDCA 165

Query: 743 NTTECRALINRGYDILHPSWVIDCVAYKKLIPIE 776
                 A   +G  ++HP WV DCV    ++ +E
Sbjct: 166 EGARAAAAREQGVAVVHPKWVTDCVRRGAVVEME 199

>YOR346W Chr15 (981828..984785) [2958 bp, 985 aa] {ON}
           REV1Deoxycytidyl transferase; involved in repair of
           abasic sites and adducted guanines in damaged DNA by
           translesion synthesis (TLS); forms a complex with the
           subunits of DNA polymerase zeta, Rev3p and Rev7p;
          Length = 985

 Score = 34.7 bits (78), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 33/149 (22%), Positives = 66/149 (44%), Gaps = 19/149 (12%)

Query: 649 SYQAEKSHLKLVRKKRREVLTSNTFDQKTEQIPTSIIFAGLYFYVLSDYVTNASEVRITR 708
           +Y  EK+H + ++    ++L     DQ + Q  +S IF     Y+           +  R
Sbjct: 134 AYFHEKAHGQTLQD---QILKDQYKDQISSQ--SSKIFKNCVIYI-------NGYTKPGR 181

Query: 709 GELENAIVRHGGRLIYNIILKRHYIGDVRLISCKNTTECRALINRGYDILHPSWVIDCVA 768
            +L   IV HGG+ ++ +  K+     V  I   N    + +    Y ++ P W++D V 
Sbjct: 182 LQLHEMIVLHGGKFLHYLSSKK----TVTHIVASNLPLKKRIEFANYKVVSPDWIVDSVK 237

Query: 769 YKKLIPIEPCYCFNVSQKMRAVAEKRVDC 797
             +L+P +    ++++ K+    +K  +C
Sbjct: 238 EARLLPWQN---YSLTSKLDEQQKKLDNC 263

>AEL073C Chr5 complement(489107..491263) [2157 bp, 718 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR042W
           (NUP85)
          Length = 718

 Score = 34.7 bits (78), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 33/111 (29%), Positives = 50/111 (45%), Gaps = 9/111 (8%)

Query: 617 GGYCKRIRFDKDWTDCFTLNELYDSRSARFNPSYQAEKSHLKLVRKKRREVLTSNTFDQK 676
           G   K I + K W +C+    LY      + PS Q  + +L+LV K+    +TS  ++Q 
Sbjct: 324 GNKSKIIYYSKTWYECYCGLMLY------YIPSLQLSEEYLQLVLKEHPLDVTS-PWEQA 376

Query: 677 TEQIPTSIIFAGLYFYVLSDYVTNASEVRI--TRGELENAIVRHGGRLIYN 725
              I T  I++ L      D  T A    I   +G LEN ++  GG  + N
Sbjct: 377 CVSIITGKIYSILPVLDSLDSCTAAFTAAICEAKGLLENDLLDDGGLEVSN 427

>TDEL0E05370 Chr5 complement(982429..983802) [1374 bp, 457 aa] {ON}
           Anc_6.228 YGL130W
          Length = 457

 Score = 33.5 bits (75), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 26/107 (24%), Positives = 48/107 (44%), Gaps = 20/107 (18%)

Query: 379 YVVFDLLYLNGTSLTPLPLHQRKEYL-----------------ESILTPVKNVVEMVRTS 421
           Y++FD L +NG  +TP P   R  +L                 + +  P K  + M   +
Sbjct: 144 YLMFDCLAINGRCITPSPTSSRLAHLGKEFFKPYYDLRSLFAEQCVTFPFK--LSMKHMN 201

Query: 422 RCYNVESIKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPE 468
             Y++  +  SL  ++   S+G++       Y+V S+++  +K KPE
Sbjct: 202 FSYDLLKVANSLS-SLPHESDGLIFTPVKLPYSVGSKDSYLLKWKPE 247

>ADR369C Chr4 complement(1362309..1364792) [2484 bp, 827 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR346W
           (REV1)
          Length = 827

 Score = 33.9 bits (76), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 33/73 (45%), Gaps = 10/73 (13%)

Query: 708 RGELENAIVRHGGRLIYNIILKRHYIG---DVRLISCKNTTECRALINRGYDILHPSWVI 764
           R EL   IV HGG  +       HY+    DV  I  ++    +  +     ++ P+WV 
Sbjct: 59  REELRREIVMHGGTFV-------HYLARPSDVTHIVAEHVPVAKRRLWHACKVVRPAWVS 111

Query: 765 DCVAYKKLIPIEP 777
            C+   +L+P +P
Sbjct: 112 ACLCSGELVPWKP 124

>TPHA0E02770 Chr5 (580118..581470) [1353 bp, 450 aa] {ON} Anc_6.228
           YGL130W
          Length = 450

 Score = 33.5 bits (75), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 54/107 (50%), Gaps = 20/107 (18%)

Query: 379 YVVFDLLYLNGTSLTPLPLHQR-----KEY------LESILT------PVKNVVEMVRTS 421
           Y++FD L +NG +LT  P   R     KE+      + SI        P K  + M + +
Sbjct: 143 YLMFDCLTMNGRNLTHSPTSSRLAHLGKEFYKPYFDMRSIFPDRCINFPFK--ISMKQMN 200

Query: 422 RCYNVESIKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPE 468
             Y++ ++ K+L+    L S+G++    N+ Y V ++++  +K KPE
Sbjct: 201 FSYDLVNVYKTLDKLPHL-SDGLIFTPVNTPYVVGAKDSYLLKWKPE 246

>KLLA0B02200g Chr2 (196341..197741) [1401 bp, 466 aa] {ON} highly
           similar to uniprot|Q01159 Saccharomyces cerevisiae
           YGL130W CEG1 mRNA guanylyltransferase (mRNA capping
           enzyme), alpha subunit
          Length = 466

 Score = 33.5 bits (75), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 23/105 (21%), Positives = 50/105 (47%), Gaps = 16/105 (15%)

Query: 379 YVVFDLLYLNGTSLTPLPLHQRKEYL-ESILTPVKNV--------------VEMVRTSRC 423
           Y++FD L +NG SL   P   R  +L +    P  ++              + M   +  
Sbjct: 145 YLMFDCLAVNGRSLVQSPTSSRLAHLGKEFFKPYYDLRSYFPDRCSTFPFKISMKHMNFS 204

Query: 424 YNVESIKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPE 468
           Y++  + K+L+ ++   S+G++     ++Y++  +++  +K KPE
Sbjct: 205 YDLAKVAKTLD-SLPHVSDGLIFTPVQAAYHIGGKDSYLLKWKPE 248

>SAKL0B06600g Chr2 (569406..572360) [2955 bp, 984 aa] {ON} highly
           similar to uniprot|P09440 Saccharomyces cerevisiae
           YBR084W MIS1 Mitochondrial C1-tetrahydrofolate synthase
           involved in interconversion between different oxidation
           states of tetrahydrofolate (THF) provides activities of
           formyl-THF synthetase methenyl-THF cyclohydrolase and
           methylene-THF dehydrogenase
          Length = 984

 Score = 33.5 bits (75), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 43/87 (49%), Gaps = 11/87 (12%)

Query: 512 SSGIANNSKNENILYSQKKVKKILSFCSVANGISQEEFKEIDRKTRGCWKKTSEVAPPAS 571
           SS IA  + ++N+ +S+ ++   LS   VA  I  E F+EI+         T E  P   
Sbjct: 27  SSTIAYRNGSQNVSFSKSELYHTLSGNKVAKTIRDEAFREIEH----IKIATPEFKPTLK 82

Query: 572 IFEFGSKIPAEWIEPNESIVLEIKSRS 598
           IF+ GS+       P+ S+ + +K ++
Sbjct: 83  IFQIGSR-------PDSSVYVRMKLKA 102

>ZYRO0G15180g Chr7 (1223984..1226050) [2067 bp, 688 aa] {ON} similar
           to uniprot|P47027 Saccharomyces cerevisiae YJL090C DPB11
           Essential BRCT repeat protein required on the
           prereplicative complex at replication origins for
           loading DNA polymerases to initiate DNA synthesis also
           required for S/M checkpoint control
          Length = 688

 Score = 32.7 bits (73), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 26/63 (41%), Gaps = 4/63 (6%)

Query: 748 RALINRGYDILHPSWVIDCVAYKKLIPIEPCYCFNV---SQKMRAVAEKRVDCLGDSFEN 804
           +A +  G  I+HP WV+DC     L+  +P Y          +  +     DC  DS   
Sbjct: 166 KAAMELGIPIIHPKWVLDCHKRNALLEFDPYYLLETIEPGTTLDQIGINSCDCW-DSLAE 224

Query: 805 DIS 807
            IS
Sbjct: 225 PIS 227

>KLTH0E15356g Chr5 (1358408..1361356) [2949 bp, 982 aa] {ON} some
           similarities with uniprot|P42946 Saccharomyces
           cerevisiae YJL108C PRM10 Pheromone-regulated protein
           predicted to have 5 transmembrane segments
          Length = 982

 Score = 32.7 bits (73), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 29/119 (24%), Positives = 54/119 (45%), Gaps = 13/119 (10%)

Query: 440 GSEGVVLKYYNSSYNVASRNNNWIKVKPEYLEEFGENLDLV-----IIGRDPGKKDSFML 494
           G  G +LK Y +  ++ASR+   +   PE  + +GE+  L      +   +PGKK     
Sbjct: 424 GVLGSLLKMYQNEDDLASRSQVSLDTTPEAWDYYGEDAPLSGTMSGVTATEPGKKSK--- 480

Query: 495 GLLLLNEKEMDKRDQEV--SSGIANNSKNENILYSQKKVKKILSFCSVANGISQEEFKE 551
               ++   + K+ Q +  S  + N  K  N   ++ K+K + S    AN + +++  E
Sbjct: 481 ---KISFGGLGKKTQSMLSSEHLPNGGKLPNFKATRPKMKNVKSVAKHANKLRRKQAAE 536

>NDAI0F03690 Chr6 complement(877227..879962) [2736 bp, 911 aa] {ON}
           Anc_2.29 YNL216W
          Length = 911

 Score = 32.3 bits (72), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 35/164 (21%), Positives = 67/164 (40%), Gaps = 27/164 (16%)

Query: 670 SNTFDQKTEQIPTSIIFAGLYFYVLSDYVTNASEVRITRGELENAIVRHGGRLIYNIILK 729
           SNT D     +   ++F  + F++  D  + A +      +LE  I  +GG ++    L 
Sbjct: 153 SNTSDNGANPVKKKLVFENIKFFINRD--SGAIDSSTEADQLERLITANGGEIVK--ALP 208

Query: 730 RHYIGDVRLISCKNTTECRALINRGYDILHPSWVIDCVAYKKLIPIEPCYCFNVSQKMRA 789
           +    D  ++S  N T+   +          +++  C+A   L+P+E  Y     +  RA
Sbjct: 209 QQASSDFFVVSPYNDTKLPTITT--------TYIRTCIARDTLLPLE-NYLVPYDE-FRA 258

Query: 790 VAEKRVDCL---------GDSFENDISETKLSL----LYKSQHN 820
           V +  +  L          D  +N +SE + ++    L   QH+
Sbjct: 259 VIDSELRSLNGDGEKADQNDHIQNHVSEEQQAVEQNGLEPDQHD 302

>TBLA0A02070 Chr1 complement(499281..500642) [1362 bp, 453 aa] {ON}
           Anc_6.228 YGL130W
          Length = 453

 Score = 32.3 bits (72), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 24/105 (22%), Positives = 48/105 (45%), Gaps = 16/105 (15%)

Query: 379 YVVFDLLYLNGTSLTPLPLHQRKEYL-ESILTPVKNV--------------VEMVRTSRC 423
           Y++FD L +NG  L P P   R  +L +    P  ++              + M   +  
Sbjct: 144 YLMFDCLAINGRCLVPSPTSSRLAHLGKEFFKPYYDLRTYYPDHCGTFPFKLSMKHMNFS 203

Query: 424 YNVESIKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPE 468
           Y++  ++ +L+  +   S+G++     +SY V  +++  +K KPE
Sbjct: 204 YDLVKVENTLD-KLPHKSDGLIFTPVKTSYYVGGKDSYLLKWKPE 247

>CAGL0K05137g Chr11 (500434..504072) [3639 bp, 1212 aa] {ON} similar
           to uniprot|P48016 Saccharomyces cerevisiae YPR026w
           Vacuolar acid trehalase precursor
          Length = 1212

 Score = 32.3 bits (72), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 36/86 (41%), Gaps = 2/86 (2%)

Query: 522 ENILYSQKKVKKILSFCSVANGISQEEFKEIDRKTRGCWKKTSEVAPPASIFEFGSKIPA 581
           EN+ YS   V    +     N  S   F   DR  R      +E  P   I+++ S + +
Sbjct: 388 ENVPYSNAVVYSTCTIKGTENNFSPYNFTSDDRIARNYMTNLTEENPKVVIYKYTSVVSS 447

Query: 582 EW--IEPNESIVLEIKSRSLDNTETN 605
           E+   EPN ++ L+  S   +  + N
Sbjct: 448 EYNNDEPNPNVNLKFASNIANTAKGN 473

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.137    0.406 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 105,524,337
Number of extensions: 4851186
Number of successful extensions: 14723
Number of sequences better than 10.0: 81
Number of HSP's gapped: 14978
Number of HSP's successfully gapped: 81
Length of query: 945
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 826
Effective length of database: 39,836,145
Effective search space: 32904655770
Effective search space used: 32904655770
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 71 (32.0 bits)