Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_15.1736.15ON25125113390.0
YOR004W (UTP23)6.15ON25425310721e-149
Skud_15.1656.15ON25725010491e-145
Suva_15.1796.15ON25921910451e-145
NDAI0I022506.15ON2712267981e-107
KAFR0A050606.15ON2692337891e-105
NCAS0D026606.15ON2612337701e-103
KLLA0D01023g6.15ON2682207581e-101
Kpol_1045.746.15ON2572157571e-101
KNAG0F028806.15ON2692197561e-101
TDEL0G045406.15ON2452427461e-99
CAGL0E02673g6.15ON2632537481e-99
SAKL0E01056g6.15ON2692477385e-98
ACR011C6.15ON2532337358e-98
KLTH0C11352g6.15ON2682237351e-97
ZYRO0C07920g6.15ON2932177329e-97
TPHA0J002806.15ON2712547248e-96
Kwal_56.223996.15ON2742777126e-94
Ecym_30196.15ON2662156855e-90
TBLA0A072906.15ON2592625987e-77
KLTH0E02860g5.392ON1891451495e-11
Kpol_1055.185.392ON1891451451e-10
CAGL0M01056g5.392ON1891451442e-10
KLLA0A07018g5.392ON1891451423e-10
KAFR0D042805.392ON1891451424e-10
Kwal_55.200895.392ON1891451424e-10
NDAI0C045505.392ON1891451415e-10
KNAG0C052705.392ON1891451416e-10
TDEL0E023305.392ON1891481406e-10
AEL102W5.392ON1891451408e-10
TBLA0H017505.392ON1891451399e-10
TPHA0D023105.392ON1891451381e-09
Ecym_74695.392ON1891451372e-09
NCAS0F030905.392ON1891451362e-09
ZYRO0A06754g5.392ON1891481363e-09
Skud_4.6065.392ON1891451328e-09
Smik_4.5995.392ON1891451329e-09
Suva_2.5095.392ON1891451329e-09
YDR339C (FCF1)5.392ON1891451329e-09
SAKL0G07766g5.392ON1891451302e-08
Smik_16.2747.436ON1124114711.7
Kwal_23.45842.50ON42351702.0
SAKL0A06688g6.133ON55266692.7
TPHA0F024306.31ON79856692.9
TPHA0A052105.84ON63280674.3
Skud_4.538.454ON39479665.9
ZYRO0A07480g2.349ON160273666.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_15.173
         (251 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_15.173 Chr15 (300941..301696) [756 bp, 251 aa] {ON} YOR004W...   520   0.0  
YOR004W Chr15 (333592..334356) [765 bp, 254 aa] {ON}  UTP23Compo...   417   e-149
Skud_15.165 Chr15 (293629..294402) [774 bp, 257 aa] {ON} YOR004W...   408   e-145
Suva_15.179 Chr15 (308047..308826) [780 bp, 259 aa] {ON} YOR004W...   407   e-145
NDAI0I02250 Chr9 (513792..514607) [816 bp, 271 aa] {ON} Anc_6.15...   311   e-107
KAFR0A05060 Chr1 complement(1006556..1007365) [810 bp, 269 aa] {...   308   e-105
NCAS0D02660 Chr4 complement(511544..512329) [786 bp, 261 aa] {ON...   301   e-103
KLLA0D01023g Chr4 (89887..90693) [807 bp, 268 aa] {ON} similar t...   296   e-101
Kpol_1045.74 s1045 complement(173724..174497) [774 bp, 257 aa] {...   296   e-101
KNAG0F02880 Chr6 complement(546147..546956) [810 bp, 269 aa] {ON...   295   e-101
TDEL0G04540 Chr7 complement(828055..828792) [738 bp, 245 aa] {ON...   291   1e-99
CAGL0E02673g Chr5 (253705..254496) [792 bp, 263 aa] {ON} similar...   292   1e-99
SAKL0E01056g Chr5 (79518..80327) [810 bp, 269 aa] {ON} similar t...   288   5e-98
ACR011C Chr3 complement(377334..378095) [762 bp, 253 aa] {ON} Sy...   287   8e-98
KLTH0C11352g Chr3 complement(934886..935692) [807 bp, 268 aa] {O...   287   1e-97
ZYRO0C07920g Chr3 complement(603790..604671) [882 bp, 293 aa] {O...   286   9e-97
TPHA0J00280 Chr10 (63865..64680) [816 bp, 271 aa] {ON} Anc_6.15 ...   283   8e-96
Kwal_56.22399 s56 (111021..111845) [825 bp, 274 aa] {ON} YOR004W...   278   6e-94
Ecym_3019 Chr3 (36286..37086) [801 bp, 266 aa] {ON} similar to A...   268   5e-90
TBLA0A07290 Chr1 (1814724..1815503) [780 bp, 259 aa] {ON} Anc_6....   234   7e-77
KLTH0E02860g Chr5 (258370..258939) [570 bp, 189 aa] {ON} highly ...    62   5e-11
Kpol_1055.18 s1055 complement(40805..41374) [570 bp, 189 aa] {ON...    60   1e-10
CAGL0M01056g Chr13 (117010..117579) [570 bp, 189 aa] {ON} highly...    60   2e-10
KLLA0A07018g Chr1 complement(632523..633092) [570 bp, 189 aa] {O...    59   3e-10
KAFR0D04280 Chr4 (842029..842598) [570 bp, 189 aa] {ON} Anc_5.39...    59   4e-10
Kwal_55.20089 s55 (245372..245941) [570 bp, 189 aa] {ON} YDR339C...    59   4e-10
NDAI0C04550 Chr3 complement(1031852..1032421) [570 bp, 189 aa] {...    59   5e-10
KNAG0C05270 Chr3 (1028377..1028946) [570 bp, 189 aa] {ON} Anc_5....    59   6e-10
TDEL0E02330 Chr5 (455296..455865) [570 bp, 189 aa] {ON} Anc_5.39...    59   6e-10
AEL102W Chr5 (436582..437151) [570 bp, 189 aa] {ON} Syntenic hom...    59   8e-10
TBLA0H01750 Chr8 (408338..408907) [570 bp, 189 aa] {ON} Anc_5.39...    58   9e-10
TPHA0D02310 Chr4 complement(478545..479114) [570 bp, 189 aa] {ON...    58   1e-09
Ecym_7469 Chr7 complement(956526..957095) [570 bp, 189 aa] {ON} ...    57   2e-09
NCAS0F03090 Chr6 complement(616705..617274) [570 bp, 189 aa] {ON...    57   2e-09
ZYRO0A06754g Chr1 (550964..551533) [570 bp, 189 aa] {ON} highly ...    57   3e-09
Skud_4.606 Chr4 complement(1085976..1086545) [570 bp, 189 aa] {O...    55   8e-09
Smik_4.599 Chr4 complement(1076379..1076948) [570 bp, 189 aa] {O...    55   9e-09
Suva_2.509 Chr2 complement(907366..907935) [570 bp, 189 aa] {ON}...    55   9e-09
YDR339C Chr4 complement(1149951..1150520) [570 bp, 189 aa] {ON} ...    55   9e-09
SAKL0G07766g Chr7 (652944..653513) [570 bp, 189 aa] {ON} highly ...    55   2e-08
Smik_16.274 Chr16 (504633..508007) [3375 bp, 1124 aa] {ON} YPR03...    32   1.7  
Kwal_23.4584 s23 complement(777438..778709) [1272 bp, 423 aa] {O...    32   2.0  
SAKL0A06688g Chr1 complement(592893..594236,594303..594617) [165...    31   2.7  
TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {O...    31   2.9  
TPHA0A05210 Chr1 complement(1173573..1175471) [1899 bp, 632 aa] ...    30   4.3  
Skud_4.53 Chr4 (91849..93033) [1185 bp, 394 aa] {ON} YDL204W (REAL)    30   5.9  
ZYRO0A07480g Chr1 (609274..614082) [4809 bp, 1602 aa] {ON} simil...    30   6.2  

>Smik_15.173 Chr15 (300941..301696) [756 bp, 251 aa] {ON} YOR004W
           (REAL)
          Length = 251

 Score =  520 bits (1339), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 251/251 (100%), Positives = 251/251 (100%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNGSNFNLPSGLKRTLQADVKVM 60
           MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNGSNFNLPSGLKRTLQADVKVM
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNGSNFNLPSGLKRTLQADVKVM 60

Query: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPADCIESVVDINGANKHRYVVA 120
           ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPADCIESVVDINGANKHRYVVA
Sbjct: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPADCIESVVDINGANKHRYVVA 120

Query: 121 SQDIGLRRKLRNVPGVPLIHLTRSVMVMEPLSTASAKASKMTEERKLYKGLNDPNVDKVQ 180
           SQDIGLRRKLRNVPGVPLIHLTRSVMVMEPLSTASAKASKMTEERKLYKGLNDPNVDKVQ
Sbjct: 121 SQDIGLRRKLRNVPGVPLIHLTRSVMVMEPLSTASAKASKMTEERKLYKGLNDPNVDKVQ 180

Query: 181 EISEGSGKESVTKKRKFGPKAPNPLSVKKKKKAYSTSDEARGKEDTSKEKKRRRRKHGSH 240
           EISEGSGKESVTKKRKFGPKAPNPLSVKKKKKAYSTSDEARGKEDTSKEKKRRRRKHGSH
Sbjct: 181 EISEGSGKESVTKKRKFGPKAPNPLSVKKKKKAYSTSDEARGKEDTSKEKKRRRRKHGSH 240

Query: 241 TNSITNRTTAA 251
           TNSITNRTTAA
Sbjct: 241 TNSITNRTTAA 251

>YOR004W Chr15 (333592..334356) [765 bp, 254 aa] {ON}
           UTP23Component of the small subunit processome, involved
           in 40S ribosomal subunit biogenesis; interacts with
           snR30 and is required for dissociation of snR30 from
           large pre-ribosomal particles; has homology to PINc
           domain protein Fcf1p, although the PINc domain of Utp23p
           is not required for function; essential protein
          Length = 254

 Score =  417 bits (1072), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 219/253 (86%), Positives = 237/253 (93%), Gaps = 2/253 (0%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNGSNFNLPSGLKRTLQADVKVM 60
           MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECN SNFNLPSGLKRTLQADVKVM
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNNSNFNLPSGLKRTLQADVKVM 60

Query: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPADCIESVVDINGANKHRYVVA 120
           ITQCCIQALYETRN+GAI+LAKQFERRRCNHSFKDPKSPA+CIESVV+I+GANKHRYVVA
Sbjct: 61  ITQCCIQALYETRNDGAINLAKQFERRRCNHSFKDPKSPAECIESVVNISGANKHRYVVA 120

Query: 121 SQDIGLRRKLRNVPGVPLIHLTRSVMVMEPLSTASAKASKMTEERKLYKGLNDPNVDKVQ 180
           SQDI LRRKLR VPGVPLIHLTRSVMVMEPLSTASAKASK+TEE+KLYKGLNDPN++K+Q
Sbjct: 121 SQDIDLRRKLRTVPGVPLIHLTRSVMVMEPLSTASAKASKITEEQKLYKGLNDPNIEKLQ 180

Query: 181 EISEGSGKESVTKKRKFGPKAPNPLSVKKKKKAYSTSDEARGKEDTS-KEKKRRRRKHGS 239
           E  +GSGKES+TKKRK GPKAPNPLSVKKKKK  S SDE + KEDTS ++KKRRRRKH S
Sbjct: 181 ESGDGSGKESITKKRKLGPKAPNPLSVKKKKKVNSPSDEVKDKEDTSKEKKKRRRRKHKS 240

Query: 240 HTN-SITNRTTAA 251
           +TN  ++N TTAA
Sbjct: 241 NTNVPVSNGTTAA 253

>Skud_15.165 Chr15 (293629..294402) [774 bp, 257 aa] {ON} YOR004W
           (REAL)
          Length = 257

 Score =  408 bits (1049), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 206/250 (82%), Positives = 222/250 (88%), Gaps = 1/250 (0%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNGSNFNLPSGLKRTLQADVKVM 60
           MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLV EC+GSNFNLPSGLKRTLQADVKVM
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVM 60

Query: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPADCIESVVDINGANKHRYVVA 120
           ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPA+CIESVVD+NGANKHRYVVA
Sbjct: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVDVNGANKHRYVVA 120

Query: 121 SQDIGLRRKLRNVPGVPLIHLTRSVMVMEPLSTASAKASKMTEERKLYKGLNDPNVDKVQ 180
           SQDI LRRKLR VPGVPLIHLTRSVM+MEPLSTASAK SK TEE+KL+KGLNDPNV+K +
Sbjct: 121 SQDIHLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKESKKTEEQKLFKGLNDPNVEKTE 180

Query: 181 EISEGSGKESVTKKRKFGPKAPNPLSVKKKKKAYSTSDEARGKEDTSKEKKRRRRKHGSH 240
           ++S  SGKES  KKRK GPKAPNPLSVKKKK +   S+E +G++D  KEKKRRR+   S 
Sbjct: 181 KVSSESGKESAPKKRKIGPKAPNPLSVKKKKTS-QPSNETKGEDDAFKEKKRRRKHKSST 239

Query: 241 TNSITNRTTA 250
             S  N TT 
Sbjct: 240 NKSAINGTTV 249

>Suva_15.179 Chr15 (308047..308826) [780 bp, 259 aa] {ON} YOR004W
           (REAL)
          Length = 259

 Score =  407 bits (1045), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 192/219 (87%), Positives = 206/219 (94%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNGSNFNLPSGLKRTLQADVKVM 60
           MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLV EC+GSNF+LPSGLKRTLQADVKVM
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVM 60

Query: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPADCIESVVDINGANKHRYVVA 120
           ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPA+CIESVV++NGANKHRYVVA
Sbjct: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVNVNGANKHRYVVA 120

Query: 121 SQDIGLRRKLRNVPGVPLIHLTRSVMVMEPLSTASAKASKMTEERKLYKGLNDPNVDKVQ 180
           SQDI LRRKLR VPGVPLIHLTRSVM+MEPLSTASAKAS+MTEE+KLYKGLNDPN++K +
Sbjct: 121 SQDIDLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKASRMTEEQKLYKGLNDPNIEKAE 180

Query: 181 EISEGSGKESVTKKRKFGPKAPNPLSVKKKKKAYSTSDE 219
            IS+GS KES  KKRK GPKAPNPLS+KKKKK   + DE
Sbjct: 181 AISKGSEKESTPKKRKAGPKAPNPLSMKKKKKTGPSDDE 219

>NDAI0I02250 Chr9 (513792..514607) [816 bp, 271 aa] {ON} Anc_6.15
           YOR004W
          Length = 271

 Score =  311 bits (798), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 149/226 (65%), Positives = 181/226 (80%), Gaps = 8/226 (3%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNGSNFNLPSGLKRTLQADVKVM 60
           MRQKRAKSYRKQLLVY+HTFKFR PYQVLVDNQ+VL+C+ SN++L  GLK TLQ++VKVM
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFKFRAPYQVLVDNQIVLDCSNSNYDLAKGLKNTLQSEVKVM 60

Query: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPADCIESVVDINGANKHRYVVA 120
           ITQCC+QALYE  N+ AI+LA++FERRRCNH+ K+PK+  +CIESVV+ING NKHRYVVA
Sbjct: 61  ITQCCMQALYEENNQDAIELARRFERRRCNHNPKEPKTAIECIESVVNINGQNKHRYVVA 120

Query: 121 SQDIGLRRKLRNVPGVPLIHLTRSVMVMEPLSTASAKASKMTEERKLYKGLNDPN----- 175
           SQD+  RRKLR VPGVPLIH++R+VM+MEPLS  SA+ S+  E  KLYKGLNDP      
Sbjct: 121 SQDLATRRKLRQVPGVPLIHISRAVMIMEPLSDVSAQVSRRKENEKLYKGLNDPKFTGVK 180

Query: 176 --VDKVQEISEGSGKESVTKKRKFGPKAPNPLSVKKKKKAYSTSDE 219
             VDK + + E    +   KKRK GPK PNPLS+KKKK A ++ +E
Sbjct: 181 SAVDK-ETVKEKESTDQQKKKRKIGPKGPNPLSMKKKKTASNSMNE 225

>KAFR0A05060 Chr1 complement(1006556..1007365) [810 bp, 269 aa] {ON}
           Anc_6.15 YOR004W
          Length = 269

 Score =  308 bits (789), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 149/233 (63%), Positives = 180/233 (77%), Gaps = 4/233 (1%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNGSNFNLPSGLKRTLQADVKVM 60
           MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDN++V   + SNF+L  GLKRTLQA+VK M
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNEIVTVSSNSNFDLVKGLKRTLQAEVKPM 60

Query: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPADCIESVVDINGANKHRYVVA 120
           ITQCC+QALYETR++ AID+AK FERRRCNH  K+PK+P +C+ SVV++NG NKHRYVVA
Sbjct: 61  ITQCCMQALYETRDQNAIDMAKGFERRRCNHPPKEPKTPIECVLSVVNVNGKNKHRYVVA 120

Query: 121 SQDIGLRRKLRNVPGVPLIHLTRSVMVMEPLSTASAKASKMTEERKLYKGLNDPNVDKV- 179
           SQDI +RR+LR VPGVPL+H++RSVM+MEPLS  SAK S   E+ KLYKGLNDP    + 
Sbjct: 121 SQDIDIRRQLRRVPGVPLVHISRSVMIMEPLSDTSAKISSRMEQEKLYKGLNDPKYAGLK 180

Query: 180 ---QEISEGSGKESVTKKRKFGPKAPNPLSVKKKKKAYSTSDEARGKEDTSKE 229
              +E +E  G    T K+K GPK PNPLSV+KK K  +   +    +D  +E
Sbjct: 181 LDEEEATETQGSGEKTAKKKRGPKGPNPLSVRKKVKTLNEPKQTDKNDDVQEE 233

>NCAS0D02660 Chr4 complement(511544..512329) [786 bp, 261 aa] {ON}
           Anc_6.15
          Length = 261

 Score =  301 bits (770), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 148/233 (63%), Positives = 190/233 (81%), Gaps = 7/233 (3%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNGSNFNLPSGLKRTLQADVKVM 60
           MRQKRAKSYRKQLLVY+HTF+FREPYQ+LVDNQ+V +C+ SN++L  GL RTLQA+VKVM
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFRFREPYQILVDNQIVTDCSTSNYDLEKGLHRTLQAEVKVM 60

Query: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPADCIESVVDINGANKHRYVVA 120
           ITQCC+QALYE  ++ AI+LA++FERRRCNH+ KDPK+P +CIESVV+ING NKHRYVVA
Sbjct: 61  ITQCCMQALYEANDQNAIELARRFERRRCNHNPKDPKTPIECIESVVNINGQNKHRYVVA 120

Query: 121 SQDIGLRRKLRNVPGVPLIHLTRSVMVMEPLSTASAKASKMTEERKLYKGLNDPNVDKVQ 180
           +QD+ +RRKLR VPGVPL+H++R+VM+MEPLS ASAK SK  E  KLYKGLNDP    V+
Sbjct: 121 AQDVAIRRKLRQVPGVPLVHISRAVMIMEPLSDASAKVSKRKENEKLYKGLNDPKYTGVK 180

Query: 181 EISEG--SGKESVTKKRKFGPKAPNPLSVKKKKKAYSTSDEARGKEDTSKEKK 231
             +E      +   KK K+GPK+PNPLS+KKKK+     +  R +ED++++++
Sbjct: 181 TAAEDVKIDDKPKPKKSKYGPKSPNPLSMKKKKQ-----EPKRNREDSTEDQE 228

>KLLA0D01023g Chr4 (89887..90693) [807 bp, 268 aa] {ON} similar to
           uniprot|Q12339 Saccharomyces cerevisiae YOR004W Protein
           required for cell viability
          Length = 268

 Score =  296 bits (758), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 143/220 (65%), Positives = 175/220 (79%), Gaps = 5/220 (2%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNGSNFNLPSGLKRTLQADVKVM 60
           MRQKRAKSYRKQ+LVY+HTFKFR+PYQVLVD+QLVLE   S+F+   GL+RTLQA+VK M
Sbjct: 1   MRQKRAKSYRKQMLVYNHTFKFRQPYQVLVDDQLVLETFNSSFDFVKGLQRTLQAEVKPM 60

Query: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPADCIESVVDINGANKHRYVVA 120
           ITQCC+Q+LY+T N+GAID  KQFERRRCNH  K+PKS  +C+ SVVD+NG NKHRYVVA
Sbjct: 61  ITQCCMQSLYQTNNQGAIDAGKQFERRRCNHDPKEPKSVLECLTSVVDVNGKNKHRYVVA 120

Query: 121 SQDIGLRRKLRNVPGVPLIHLTRSVMVMEPLSTASAKASKMTEERKLYKGLNDPNVDKV- 179
           +QD+ +RR+LR +PGVPL+++ RSVMVMEPLS AS K S+  EE+KLYKGLNDP    + 
Sbjct: 121 TQDVEIRRRLRKIPGVPLVYMNRSVMVMEPLSNASEKVSREVEEQKLYKGLNDPKFAGIA 180

Query: 180 ---QEISEGSGKESVTKKRKFGPKAPNPLSVKKKKKAYST 216
               + +    +E+  KKRK GPK PNPLS+KKKK   ST
Sbjct: 181 RDENDEAGAENQENKPKKRK-GPKEPNPLSMKKKKTTEST 219

>Kpol_1045.74 s1045 complement(173724..174497) [774 bp, 257 aa] {ON}
           complement(173726..174499) [774 nt, 258 aa]
          Length = 257

 Score =  296 bits (757), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 143/215 (66%), Positives = 178/215 (82%), Gaps = 7/215 (3%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNGSNFNLPSGLKRTLQADVKVM 60
           MRQ+RAKSYRKQ+LVY+HTFKFREPYQ +VD+QLVL+C  S F++  GLKRTLQA+VKVM
Sbjct: 1   MRQRRAKSYRKQMLVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVM 60

Query: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPADCIESVVDINGANKHRYVVA 120
           ITQCC+QALY+T N+ AI +AK+FERRRCNH  KDPKSP +CIES+VDI G+NKHRYVVA
Sbjct: 61  ITQCCMQALYKTDNQEAISIAKEFERRRCNHPPKDPKSPLECIESIVDIKGSNKHRYVVA 120

Query: 121 SQDIGLRRKLRNVPGVPLIHLTRSVMVMEPLSTASAKASKMTEERKLYKGLND----PNV 176
           SQD+ +RRKLR +PGVP++H++R+VM++EPLS AS K S+  E+ KLYKGLND      +
Sbjct: 121 SQDMDIRRKLRKIPGVPIVHVSRAVMILEPLSDASLKISERLEKDKLYKGLNDSKHTAGL 180

Query: 177 DKVQEISEGSGKESVTKKRKFGPKAPNPLSVKKKK 211
           D+ +  SE S K S +KK K GPK PNPLS+KK+K
Sbjct: 181 DEPK--SEKSEKTSESKKNK-GPKQPNPLSMKKRK 212

>KNAG0F02880 Chr6 complement(546147..546956) [810 bp, 269 aa] {ON}
           Anc_6.15 YOR004W
          Length = 269

 Score =  295 bits (756), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 143/219 (65%), Positives = 175/219 (79%), Gaps = 7/219 (3%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNGSNFNLPSGLKRTLQADVKVM 60
           MRQKRAKSYRKQLLVY+HTF+FREPYQV++D+++VL+   S F+L   L+RT+QA+VK+M
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFRFREPYQVILDDEIVLQATESKFDLYKALQRTVQAEVKLM 60

Query: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPADCIESVVDINGANKHRYVVA 120
           ITQCC+QALY T N  AID+AK++ERRRCNH  KDPKSP +CIESVVDI G NKHRY+VA
Sbjct: 61  ITQCCMQALYATNNRQAIDMAKRYERRRCNHPPKDPKSPFECIESVVDIKGENKHRYIVA 120

Query: 121 SQDIGLRRKLRNVPGVPLIHLTRSVMVMEPLSTASAKASKMTEERKLYKGLNDPNVDKVQ 180
            Q+I LRRKLR VPGVPLIH++R+VM+MEPLS ASA+ SK  E++KL+ GLND     ++
Sbjct: 121 CQNIDLRRKLRRVPGVPLIHVSRAVMIMEPLSDASARISKRMEQQKLFSGLNDAKAAGIK 180

Query: 181 ----EISEGSGKESVT---KKRKFGPKAPNPLSVKKKKK 212
               E  E  GKE+     KKRK GPK PNPLS+KKKKK
Sbjct: 181 AAETEKVEDKGKEAPEAKPKKRKLGPKQPNPLSMKKKKK 219

>TDEL0G04540 Chr7 complement(828055..828792) [738 bp, 245 aa] {ON}
           Anc_6.15 YOR004W
          Length = 245

 Score =  291 bits (746), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 153/242 (63%), Positives = 182/242 (75%), Gaps = 8/242 (3%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNGSNFNLPSGLKRTLQADVKVM 60
           MRQKRAK+YRKQ+LVY+HTFKFREPYQVLVDNQ+VL+C+GSNF+L  GL+RTLQA+VKVM
Sbjct: 1   MRQKRAKAYRKQMLVYNHTFKFREPYQVLVDNQIVLDCHGSNFDLVKGLQRTLQAEVKVM 60

Query: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPADCIESVVDINGANKHRYVVA 120
           ITQCC+QALYET  +GAI+LAK FERRRCNH  K+PK P +C+ES+V +NG NKHRYVVA
Sbjct: 61  ITQCCMQALYETNKQGAIELAKTFERRRCNHPPKEPKPPIECLESIVCVNGHNKHRYVVA 120

Query: 121 SQDIGLRRKLRNVPGVPLIHLTRSVMVMEPLSTASAKASKMTEERKLYKGLNDPNVDKVQ 180
           SQDI  RR LR  PGVPL+H  RSVMVMEPLS ASAK S   E  KL+KGLNDP    ++
Sbjct: 121 SQDIDTRRILRRTPGVPLVHTVRSVMVMEPLSDASAKVSSAAEAEKLHKGLNDPRNAGIK 180

Query: 181 EISEGSGKESVTKKRKFGPKAPNPLSVKKKK-KAYSTSDEARGKEDTSKEKKRRRRKHGS 239
                   ++  KKR    K PNPLSVKK+K ++      A+  E  +   K+RRRKH S
Sbjct: 181 ----TENPQTSIKKRT---KQPNPLSVKKRKTESKGEPKAAQDTEPVASNTKKRRRKHKS 233

Query: 240 HT 241
            T
Sbjct: 234 ST 235

>CAGL0E02673g Chr5 (253705..254496) [792 bp, 263 aa] {ON} similar to
           uniprot|Q12339 Saccharomyces cerevisiae YOR004w
          Length = 263

 Score =  292 bits (748), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 153/253 (60%), Positives = 189/253 (74%), Gaps = 7/253 (2%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNGSNFNLPSGLKRTLQADVKVM 60
           MRQKRAKSYRKQLLVY+HTFKFREPYQVL+D+Q+V++   S ++L   LKRTLQA+VK M
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFKFREPYQVLLDDQIVMDSTTSKYDLVKALKRTLQAEVKPM 60

Query: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPADCIESVVDINGANKHRYVVA 120
           ITQCC+QALYET+NE AIDL K+FERRRC H   +  SP +CI +VVD+ G NKHRYVVA
Sbjct: 61  ITQCCMQALYETKNEHAIDLGKEFERRRCGHMPGEAVSPKECILNVVDVKGKNKHRYVVA 120

Query: 121 SQDIGLRRKLRNVPGVPLIHLTRSVMVMEPLSTASAKASKMTEERKLYKGLNDPNVDKVQ 180
            QD+ +RR LR VPGVPL+H++RSVM+MEPLS ASAK S+M EE KL++GLNDP    ++
Sbjct: 121 CQDVEIRRLLRKVPGVPLLHISRSVMIMEPLSDASAKVSRMEEESKLFRGLNDPKYAGLK 180

Query: 181 ---EISEGSGKESVTKKRKFGPKAPNPLSV-KKKKKAYSTSDEARGKEDTSKEKKRRR-- 234
              E  E S +++V KKRK GPK PNPLS+ KKKK+      +     D S+  KRRR  
Sbjct: 181 GEHEEEEQSKEQTVAKKRKIGPKQPNPLSMKKKKKENTKKEQQTETSADQSQPTKRRRSR 240

Query: 235 -RKHGSHTNSITN 246
             KHGS  ++ TN
Sbjct: 241 KHKHGSKNSTDTN 253

>SAKL0E01056g Chr5 (79518..80327) [810 bp, 269 aa] {ON} similar to
           uniprot|Q12339 Saccharomyces cerevisiae YOR004W Protein
           required for cell viability
          Length = 269

 Score =  288 bits (738), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 149/247 (60%), Positives = 187/247 (75%), Gaps = 14/247 (5%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNGSNFNLPSGLKRTLQADVKVM 60
           MRQKRAKSYRKQ+LVY+HTFKFREPYQVLVD+Q+V+    S+F+L  GLKRTLQA+VK M
Sbjct: 1   MRQKRAKSYRKQMLVYNHTFKFREPYQVLVDDQIVMGTYKSSFDLAKGLKRTLQAEVKPM 60

Query: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPADCIESVVDINGANKHRYVVA 120
           ITQCC+QALY T+++GAI++AK +ERRRCNH  K+ K+  +CIESVV+ NG NKHRYVVA
Sbjct: 61  ITQCCMQALYATKDQGAIEMAKTYERRRCNHPPKESKTSLECIESVVNFNGKNKHRYVVA 120

Query: 121 SQDIGLRRKLRNVPGVPLIHLTRSVMVMEPLSTASAKASKMTEERKLYKGLNDP------ 174
           +QDI +RRKLR VPGVPLI++ RSVMVMEPLS AS + SK+ EE KL+KGLNDP      
Sbjct: 121 TQDIDIRRKLRRVPGVPLIYMNRSVMVMEPLSEASERLSKVREEEKLFKGLNDPKHAGLA 180

Query: 175 ---NVDKVQEISEGSGKESVTKKRKFGPKAPNPLSVKKKKKAYSTSDEARGKEDTSKEKK 231
              +VD V  +     K+    K+K GPK PNPLSVK+K+     + +A  +     E+K
Sbjct: 181 HDESVDLVDSV-----KQKQPSKKKGGPKEPNPLSVKRKRDQREENTKAPAETAEQSERK 235

Query: 232 RRRRKHG 238
           RR+R+HG
Sbjct: 236 RRKRRHG 242

>ACR011C Chr3 complement(377334..378095) [762 bp, 253 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR004W
          Length = 253

 Score =  287 bits (735), Expect = 8e-98,   Method: Compositional matrix adjust.
 Identities = 141/233 (60%), Positives = 180/233 (77%), Gaps = 8/233 (3%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNGSNFNLPSGLKRTLQADVKVM 60
           MRQKRAK+Y+KQ+LVY+HTFKFREPYQVLVD+Q+VLE N S+F+L  GLKRTLQA+VK M
Sbjct: 1   MRQKRAKAYKKQMLVYNHTFKFREPYQVLVDDQIVLETNKSSFDLLKGLKRTLQAEVKPM 60

Query: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPADCIESVVDINGANKHRYVVA 120
           ITQCC+Q LY+T+N+ AI   K +ERRRCNH  K+PK P +C++SVV +NG N+HRY+VA
Sbjct: 61  ITQCCMQKLYDTKNQDAIAQGKLYERRRCNH-VKEPKEPIECLQSVVAVNGQNRHRYIVA 119

Query: 121 SQDIGLRRKLRNVPGVPLIHLTRSVMVMEPLSTASAKASKMTEERKLYKGLNDPNVDKVQ 180
           SQDI +RR LR VPGVPL+++ R+VMVMEPLS+ S + S+  E++KL+KGLNDP    + 
Sbjct: 120 SQDIAIRRALRKVPGVPLVYINRAVMVMEPLSSTSEQVSREAEKQKLFKGLNDPKYTGIA 179

Query: 181 EISEGSGKESV----TKKRKFGPKAPNPLSVKKK--KKAYSTSDEARGKEDTS 227
           E S  +G +      T KRK GPKAPNPLS+KK+  K+   TSD +  K D S
Sbjct: 180 ENSAPAGAQPAEGAPTLKRK-GPKAPNPLSMKKRKVKEEQPTSDASEQKADAS 231

>KLTH0C11352g Chr3 complement(934886..935692) [807 bp, 268 aa] {ON}
           similar to uniprot|Q12339 Saccharomyces cerevisiae
           YOR004W Protein required for cell viability
          Length = 268

 Score =  287 bits (735), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 138/223 (61%), Positives = 174/223 (78%), Gaps = 3/223 (1%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNGSNFNLPSGLKRTLQADVKVM 60
           MRQKRAKSYRKQ+LVY+H FKFREPYQVLVD+Q+V + + ++F+L  GL+RTLQA+VK M
Sbjct: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHRASFDLVKGLQRTLQAEVKPM 60

Query: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPADCIESVVDINGANKHRYVVA 120
           ITQCCIQA+YET+N+ AI+LAK FERRRCNH  K+ K P +C++SVV +NG NKHRYVVA
Sbjct: 61  ITQCCIQAIYETKNQDAIELAKSFERRRCNHPPKEAKPPIECLQSVVSVNGNNKHRYVVA 120

Query: 121 SQDIGLRRKLRNVPGVPLIHLTRSVMVMEPLSTASAKASKMTEERKLYKGLNDPNVDKVQ 180
           SQD  +R+KLR VPGVPLI++ RSVMVMEPLS AS   S+  E+ KL+KGLNDP    + 
Sbjct: 121 SQDPSIRKKLRQVPGVPLIYMNRSVMVMEPLSKASGDFSRAQEKEKLFKGLNDPKYAGLP 180

Query: 181 EISEGSGKES---VTKKRKFGPKAPNPLSVKKKKKAYSTSDEA 220
              EG   ++   V+K ++ GPK PNPLS+KKKK    + DE+
Sbjct: 181 AEEEGGKTDNGTEVSKNKRKGPKGPNPLSIKKKKTVPDSKDES 223

>ZYRO0C07920g Chr3 complement(603790..604671) [882 bp, 293 aa] {ON}
           similar to uniprot|Q12339 Saccharomyces cerevisiae
           YOR004W Protein required for cell viability
          Length = 293

 Score =  286 bits (732), Expect = 9e-97,   Method: Compositional matrix adjust.
 Identities = 139/217 (64%), Positives = 175/217 (80%), Gaps = 6/217 (2%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNGSNFNLPSGLKRTLQADVKVM 60
           MRQKRAKSY+KQ+LVY++ F+FREPYQVL+D+QLV +C  S+++L  GLKRTLQA+VK M
Sbjct: 1   MRQKRAKSYKKQMLVYNYAFRFREPYQVLIDDQLVSDCQKSHYDLVGGLKRTLQAEVKPM 60

Query: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPADCIESVVDINGANKHRYVVA 120
           ITQCC+QALY T+N+ AI+L K FERRRCNH  K+ K P +CI+SVV++NG+NKHRYVVA
Sbjct: 61  ITQCCMQALYFTKNQDAIELGKSFERRRCNHPPKEAKPPHECIQSVVNVNGSNKHRYVVA 120

Query: 121 SQDIGLRRKLRNVPGVPLIHLTRSVMVMEPLSTASAKASKMTEERKLYKGLNDPNVDKVQ 180
           SQD+ LRRKLR VPGVPLIH++RSVMVMEPLS AS++ ++M+E  KL KGLNDP +  ++
Sbjct: 121 SQDVTLRRKLRKVPGVPLIHMSRSVMVMEPLSEASSRVNEMSEREKLLKGLNDPKLAGLK 180

Query: 181 -----EISEGSGKESVTKKRKFGPKAPNPLSVKKKKK 212
                E    S  +   KKRK GPK PNPLSV+KK+K
Sbjct: 181 TTPSVENELESESQPPAKKRK-GPKGPNPLSVRKKQK 216

>TPHA0J00280 Chr10 (63865..64680) [816 bp, 271 aa] {ON} Anc_6.15
           YOR004W
          Length = 271

 Score =  283 bits (724), Expect = 8e-96,   Method: Compositional matrix adjust.
 Identities = 144/254 (56%), Positives = 184/254 (72%), Gaps = 20/254 (7%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNGSNFNLPSGLKRTLQAD-VKV 59
           MRQKRAKSY+KQ++VY+HTFKFREPYQ+LVD Q+V +   SN+NL   L++TLQA+ +KV
Sbjct: 1   MRQKRAKSYKKQMVVYNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKV 60

Query: 60  MITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPADCIESVVDINGANKHRYVV 119
           MITQCC+Q LY T N+  ID AK+FERRRCNHS KDPK P +CIES+V+I+G NKHRYVV
Sbjct: 61  MITQCCMQKLYTTSNQELIDEAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVV 120

Query: 120 ASQDIGLRRKLRNVPGVPLIHLTRSVMVMEPLSTASAKASKMTEERKLYKGLNDPNVDKV 179
           A+Q++ LRRKLR VPGVP++HL+RSVM+MEP+S +S + ++  E+ KLYKGLNDP     
Sbjct: 121 ATQNMELRRKLRRVPGVPILHLSRSVMIMEPISDSSVRLNRKFEQSKLYKGLNDPKYSMA 180

Query: 180 QEISEGS----GKESVTKKRKFGPKAPNPLSVKKK------KKAYSTSDEARGKEDTSKE 229
               EG+    G +    K++ G K PNPLS KKK      K A +T+D A         
Sbjct: 181 PTPKEGTPDTEGTQPAATKKRKGVKEPNPLSKKKKVKVEIPKPAATTTDAA--------- 231

Query: 230 KKRRRRKHGSHTNS 243
            K+RRRKH S+ NS
Sbjct: 232 NKKRRRKHRSNKNS 245

>Kwal_56.22399 s56 (111021..111845) [825 bp, 274 aa] {ON} YOR004W -
           Protein required for cell viability [contig 185] FULL
          Length = 274

 Score =  278 bits (712), Expect = 6e-94,   Method: Compositional matrix adjust.
 Identities = 151/277 (54%), Positives = 188/277 (67%), Gaps = 35/277 (12%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNGSNFNLPSGLKRTLQADVKVM 60
           MRQKRAKSYRKQ+LVY+H FKFREPYQVLVD+Q+V + + + F+L  GLKRTLQA+VK M
Sbjct: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHKAAFDLVKGLKRTLQAEVKPM 60

Query: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPADCIESVVDINGANKHRYVVA 120
           ITQCCIQA+YET ++ AI+LAK FERRRCNH  K+ K P +C++SVV++NG NKHRYVVA
Sbjct: 61  ITQCCIQAIYETNDQEAIELAKSFERRRCNHPPKEAKPPLECLQSVVNVNGVNKHRYVVA 120

Query: 121 SQDIGLRRKLRNVPGVPLIHLTRSVMVMEPLSTASAKASKMTEERKLYKGLNDP------ 174
           +Q+  +R  LR VPGVPL+ + RSVMVMEPLS AS   S++ E  KL+KGLNDP      
Sbjct: 121 TQNQEIRGCLRKVPGVPLVFMNRSVMVMEPLSKASQNVSRVQEREKLFKGLNDPKFAGLP 180

Query: 175 -----------NVDKVQEISEGSGKESVTKKRKFGPKAPNPLSVKKKKKAYSTSDEARGK 223
                       VDK     EG+G  +  KKRK GPK PNPLS+KKKK + S  +     
Sbjct: 181 LTEQPATATAATVDK-----EGAG--APAKKRK-GPKGPNPLSIKKKKTSESRKEPVNPA 232

Query: 224 EDTS--------KEK--KRRRRKHGSHTNSITNRTTA 250
           E+TS        KE+  +RR+R H   T      TT+
Sbjct: 233 ENTSATLTENDNKEQPSRRRKRSHKKTTPQTAEETTS 269

>Ecym_3019 Chr3 (36286..37086) [801 bp, 266 aa] {ON} similar to
           Ashbya gossypii ACR011C
          Length = 266

 Score =  268 bits (685), Expect = 5e-90,   Method: Compositional matrix adjust.
 Identities = 136/215 (63%), Positives = 167/215 (77%), Gaps = 7/215 (3%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNGSNFNLPSGLKRTLQADVKVM 60
           MRQKRAK+Y+KQ+LVY+HTFKFR+PYQVLVD+QLVLE N S+F+L  GLKRTLQA+VK M
Sbjct: 1   MRQKRAKAYKKQMLVYNHTFKFRQPYQVLVDDQLVLETNKSSFDLLKGLKRTLQAEVKPM 60

Query: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPADCIESVVDINGANKHRYVVA 120
           ITQCC+Q LYE++N+GAI  AK +ERRRCNH +K+PK P++CI SVVDING N HRYVVA
Sbjct: 61  ITQCCVQKLYESKNQGAIAQAKMYERRRCNH-YKEPKEPSECIRSVVDINGRNLHRYVVA 119

Query: 121 SQDIGLRRKLRNVPGVPLIHLTRSVMVMEPLSTASAKASKMTEERKLYKGLND------P 174
           +QDI +RR LR VPGVPLI++ RSVMVMEPLS+ S + S+  E  KL KGLND      P
Sbjct: 120 TQDIEIRRILRRVPGVPLIYMNRSVMVMEPLSSNSQQVSQQVENEKLVKGLNDPKYAGTP 179

Query: 175 NVDKVQEISEGSGKESVTKKRKFGPKAPNPLSVKK 209
           N  +   +   S   +  K++  GPK PNPLS+KK
Sbjct: 180 NNTEDASVDPKSPDANQLKRKIKGPKEPNPLSIKK 214

>TBLA0A07290 Chr1 (1814724..1815503) [780 bp, 259 aa] {ON} Anc_6.15
           YOR004W
          Length = 259

 Score =  234 bits (598), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 131/262 (50%), Positives = 173/262 (66%), Gaps = 27/262 (10%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNGSNFNLPSGLKRTLQAD--VK 58
           MRQKRAKSY+KQL+VY+HTFKFREPYQV++D+ LV E   + +NL  GL   L +   +K
Sbjct: 1   MRQKRAKSYKKQLIVYNHTFKFREPYQVIIDDALVQETLRAKYNLIKGLNNVLSSSNAIK 60

Query: 59  VMITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPADCIESVVDINGANKHRYV 118
            MITQCCI ALY++ ++ +I + K FERRRCNHS K+P SP++C+ S+VD+NG NKHRY+
Sbjct: 61  PMITQCCISALYKSEDQESISIGKTFERRRCNHSVKEPLSPSECMLSIVDVNGKNKHRYI 120

Query: 119 VASQDIGLRRKLRNVPGVPLIHLTRSVMVMEPLSTASAKASKMTEERKLYKGLNDPNVDK 178
           VA+QD+ LRRKLR +PGVPLIH  RSVMVMEPLS AS + ++  E +KL  GLN      
Sbjct: 121 VATQDLELRRKLRKIPGVPLIHFKRSVMVMEPLSDASCEYNEEVESKKLTSGLNSTKAS- 179

Query: 179 VQEISEGSGKESVTKKRKFGPKAPNPLSVKKKKKAYSTSD---------------EARGK 223
                EG  +  + KK+  G    NPLS+KKK  + S S+                 R  
Sbjct: 180 ----VEGGQENGIKKKKVKG---VNPLSMKKKSNSNSNSNSNSNSNSKPKPKPIKHERDN 232

Query: 224 EDTSKE--KKRRRRKHGSHTNS 243
           E+ + +  KKRR+RKH S+ N+
Sbjct: 233 ENATDQPAKKRRKRKHTSNANA 254

>KLTH0E02860g Chr5 (258370..258939) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339C Protein required for cell viability
          Length = 189

 Score = 62.0 bits (149), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 42/145 (28%), Positives = 74/145 (51%), Gaps = 17/145 (11%)

Query: 14  LVYSHTFKFREPYQVLVDNQLVLECNGSNFNLPSGLKRTLQADVKVMITQCCIQALYET- 72
           L + +    + PYQVL+D   +        ++  G+  TL A    MIT C +  L +  
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDTLLAKCIPMITDCVMAELEKLG 110

Query: 73  -RNEGAIDLAK--QFERRRCNH--SFKDPKSPADCIESVVDINGANKHR-YVVASQDIGL 126
            +   A+ LA+  + +R  C+H  ++ D     DC+     +N   +H+ Y+VA+ D GL
Sbjct: 111 PKYRIALKLARDPRIQRLTCSHKGTYAD-----DCL-----VNRVLQHKCYIVATNDAGL 160

Query: 127 RRKLRNVPGVPLIHLTRSVMVMEPL 151
           ++++R VPG+PL+ +     V+E L
Sbjct: 161 KQRIRKVPGIPLMSVGGHAYVIEKL 185

>Kpol_1055.18 s1055 complement(40805..41374) [570 bp, 189 aa] {ON}
           complement(40805..41374) [570 nt, 190 aa]
          Length = 189

 Score = 60.5 bits (145), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 74/145 (51%), Gaps = 17/145 (11%)

Query: 14  LVYSHTFKFREPYQVLVDNQLVLECNGSNFNLPSGLKRTLQADVKVMITQCCIQALYET- 72
           L + +    + PYQVL+D   +        ++  G+   L A    +IT C +  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIIKGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 73  -RNEGAIDLAK--QFERRRCNH--SFKDPKSPADCIESVVDINGANKHR-YVVASQDIGL 126
            +   A+ LA+  + +R  C+H  ++ D     DCI     +N   +H+ Y+VA+ D+GL
Sbjct: 111 PKYRIALRLARDPRIKRLSCSHKGTYAD-----DCI-----VNRVLQHKCYIVATNDVGL 160

Query: 127 RRKLRNVPGVPLIHLTRSVMVMEPL 151
           ++++R VPG+PL+ +     V+E L
Sbjct: 161 KQRIRKVPGIPLMSVGGHSYVIEKL 185

>CAGL0M01056g Chr13 (117010..117579) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339c
          Length = 189

 Score = 60.1 bits (144), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 72/145 (49%), Gaps = 17/145 (11%)

Query: 14  LVYSHTFKFREPYQVLVDNQLVLECNGSNFNLPSGLKRTLQADVKVMITQCCIQALYET- 72
           L + +    + PYQVL+D   +        ++  G+   L A    +IT C I  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVKGMMDCLLAKCNPLITDCVIAELEKLG 110

Query: 73  -RNEGAIDLAK--QFERRRCNH--SFKDPKSPADCIESVVDINGANKHR-YVVASQDIGL 126
            +   A+ LA+  + +R  C H  ++ D     DCI     +N   +H+ Y+VA+ D GL
Sbjct: 111 PKYRIALKLARDPRIKRLTCTHKGTYAD-----DCI-----VNRVLQHKCYIVATNDAGL 160

Query: 127 RRKLRNVPGVPLIHLTRSVMVMEPL 151
           ++++R +PG+PL+ +     V+E L
Sbjct: 161 KQRVRKIPGIPLMSVGGHAYVIEKL 185

>KLLA0A07018g Chr1 complement(632523..633092) [570 bp, 189 aa] {ON}
           highly similar to uniprot|Q05498 Saccharomyces
           cerevisiae YDR339C Protein required for cell viability
          Length = 189

 Score = 59.3 bits (142), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 40/145 (27%), Positives = 74/145 (51%), Gaps = 17/145 (11%)

Query: 14  LVYSHTFKFREPYQVLVDNQLVLECNGSNFNLPSGLKRTLQADVKVMITQCCIQALYET- 72
           L + +    + PYQVL+D   +        ++  G+   L A   ++IT C +  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVKGMMDCLLAKCNILITDCVMAELEKLG 110

Query: 73  -RNEGAIDLAK--QFERRRCNH--SFKDPKSPADCIESVVDINGANKHR-YVVASQDIGL 126
            +   A+ LA+  + +R  C+H  ++ D     DCI     ++   +H+ Y+VA+ D GL
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD-----DCI-----VHRVLQHKCYIVATNDAGL 160

Query: 127 RRKLRNVPGVPLIHLTRSVMVMEPL 151
           ++++R VPG+PL+ +     V+E L
Sbjct: 161 KQRVRKVPGIPLMSVGGHSYVIEKL 185

>KAFR0D04280 Chr4 (842029..842598) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 59.3 bits (142), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 73/145 (50%), Gaps = 17/145 (11%)

Query: 14  LVYSHTFKFREPYQVLVDNQLVLECNGSNFNLPSGLKRTLQADVKVMITQCCIQALYET- 72
           L + +    + PYQVL+D   +        ++  G+   L A    +IT C I  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCNPLITDCVIAELEKLG 110

Query: 73  -RNEGAIDLAK--QFERRRCNH--SFKDPKSPADCIESVVDINGANKHR-YVVASQDIGL 126
            +   A+ LA+  + +R  C+H  ++ D     DCI     +N   +H+ Y+VA+ D GL
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD-----DCI-----VNRVLQHKCYIVATNDAGL 160

Query: 127 RRKLRNVPGVPLIHLTRSVMVMEPL 151
           ++++R +PG+PL+ +     V+E L
Sbjct: 161 KQRVRKIPGIPLMSVGGHSYVIEKL 185

>Kwal_55.20089 s55 (245372..245941) [570 bp, 189 aa] {ON} YDR339C -
           Protein required for cell viability [contig 154] FULL
          Length = 189

 Score = 59.3 bits (142), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 73/145 (50%), Gaps = 17/145 (11%)

Query: 14  LVYSHTFKFREPYQVLVDNQLVLECNGSNFNLPSGLKRTLQADVKVMITQCCIQALYET- 72
           L + +    + PYQVL+D   +        +L  G+  TL A    +IT C +  L +  
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKIDLVRGMMDTLLAKCIPLITDCVMAELEKLG 110

Query: 73  -RNEGAIDLAK--QFERRRCNH--SFKDPKSPADCIESVVDINGANKHR-YVVASQDIGL 126
            +   A+ LA+  + +R  C+H  ++ D     DC+     +N   +H+ Y+VA+ D  L
Sbjct: 111 PKYRIALKLARDPRIQRLSCSHKGTYAD-----DCL-----VNRVLQHKCYIVATNDAAL 160

Query: 127 RRKLRNVPGVPLIHLTRSVMVMEPL 151
           ++++R VPG+PL+ +     V+E L
Sbjct: 161 KQRIRKVPGIPLMSVGGHAYVIEKL 185

>NDAI0C04550 Chr3 complement(1031852..1032421) [570 bp, 189 aa] {ON}
           Anc_5.392
          Length = 189

 Score = 58.9 bits (141), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 73/145 (50%), Gaps = 17/145 (11%)

Query: 14  LVYSHTFKFREPYQVLVDNQLVLECNGSNFNLPSGLKRTLQADVKVMITQCCIQALYET- 72
           L + +    + PYQVL+D   +        +L  G+   L A    +IT C +  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDLVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 73  -RNEGAIDLAK--QFERRRCNH--SFKDPKSPADCIESVVDINGANKHR-YVVASQDIGL 126
            +   A+ LA+  + +R  C+H  ++ D     DCI     +N   +H+ Y+VA+ D GL
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD-----DCI-----VNRVLQHKCYIVATNDAGL 160

Query: 127 RRKLRNVPGVPLIHLTRSVMVMEPL 151
           ++++R +PG+PL+ +     V+E L
Sbjct: 161 KQRVRKIPGIPLMSVGGHSYVIEKL 185

>KNAG0C05270 Chr3 (1028377..1028946) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 58.9 bits (141), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 40/145 (27%), Positives = 73/145 (50%), Gaps = 17/145 (11%)

Query: 14  LVYSHTFKFREPYQVLVDNQLVLECNGSNFNLPSGLKRTLQADVKVMITQCCIQALYET- 72
           L + +    + PYQVL+D   +        ++  G+   L A    +IT C I  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCNPLITDCVIAELEKLG 110

Query: 73  -RNEGAIDLAK--QFERRRCNH--SFKDPKSPADCIESVVDINGANKHR-YVVASQDIGL 126
            +   A+ LA+  + +R  C+H  ++ D     DC+     +N   +H+ Y+VA+ D GL
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD-----DCL-----VNRVLQHKCYIVATNDAGL 160

Query: 127 RRKLRNVPGVPLIHLTRSVMVMEPL 151
           ++++R +PG+PL+ +     V+E L
Sbjct: 161 KQRVRKIPGIPLMSVGGHAYVIEKL 185

>TDEL0E02330 Chr5 (455296..455865) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 58.5 bits (140), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 41/148 (27%), Positives = 72/148 (48%), Gaps = 17/148 (11%)

Query: 14  LVYSHTFKFREPYQVLVDNQLVLECNGSNFNLPSGLKRTLQADVKVMITQCCIQALYET- 72
           L + +    + PYQVL+D   +        +L  G+   L A    +IT C +  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDLVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 73  -RNEGAIDLAK--QFERRRCNH--SFKDPKSPADCIESVVDINGANKHR-YVVASQDIGL 126
            +   A+ LA+  + +R  C H  ++ D     DCI     +N   +H+ Y+VA+ D GL
Sbjct: 111 PKFRIALKLARDPRIKRLSCTHKGTYAD-----DCI-----VNRVLQHKCYIVATNDAGL 160

Query: 127 RRKLRNVPGVPLIHLTRSVMVMEPLSTA 154
           ++++R +PG+PL+ +      +E L  A
Sbjct: 161 KQRVRKIPGIPLMSVGGHAYAIEKLPDA 188

>AEL102W Chr5 (436582..437151) [570 bp, 189 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR339C
          Length = 189

 Score = 58.5 bits (140), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 73/145 (50%), Gaps = 17/145 (11%)

Query: 14  LVYSHTFKFREPYQVLVDNQLVLECNGSNFNLPSGLKRTLQADVKVMITQCCIQALYET- 72
           L + +    + PYQVL+D   +        +L  G+   L A    +IT C +  L +  
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKIDLVRGMMDCLLAKCVPLITDCVMAELEKLG 110

Query: 73  -RNEGAIDLAK--QFERRRCNH--SFKDPKSPADCIESVVDINGANKHR-YVVASQDIGL 126
            +   A+ LA+  + +R  C+H  ++ D     DC+     +N   +H+ Y+VA+ D GL
Sbjct: 111 PKYRIALKLARDPRIKRLNCSHKGTYAD-----DCL-----VNRVLQHKCYIVATNDAGL 160

Query: 127 RRKLRNVPGVPLIHLTRSVMVMEPL 151
           ++++R VPG+PL+ +     V+E L
Sbjct: 161 KQRIRKVPGIPLMSVGGHSYVIEKL 185

>TBLA0H01750 Chr8 (408338..408907) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 58.2 bits (139), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 40/145 (27%), Positives = 73/145 (50%), Gaps = 17/145 (11%)

Query: 14  LVYSHTFKFREPYQVLVDNQLVLECNGSNFNLPSGLKRTLQADVKVMITQCCIQALYET- 72
           L + +    + PYQVL+D   +        ++  G+   L A    +IT C +  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCNPLITDCVVAELEKLG 110

Query: 73  -RNEGAIDLAK--QFERRRCNH--SFKDPKSPADCIESVVDINGANKHR-YVVASQDIGL 126
            +   A+ LA+  + +R  C+H  ++ D     DCI     +N   +H+ Y+VA+ D GL
Sbjct: 111 PKFRIALKLARDPRIKRLSCSHRGTYAD-----DCI-----VNRVLQHKCYIVATNDAGL 160

Query: 127 RRKLRNVPGVPLIHLTRSVMVMEPL 151
           ++++R +PG+PL+ +     V+E L
Sbjct: 161 KQRVRKIPGIPLMSVGGHSYVVEKL 185

>TPHA0D02310 Chr4 complement(478545..479114) [570 bp, 189 aa] {ON}
           Anc_5.392 YDR339C
          Length = 189

 Score = 57.8 bits (138), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 72/145 (49%), Gaps = 17/145 (11%)

Query: 14  LVYSHTFKFREPYQVLVDNQLVLECNGSNFNLPSGLKRTLQADVKVMITQCCIQALYET- 72
           L +      R PYQVL+D   +        ++  G+   L A    +IT C +  L +  
Sbjct: 51  LFFQFNEAIRPPYQVLIDTNFINFSIQKKIDIIKGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 73  -RNEGAIDLAK--QFERRRCNH--SFKDPKSPADCIESVVDINGANKHR-YVVASQDIGL 126
            +   A+ LA+  + +R  C+H  ++ D     DCI     +N   +H+ Y+VA+ D GL
Sbjct: 111 PKYRIALRLARDPRIKRLSCSHKGTYAD-----DCI-----VNRVLQHKCYIVATNDQGL 160

Query: 127 RRKLRNVPGVPLIHLTRSVMVMEPL 151
           ++++R +PG+PL+ +     V+E L
Sbjct: 161 KQRVRKIPGIPLMSVGGHAYVIEKL 185

>Ecym_7469 Chr7 complement(956526..957095) [570 bp, 189 aa] {ON}
           similar to Ashbya gossypii AEL102W
          Length = 189

 Score = 57.4 bits (137), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 40/145 (27%), Positives = 73/145 (50%), Gaps = 17/145 (11%)

Query: 14  LVYSHTFKFREPYQVLVDNQLVLECNGSNFNLPSGLKRTLQADVKVMITQCCIQALYET- 72
           L + +    + PYQVL+D   +        ++  G+   L A    +IT C +  L +  
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCVPLITDCVMAELEKLG 110

Query: 73  -RNEGAIDLAK--QFERRRCNH--SFKDPKSPADCIESVVDINGANKHR-YVVASQDIGL 126
            +   A+ LA+  + +R  C+H  ++ D     DC+     +N   +H+ Y+VA+ D GL
Sbjct: 111 PKYRIALKLARDPRIKRLTCSHRGTYAD-----DCL-----VNRVLQHKCYIVATNDAGL 160

Query: 127 RRKLRNVPGVPLIHLTRSVMVMEPL 151
           ++++R VPG+PL+ +     V+E L
Sbjct: 161 KQRIRKVPGIPLLSVGGHSYVIEKL 185

>NCAS0F03090 Chr6 complement(616705..617274) [570 bp, 189 aa] {ON}
           Anc_5.392 YDR339C
          Length = 189

 Score = 57.0 bits (136), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 40/145 (27%), Positives = 73/145 (50%), Gaps = 17/145 (11%)

Query: 14  LVYSHTFKFREPYQVLVDNQLVLECNGSNFNLPSGLKRTLQADVKVMITQCCIQALYET- 72
           L + +    + PYQVL+D   +        +L  G+   L A    +IT C +  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDLVKGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 73  -RNEGAIDLAK--QFERRRCNH--SFKDPKSPADCIESVVDINGANKHR-YVVASQDIGL 126
            +   A+ LA+  + +R  C+H  ++ D     DCI     +N   +H+ ++VA+ D GL
Sbjct: 111 PKYRIALRLARDPRIKRLSCSHKGTYAD-----DCI-----VNRVLQHKCFIVATNDAGL 160

Query: 127 RRKLRNVPGVPLIHLTRSVMVMEPL 151
           ++++R +PG+PL+ +     V+E L
Sbjct: 161 KQRVRKIPGIPLMSVGGHSYVIEKL 185

>ZYRO0A06754g Chr1 (550964..551533) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339C Protein required for cell viability
          Length = 189

 Score = 57.0 bits (136), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 40/148 (27%), Positives = 72/148 (48%), Gaps = 17/148 (11%)

Query: 14  LVYSHTFKFREPYQVLVDNQLVLECNGSNFNLPSGLKRTLQADVKVMITQCCIQALYET- 72
           L + +    R PYQVL+D   +        ++  G+   L A    +IT C +  L +  
Sbjct: 51  LFFQYNQAIRPPYQVLIDTNFINFSIQKKIDIVKGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 73  -RNEGAIDLAK--QFERRRCNH--SFKDPKSPADCIESVVDINGANKHR-YVVASQDIGL 126
            +   A+ LA+  + +R  C H  ++ D     DC+     +N   +H+ Y+VA+ D  L
Sbjct: 111 PKYRIALKLARDPRIKRLSCTHKGTYAD-----DCL-----VNRVMQHKCYIVATNDAPL 160

Query: 127 RRKLRNVPGVPLIHLTRSVMVMEPLSTA 154
           ++++R +PG+PL+ +     V+E L  A
Sbjct: 161 KQRVRKIPGIPLMSVGGHSYVIEKLPDA 188

>Skud_4.606 Chr4 complement(1085976..1086545) [570 bp, 189 aa] {ON}
           YDR339C (REAL)
          Length = 189

 Score = 55.5 bits (132), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 73/145 (50%), Gaps = 17/145 (11%)

Query: 14  LVYSHTFKFREPYQVLVDNQLVLECNGSNFNLPSGLKRTLQADVKVMITQCCIQALYET- 72
           L + +    + PYQVL+D   +        ++  G+   L A    +IT C +  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 73  -RNEGAIDLAK--QFERRRCNH--SFKDPKSPADCIESVVDINGANKHR-YVVASQDIGL 126
            +   A+ LA+  + +R  C+H  ++ D     DC+     ++   +H+ Y+VA+ D GL
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD-----DCL-----VHRVLQHKCYIVATNDAGL 160

Query: 127 RRKLRNVPGVPLIHLTRSVMVMEPL 151
           ++++R +PG+PL+ +     V+E L
Sbjct: 161 KQRIRKIPGIPLMSVGGHAYVIEKL 185

>Smik_4.599 Chr4 complement(1076379..1076948) [570 bp, 189 aa] {ON}
           YDR339C (REAL)
          Length = 189

 Score = 55.5 bits (132), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 73/145 (50%), Gaps = 17/145 (11%)

Query: 14  LVYSHTFKFREPYQVLVDNQLVLECNGSNFNLPSGLKRTLQADVKVMITQCCIQALYET- 72
           L + +    + PYQVL+D   +        ++  G+   L A    +IT C +  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 73  -RNEGAIDLAK--QFERRRCNH--SFKDPKSPADCIESVVDINGANKHR-YVVASQDIGL 126
            +   A+ LA+  + +R  C+H  ++ D     DC+     ++   +H+ Y+VA+ D GL
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD-----DCL-----VHRVLQHKCYIVATNDAGL 160

Query: 127 RRKLRNVPGVPLIHLTRSVMVMEPL 151
           ++++R +PG+PL+ +     V+E L
Sbjct: 161 KQRIRKIPGIPLMSVGGHAYVIEKL 185

>Suva_2.509 Chr2 complement(907366..907935) [570 bp, 189 aa] {ON}
           YDR339C (REAL)
          Length = 189

 Score = 55.5 bits (132), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 73/145 (50%), Gaps = 17/145 (11%)

Query: 14  LVYSHTFKFREPYQVLVDNQLVLECNGSNFNLPSGLKRTLQADVKVMITQCCIQALYET- 72
           L + +    + PYQVL+D   +        ++  G+   L A    +IT C +  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 73  -RNEGAIDLAK--QFERRRCNH--SFKDPKSPADCIESVVDINGANKHR-YVVASQDIGL 126
            +   A+ LA+  + +R  C+H  ++ D     DC+     ++   +H+ Y+VA+ D GL
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD-----DCL-----VHRVLQHKCYIVATNDAGL 160

Query: 127 RRKLRNVPGVPLIHLTRSVMVMEPL 151
           ++++R +PG+PL+ +     V+E L
Sbjct: 161 KQRIRKIPGIPLMSVGGHAYVIEKL 185

>YDR339C Chr4 complement(1149951..1150520) [570 bp, 189 aa] {ON}
           FCF1Putative PINc domain nuclease required for early
           cleavages of 35S pre-rRNA and maturation of 18S rRNA;
           component of the SSU (small subunit) processome involved
           in 40S ribosomal subunit biogenesis; copurifies with
           Faf1p
          Length = 189

 Score = 55.5 bits (132), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 73/145 (50%), Gaps = 17/145 (11%)

Query: 14  LVYSHTFKFREPYQVLVDNQLVLECNGSNFNLPSGLKRTLQADVKVMITQCCIQALYET- 72
           L + +    + PYQVL+D   +        ++  G+   L A    +IT C +  L +  
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 73  -RNEGAIDLAK--QFERRRCNH--SFKDPKSPADCIESVVDINGANKHR-YVVASQDIGL 126
            +   A+ LA+  + +R  C+H  ++ D     DC+     ++   +H+ Y+VA+ D GL
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD-----DCL-----VHRVLQHKCYIVATNDAGL 160

Query: 127 RRKLRNVPGVPLIHLTRSVMVMEPL 151
           ++++R +PG+PL+ +     V+E L
Sbjct: 161 KQRIRKIPGIPLMSVGGHAYVIEKL 185

>SAKL0G07766g Chr7 (652944..653513) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339C Protein required for cell viability
          Length = 189

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 39/145 (26%), Positives = 72/145 (49%), Gaps = 17/145 (11%)

Query: 14  LVYSHTFKFREPYQVLVDNQLVLECNGSNFNLPSGLKRTLQADVKVMITQCCIQALYET- 72
           L + +    + PYQVL+D   +        ++  G+   L A    +IT C +  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCVPLITDCVMAELEKLG 110

Query: 73  -RNEGAIDLAK--QFERRRCNH--SFKDPKSPADCIESVVDINGANKHR-YVVASQDIGL 126
            +   A+ LA+  + +R  C+H  ++ D     DC+     +N   +H+ Y+VA+ D  L
Sbjct: 111 PKYRIALRLARDPRIKRLNCSHKGTYAD-----DCL-----VNRVLQHKCYIVATNDAAL 160

Query: 127 RRKLRNVPGVPLIHLTRSVMVMEPL 151
           ++++R VPG+PL+ +     V+E L
Sbjct: 161 KQRIRKVPGIPLMSVGGHSYVIEKL 185

>Smik_16.274 Chr16 (504633..508007) [3375 bp, 1124 aa] {ON} YPR030W
           (REAL)
          Length = 1124

 Score = 32.0 bits (71), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 50/114 (43%), Gaps = 24/114 (21%)

Query: 99  PADCIESVVDINGA---NKHRYVV---------ASQDIGLRRKLRNVPGVPLIHLTRSVM 146
           P+D + +  +I  +   ++HR  V           QD GLRR+      VPL  L+ S  
Sbjct: 105 PSDVVGNCFNITSSYQPDRHRNSVPYSTIDQLHTRQDTGLRRESD---PVPLKKLSNSDD 161

Query: 147 VMEPLSTASAKASKMTEERKLYKGLND-------P--NVDKVQEISEGSGKESV 191
           V++PL T  A  S M   R L   L D       P  N  KV EIS  +  ESV
Sbjct: 162 VVKPLMTHHANNSAMFIGRVLSDYLADRGFIKQMPLYNKKKVLEISIATSAESV 215

>Kwal_23.4584 s23 complement(777438..778709) [1272 bp, 423 aa] {ON}
           YNL199C (GCR2) - Transcription factor [contig 5] FULL
          Length = 423

 Score = 31.6 bits (70), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 14/51 (27%), Positives = 30/51 (58%)

Query: 132 NVPGVPLIHLTRSVMVMEPLSTASAKASKMTEERKLYKGLNDPNVDKVQEI 182
           N+ G+  +H+  S+  +  +++ASA A+     ++ Y G+  P+ D V+E+
Sbjct: 288 NLTGIRPVHINNSINSINGVASASATATNNPMGKRKYVGVGTPDEDAVEEL 338

>SAKL0A06688g Chr1 complement(592893..594236,594303..594617) [1659
           bp, 552 aa] {ON} similar to uniprot|P27697 Saccharomyces
           cerevisiae YGL119W ABC1 Protein required for ubiquinone
           (coenzyme Q) biosynthesis which in turn is required for
           respiratory growth
          Length = 552

 Score = 31.2 bits (69), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 38/66 (57%), Gaps = 4/66 (6%)

Query: 169 KGLNDPNVDKVQEISEGSGKESVTKKRKFGPKAPNPLSVKKKKKAYSTSDEARGKEDTSK 228
           +  +DP  ++ +++SEG+   + + K   GPK+      KK  + YSTS ++  K+  S+
Sbjct: 50  QWFHDPQWNRAKKLSEGARASASSLKHASGPKSTK----KKNVRHYSTSSKSTQKDADSE 105

Query: 229 EKKRRR 234
           + K+++
Sbjct: 106 QTKKQK 111

>TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {ON}
           Anc_6.31 YMR001C
          Length = 798

 Score = 31.2 bits (69), Expect = 2.9,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 31/56 (55%), Gaps = 2/56 (3%)

Query: 12  QLLVYSHTFKFREPYQVLVDNQLVLEC--NGSNFNLPSGLKRTLQADVKVMITQCC 65
           Q L YSH  KF + ++  ++  ++LE   NGS  +L    K   +A+VK M TQ C
Sbjct: 145 QNLRYSHIVKFMDCFEDELNVYILLELCPNGSLMDLLKKRKILTEAEVKFMTTQVC 200

>TPHA0A05210 Chr1 complement(1173573..1175471) [1899 bp, 632 aa]
           {ON} Anc_5.84 YGR241C
          Length = 632

 Score = 30.4 bits (67), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 38/80 (47%), Gaps = 14/80 (17%)

Query: 68  ALYETRNEGAIDLAKQFERRRCNHSFKDPKSPADCIESVVDINGANKHRYVVASQDIGLR 127
           ALY   NEG I L + F       S KD +   D  +S VD+   N  +Y+   + IGL+
Sbjct: 189 ALYNALNEGIITLLESFFEL----SHKDAERTLDLYKSFVDLT-ENVVKYLKIGKSIGLK 243

Query: 128 RKLRNVPGVPLI-HLTRSVM 146
                   +P+I H+T  ++
Sbjct: 244 --------IPVIKHITTKLI 255

>Skud_4.53 Chr4 (91849..93033) [1185 bp, 394 aa] {ON} YDL204W (REAL)
          Length = 394

 Score = 30.0 bits (66), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 38/79 (48%), Gaps = 8/79 (10%)

Query: 174 PNVDKVQEISEGSGKE-SVTKKRKFGPKAPNPLSVK-------KKKKAYSTSDEARGKED 225
           P  DK    +  SGK+ SVT KR  G  + +  ++K       + K AYSTS  ++G   
Sbjct: 217 PQTDKDSYSTSVSGKDDSVTHKRNKGDFSTSGHNIKDNSSTSQRSKDAYSTSQYSQGNYP 276

Query: 226 TSKEKKRRRRKHGSHTNSI 244
           TSK +     K G H + I
Sbjct: 277 TSKSEDISTLKSGKHESPI 295

>ZYRO0A07480g Chr1 (609274..614082) [4809 bp, 1602 aa] {ON} similar to
            uniprot|Q12674 Saccharomyces cerevisiae YMR162C DNF3
            Non-essential P-type ATPase that is a potential
            aminophospholipid translocase localizes to the
            trans-Golgi likely involved in protein transport
          Length = 1602

 Score = 30.0 bits (66), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 37/73 (50%), Gaps = 11/73 (15%)

Query: 188  KESVTKKRKFGP-----------KAPNPLSVKKKKKAYSTSDEARGKEDTSKEKKRRRRK 236
            K+ + KK +FG            + P+ LSV K K   S+   A  ++ ++KE    + K
Sbjct: 1465 KDEIRKKLEFGAYNEMKQGWTWERDPSTLSVYKDKVFPSSRSRANSQQSSNKEGSSHKNK 1524

Query: 237  HGSHTNSITNRTT 249
            H ++++++ + TT
Sbjct: 1525 HNNNSDTLVSETT 1537

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.129    0.360 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 26,028,903
Number of extensions: 1105336
Number of successful extensions: 6489
Number of sequences better than 10.0: 235
Number of HSP's gapped: 6171
Number of HSP's successfully gapped: 349
Length of query: 251
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 144
Effective length of database: 41,212,137
Effective search space: 5934547728
Effective search space used: 5934547728
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 64 (29.3 bits)