Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_15.1726.14ON47847825530.0
YOR003W (YSP3)6.14ON47847820510.0
Suva_15.1786.14ON47647819310.0
Skud_15.1646.14ON48247819290.0
Kwal_56.223876.14ON54349613630.0
Suva_5.76.14ON66441813451e-180
SAKL0E01012g6.14ON54449313311e-180
Skud_5.296.14ON60841713361e-180
KLTH0C11396g6.14ON55042713291e-180
Smik_5.276.14ON60841813341e-180
YEL060C (PRB1)6.14ON63541813311e-179
NCAS0F002206.14ON69541612971e-173
KLLA0D00979g6.14ON56141912841e-173
TBLA0A073006.14ON57342012681e-170
TDEL0G045506.14ON56441512481e-167
ACR012C6.14ON54142112221e-163
Kpol_1032.56.14ON68042512301e-163
NDAI0K028806.14ON70441912311e-163
ZYRO0C07942g6.14ON54851012061e-161
CAGL0B03619g6.14ON46841811931e-160
Ecym_30186.14ON57542011991e-160
KAFR0L003606.14ON50242911711e-156
KNAG0E009206.14ON53141011601e-154
Kpol_1045.756.14ON47742311481e-153
CAGL0E02651g6.14ON48542710531e-139
TPHA0M002306.14ON58541210591e-138
KAFR0B065506.14ON45635110291e-136
NCAS0D026306.14ON45142310031e-132
NDAI0I022806.14ON4824269071e-117
KNAG0F02970singletonON4203208781e-113
CAGL0L13266gsingletonON5794297075e-86
NCAS0D043906.313ON4923865515e-64
ZYRO0D08822g6.313ON4903915462e-63
Suva_3.846.313ON5273915413e-62
SAKL0A02002g6.313ON4793645366e-62
KLTH0A06094g6.313ON4963235367e-62
YCR045C (RRT12)6.313ON4913225272e-60
Smik_3.1496.313ON4913245262e-60
Kpol_1028.616.313ON5183185222e-59
Kpol_1018.56.313ON4653225163e-59
TDEL0A072806.313ON4363185126e-59
KNAG0I024706.313ON4753935094e-58
Skud_3.1246.313ON5403185101e-57
Kwal_23.61836.313ON4933144992e-56
TBLA0F039706.313ON7343195085e-56
KAFR0J024506.313ON4783564955e-56
Ecym_21056.313ON6103124931e-54
CAGL0L10802g6.313ON5173404853e-54
NDAI0I005606.313ON4833984833e-54
KLLA0F06028g6.313ON5083214782e-53
AAR069W6.313ON7683194893e-53
TPHA0D037606.313ON6073214422e-47
Kwal_33.133721.78ON3772933836e-41
TBLA0A067006.313ON4972673853e-40
KLTH0F02288g1.78ON3803323634e-38
Kpol_2000.691.78ON3863073242e-32
TPHA0B045201.78ON3883363162e-31
ZYRO0F16764g1.78ON3863393135e-31
TBLA0A054101.78ON3823692792e-26
TDEL0C062301.78ON3643502535e-23
NDAI0F038902.6ON8332941126e-05
Smik_14.972.6ON8142591117e-05
Suva_14.1062.6ON8092591082e-04
YNL238W (KEX2)2.6ON8142581045e-04
Kwal_56.248002.6ON8032511029e-04
NCAS0A008802.6ON8334651000.001
Skud_14.1012.6ON8192591000.002
TBLA0B001302.6ON842277980.002
KAFR0A080402.6ON766256970.003
SAKL0G00440g2.6ON836255960.004
KLLA0D19811g2.6ON756249920.013
ZYRO0F15598g2.6ON790103910.016
Ecym_64862.6ON781100890.026
KLTH0H00418g2.6ON811251880.042
KNAG0F007702.6ON826136870.047
TBLA0A026605.457ON938124850.082
Kpol_1015.82.6ON843102780.65
ABL203W2.6ON76882751.3
KAFR0I017302.571ON400155714.0
ZYRO0A03278g3.257ON91154705.3
TPHA0P017902.6ON799253696.6
Kwal_55.204643.455ON1189124696.6
TBLA0G030603.257ON93893697.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_15.172
         (478 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_15.172 Chr15 (298772..300208) [1437 bp, 478 aa] {ON} YOR003...   988   0.0  
YOR003W Chr15 (331455..332891) [1437 bp, 478 aa] {ON}  YSP3Putat...   794   0.0  
Suva_15.178 Chr15 (305907..307337) [1431 bp, 476 aa] {ON} YOR003...   748   0.0  
Skud_15.164 Chr15 (291471..292919) [1449 bp, 482 aa] {ON} YOR003...   747   0.0  
Kwal_56.22387 s56 (107327..108958) [1632 bp, 543 aa] {ON} YEL060...   529   0.0  
Suva_5.7 Chr5 complement(15849..17843) [1995 bp, 664 aa] {ON} YE...   522   e-180
SAKL0E01012g Chr5 (75498..77132) [1635 bp, 544 aa] {ON} similar ...   517   e-180
Skud_5.29 Chr5 complement(39160..40986) [1827 bp, 608 aa] {ON} Y...   519   e-180
KLTH0C11396g Chr3 complement(936878..938530) [1653 bp, 550 aa] {...   516   e-180
Smik_5.27 Chr5 complement(42408..44234) [1827 bp, 608 aa] {ON} Y...   518   e-180
YEL060C Chr5 complement(40046..41953) [1908 bp, 635 aa] {ON}  PR...   517   e-179
NCAS0F00220 Chr6 (32791..34878) [2088 bp, 695 aa] {ON} Anc_6.14 ...   504   e-173
KLLA0D00979g Chr4 (86703..88388) [1686 bp, 561 aa] {ON} similar ...   499   e-173
TBLA0A07300 Chr1 complement(1815683..1817404) [1722 bp, 573 aa] ...   493   e-170
TDEL0G04550 Chr7 complement(829468..831162) [1695 bp, 564 aa] {O...   485   e-167
ACR012C Chr3 complement(378750..380375) [1626 bp, 541 aa] {ON} S...   475   e-163
Kpol_1032.5 s1032 (6368..8410) [2043 bp, 680 aa] {ON} (6368..841...   478   e-163
NDAI0K02880 Chr11 complement(651446..653560) [2115 bp, 704 aa] {...   478   e-163
ZYRO0C07942g Chr3 complement(605044..606690) [1647 bp, 548 aa] {...   469   e-161
CAGL0B03619g Chr2 (361572..362978) [1407 bp, 468 aa] {ON} simila...   464   e-160
Ecym_3018 Chr3 (33738..35465) [1728 bp, 575 aa] {ON} similar to ...   466   e-160
KAFR0L00360 Chr12 (64781..66289) [1509 bp, 502 aa] {ON} Anc_6.14...   455   e-156
KNAG0E00920 Chr5 complement(174432..176027) [1596 bp, 531 aa] {O...   451   e-154
Kpol_1045.75 s1045 complement(174970..176403) [1434 bp, 477 aa] ...   446   e-153
CAGL0E02651g Chr5 (251868..253325) [1458 bp, 485 aa] {ON} simila...   410   e-139
TPHA0M00230 Chr13 (45121..46878) [1758 bp, 585 aa] {ON} Anc_6.14...   412   e-138
KAFR0B06550 Chr2 (1359770..1361140) [1371 bp, 456 aa] {ON} Anc_6...   400   e-136
NCAS0D02630 Chr4 (506222..507577) [1356 bp, 451 aa] {ON} Anc_6.14     390   e-132
NDAI0I02280 Chr9 complement(519169..520617) [1449 bp, 482 aa] {O...   353   e-117
KNAG0F02970 Chr6 (563666..564928) [1263 bp, 420 aa] {ON}              342   e-113
CAGL0L13266g Chr12 (1418408..1420147) [1740 bp, 579 aa] {ON} som...   276   5e-86
NCAS0D04390 Chr4 complement(836796..838274) [1479 bp, 492 aa] {O...   216   5e-64
ZYRO0D08822g Chr4 (754340..755812) [1473 bp, 490 aa] {ON} simila...   214   2e-63
Suva_3.84 Chr3 complement(121533..123116) [1584 bp, 527 aa] {ON}...   213   3e-62
SAKL0A02002g Chr1 (176105..177544) [1440 bp, 479 aa] {ON} simila...   211   6e-62
KLTH0A06094g Chr1 complement(513667..515157) [1491 bp, 496 aa] {...   211   7e-62
YCR045C Chr3 complement(208135..209610) [1476 bp, 491 aa] {ON}  ...   207   2e-60
Smik_3.149 Chr3 complement(206258..207733) [1476 bp, 491 aa] {ON...   207   2e-60
Kpol_1028.61 s1028 (138312..139868) [1557 bp, 518 aa] {ON} (1383...   205   2e-59
Kpol_1018.5 s1018 (14365..15762) [1398 bp, 465 aa] {ON} (14365.....   203   3e-59
TDEL0A07280 Chr1 complement(1276408..1277718) [1311 bp, 436 aa] ...   201   6e-59
KNAG0I02470 Chr9 complement(479068..480495) [1428 bp, 475 aa] {O...   200   4e-58
Skud_3.124 Chr3 complement(192464..194086) [1623 bp, 540 aa] {ON...   201   1e-57
Kwal_23.6183 s23 complement(1485143..1486624) [1482 bp, 493 aa] ...   196   2e-56
TBLA0F03970 Chr6 complement(985334..987538) [2205 bp, 734 aa] {O...   200   5e-56
KAFR0J02450 Chr10 complement(469452..470888) [1437 bp, 478 aa] {...   195   5e-56
Ecym_2105 Chr2 (185014..186846) [1833 bp, 610 aa] {ON} similar t...   194   1e-54
CAGL0L10802g Chr12 complement(1159230..1160783) [1554 bp, 517 aa...   191   3e-54
NDAI0I00560 Chr9 (114935..116386) [1452 bp, 483 aa] {ON} Anc_6.313    190   3e-54
KLLA0F06028g Chr6 (576687..578213) [1527 bp, 508 aa] {ON} some s...   188   2e-53
AAR069W Chr1 (460781..463087) [2307 bp, 768 aa] {ON} Syntenic ho...   192   3e-53
TPHA0D03760 Chr4 complement(792115..793938) [1824 bp, 607 aa] {O...   174   2e-47
Kwal_33.13372 s33 (190864..191997) [1134 bp, 377 aa] {ON} YCR045...   152   6e-41
TBLA0A06700 Chr1 (1634983..1636476) [1494 bp, 497 aa] {ON} Anc_6...   152   3e-40
KLTH0F02288g Chr6 (186895..188037) [1143 bp, 380 aa] {ON} weakly...   144   4e-38
Kpol_2000.69 s2000 complement(151054..152214) [1161 bp, 386 aa] ...   129   2e-32
TPHA0B04520 Chr2 complement(1065861..1067027) [1167 bp, 388 aa] ...   126   2e-31
ZYRO0F16764g Chr6 complement(1390437..1391597) [1161 bp, 386 aa]...   125   5e-31
TBLA0A05410 Chr1 (1328472..1329620) [1149 bp, 382 aa] {ON} Anc_1...   112   2e-26
TDEL0C06230 Chr3 complement(1135740..1136834) [1095 bp, 364 aa] ...   102   5e-23
NDAI0F03890 Chr6 complement(921561..924062) [2502 bp, 833 aa] {O...    48   6e-05
Smik_14.97 Chr14 (181672..184116) [2445 bp, 814 aa] {ON} YNL238W...    47   7e-05
Suva_14.106 Chr14 (196428..198857) [2430 bp, 809 aa] {ON} YNL238...    46   2e-04
YNL238W Chr14 (202428..204872) [2445 bp, 814 aa] {ON}  KEX2Subti...    45   5e-04
Kwal_56.24800 s56 complement(1150009..1152420) [2412 bp, 803 aa]...    44   9e-04
NCAS0A00880 Chr1 (173726..176227) [2502 bp, 833 aa] {ON} Anc_2.6...    43   0.001
Skud_14.101 Chr14 (191111..193570) [2460 bp, 819 aa] {ON} YNL238...    43   0.002
TBLA0B00130 Chr2 (12377..14905) [2529 bp, 842 aa] {ON} Anc_2.6 Y...    42   0.002
KAFR0A08040 Chr1 complement(1609550..1611850) [2301 bp, 766 aa] ...    42   0.003
SAKL0G00440g Chr7 (41016..43526) [2511 bp, 836 aa] {ON} similar ...    42   0.004
KLLA0D19811g Chr4 complement(1672338..1674608) [2271 bp, 756 aa]...    40   0.013
ZYRO0F15598g Chr6 complement(1278928..1281300) [2373 bp, 790 aa]...    40   0.016
Ecym_6486 Chr6 complement(941694..944039) [2346 bp, 781 aa] {ON}...    39   0.026
KLTH0H00418g Chr8 (46022..48457) [2436 bp, 811 aa] {ON} similar ...    39   0.042
KNAG0F00770 Chr6 (137641..140121) [2481 bp, 826 aa] {ON} Anc_2.6...    38   0.047
TBLA0A02660 Chr1 (645270..648086) [2817 bp, 938 aa] {ON} Anc_5.4...    37   0.082
Kpol_1015.8 s1015 complement(19725..20576,20692..20940,20990..20...    35   0.65 
ABL203W Chr2 (26256..28562) [2307 bp, 768 aa] {ON} Syntenic homo...    33   1.3  
KAFR0I01730 Chr9 (351397..352599) [1203 bp, 400 aa] {ON} Anc_2.5...    32   4.0  
ZYRO0A03278g Chr1 (264444..267179) [2736 bp, 911 aa] {ON} simila...    32   5.3  
TPHA0P01790 Chr16 complement(373247..375646) [2400 bp, 799 aa] {...    31   6.6  
Kwal_55.20464 s55 complement(414783..418352) [3570 bp, 1189 aa] ...    31   6.6  
TBLA0G03060 Chr7 complement(808675..811491) [2817 bp, 938 aa] {O...    31   7.3  

>Smik_15.172 Chr15 (298772..300208) [1437 bp, 478 aa] {ON} YOR003W
           (REAL)
          Length = 478

 Score =  988 bits (2553), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 478/478 (100%), Positives = 478/478 (100%)

Query: 1   MKFSTILPILWASCNLCMIIPEFDEIVRFTQITDDSRNTKSLKNLRQQYSGGFLMGGLDN 60
           MKFSTILPILWASCNLCMIIPEFDEIVRFTQITDDSRNTKSLKNLRQQYSGGFLMGGLDN
Sbjct: 1   MKFSTILPILWASCNLCMIIPEFDEIVRFTQITDDSRNTKSLKNLRQQYSGGFLMGGLDN 60

Query: 61  THKTELIPYRYIVVFNEDISIKSIESHRKMVQEAHSVSVSKLAEDDVFLEVVSSSIAPDL 120
           THKTELIPYRYIVVFNEDISIKSIESHRKMVQEAHSVSVSKLAEDDVFLEVVSSSIAPDL
Sbjct: 61  THKTELIPYRYIVVFNEDISIKSIESHRKMVQEAHSVSVSKLAEDDVFLEVVSSSIAPDL 120

Query: 121 QLGGIDSSFDINGLFRGYAGYFTDEILNLVSQDPLIKFIEQESTVRLSNTSMQKDAPWGL 180
           QLGGIDSSFDINGLFRGYAGYFTDEILNLVSQDPLIKFIEQESTVRLSNTSMQKDAPWGL
Sbjct: 121 QLGGIDSSFDINGLFRGYAGYFTDEILNLVSQDPLIKFIEQESTVRLSNTSMQKDAPWGL 180

Query: 181 HRISHREKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDTEHEDFEGRAVWGAVIPGNDEAS 240
           HRISHREKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDTEHEDFEGRAVWGAVIPGNDEAS
Sbjct: 181 HRISHREKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDTEHEDFEGRAVWGAVIPGNDEAS 240

Query: 241 DLNGHGTHCAGIIGSKHYGVAKNTKLVAVKVLRSNGEGTVSDVIKGIEYVAREHIESSRK 300
           DLNGHGTHCAGIIGSKHYGVAKNTKLVAVKVLRSNGEGTVSDVIKGIEYVAREHIESSRK
Sbjct: 241 DLNGHGTHCAGIIGSKHYGVAKNTKLVAVKVLRSNGEGTVSDVIKGIEYVAREHIESSRK 300

Query: 301 KSKEFKGSTANLSLGSSKSLAMEMAVDAAVDSGVHFAIAAGNENEDACLSSPAGAQKSIT 360
           KSKEFKGSTANLSLGSSKSLAMEMAVDAAVDSGVHFAIAAGNENEDACLSSPAGAQKSIT
Sbjct: 301 KSKEFKGSTANLSLGSSKSLAMEMAVDAAVDSGVHFAIAAGNENEDACLSSPAGAQKSIT 360

Query: 361 VGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGMLSYF 420
           VGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGMLSYF
Sbjct: 361 VGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGMLSYF 420

Query: 421 LSLQPAPDSEYFDNALSPQELKEKVLKFSTHGVLGDIGDNTPNRLIYNGGGKILDDLW 478
           LSLQPAPDSEYFDNALSPQELKEKVLKFSTHGVLGDIGDNTPNRLIYNGGGKILDDLW
Sbjct: 421 LSLQPAPDSEYFDNALSPQELKEKVLKFSTHGVLGDIGDNTPNRLIYNGGGKILDDLW 478

>YOR003W Chr15 (331455..332891) [1437 bp, 478 aa] {ON}  YSP3Putative
           precursor to the subtilisin-like protease III
          Length = 478

 Score =  794 bits (2051), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/478 (79%), Positives = 430/478 (89%)

Query: 1   MKFSTILPILWASCNLCMIIPEFDEIVRFTQITDDSRNTKSLKNLRQQYSGGFLMGGLDN 60
           MKFSTILPILWA+C LCMIIP+FD IVRF +  D +R+ ++ + L Q   G F       
Sbjct: 1   MKFSTILPILWANCCLCMIIPDFDGIVRFIENIDGTRSVRAGEGLGQHDPGNFHTEHQHV 60

Query: 61  THKTELIPYRYIVVFNEDISIKSIESHRKMVQEAHSVSVSKLAEDDVFLEVVSSSIAPDL 120
            HKTE +PYRY++VFNEDIS++ I+SH ++VQ+ HS SV KL E+D F  V+SSS++   
Sbjct: 61  AHKTEFLPYRYVIVFNEDISLQQIQSHMQVVQKDHSTSVGKLTENDAFWRVISSSVSSKS 120

Query: 121 QLGGIDSSFDINGLFRGYAGYFTDEILNLVSQDPLIKFIEQESTVRLSNTSMQKDAPWGL 180
           Q GGID+ FDINGLFRGY GYFTDEI+ ++SQDP+IKF+EQE+TV++SN+S+Q++APWGL
Sbjct: 121 QFGGIDNFFDINGLFRGYTGYFTDEIIKIISQDPIIKFVEQETTVKISNSSLQEEAPWGL 180

Query: 181 HRISHREKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDTEHEDFEGRAVWGAVIPGNDEAS 240
           HR+SHREK KYGQDLEYLYEDAAG+GVTSYVLDTGIDTEHEDFEGRA WGAVIP NDEAS
Sbjct: 181 HRVSHREKPKYGQDLEYLYEDAAGKGVTSYVLDTGIDTEHEDFEGRAEWGAVIPANDEAS 240

Query: 241 DLNGHGTHCAGIIGSKHYGVAKNTKLVAVKVLRSNGEGTVSDVIKGIEYVAREHIESSRK 300
           DLNGHGTHCAGIIGSKH+GVAKNTK+VAVKVLRSNGEGTVSDVIKGIEYV +EHIESS+K
Sbjct: 241 DLNGHGTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGEGTVSDVIKGIEYVTKEHIESSKK 300

Query: 301 KSKEFKGSTANLSLGSSKSLAMEMAVDAAVDSGVHFAIAAGNENEDACLSSPAGAQKSIT 360
           K+KEFKGSTANLSLGSSKSLAMEMAV+AAVDSGVHFAIAAGNE+EDACLSSPAGA+KSIT
Sbjct: 301 KNKEFKGSTANLSLGSSKSLAMEMAVNAAVDSGVHFAIAAGNEDEDACLSSPAGAEKSIT 360

Query: 361 VGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGMLSYF 420
           VGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMA+PHVAG+LSYF
Sbjct: 361 VGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMASPHVAGILSYF 420

Query: 421 LSLQPAPDSEYFDNALSPQELKEKVLKFSTHGVLGDIGDNTPNRLIYNGGGKILDDLW 478
           LSLQPAPDSE+F++A SPQELKEKVLKFST GVLGDIGD+TPN+LIYNGGGK LD  W
Sbjct: 421 LSLQPAPDSEFFNDAPSPQELKEKVLKFSTQGVLGDIGDDTPNKLIYNGGGKKLDGFW 478

>Suva_15.178 Chr15 (305907..307337) [1431 bp, 476 aa] {ON} YOR003W
           (REAL)
          Length = 476

 Score =  748 bits (1931), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/478 (74%), Positives = 413/478 (86%), Gaps = 2/478 (0%)

Query: 1   MKFSTILPILWASCNLCMIIPEFDEIVRFTQITDDSRNTKSLKNLRQQYSGGFLMGGLDN 60
           MK  T+L  L A C +CMIIP  DEIV  T+  +D RN K  + L QQ +G F +     
Sbjct: 1   MKLLTVLLALCAGCGVCMIIPGLDEIVYLTESIEDFRNAKGQEGLGQQETGNFHLQEPKV 60

Query: 61  THKTELIPYRYIVVFNEDISIKSIESHRKMVQEAHSVSVSKLAEDDVFLEVVSSSIAPDL 120
            +K E +PYRYI+ F+ED S++SIESH++M+QE  + SVSKLA+DD F   VS+S   DL
Sbjct: 61  VYKAESLPYRYIIAFHEDSSVRSIESHKRMIQEVQNESVSKLAKDDAFF--VSTSAPSDL 118

Query: 121 QLGGIDSSFDINGLFRGYAGYFTDEILNLVSQDPLIKFIEQESTVRLSNTSMQKDAPWGL 180
           Q GGIDS FDINGLFRGY GYFT+E++  V QDP+IKFIEQESTV+++N++ Q++APWGL
Sbjct: 119 QFGGIDSFFDINGLFRGYTGYFTEEVIKRVLQDPIIKFIEQESTVKVTNSTFQEEAPWGL 178

Query: 181 HRISHREKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDTEHEDFEGRAVWGAVIPGNDEAS 240
           HRISHREKAKYGQDLEYLYEDAAGRGVTSYVLDTGID  HEDFEGRAVWGAVIP NDEAS
Sbjct: 179 HRISHREKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDINHEDFEGRAVWGAVIPDNDEAS 238

Query: 241 DLNGHGTHCAGIIGSKHYGVAKNTKLVAVKVLRSNGEGTVSDVIKGIEYVAREHIESSRK 300
           DLNGHGTHCAGIIGS+H+GV KNT LVAVKVLRSNGEGTVSDVIKGIEYV ++HI+SS+K
Sbjct: 239 DLNGHGTHCAGIIGSRHFGVTKNTNLVAVKVLRSNGEGTVSDVIKGIEYVVKDHIDSSKK 298

Query: 301 KSKEFKGSTANLSLGSSKSLAMEMAVDAAVDSGVHFAIAAGNENEDACLSSPAGAQKSIT 360
              +FKGSTANLSLGSSKS AMEMAV+AAV+SGVHFAIAAGNE+EDACLSSPAGA+KSIT
Sbjct: 299 GGPKFKGSTANLSLGSSKSPAMEMAVNAAVESGVHFAIAAGNEDEDACLSSPAGAEKSIT 358

Query: 361 VGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGMLSYF 420
           VGASTFSDDRAFFS+WGTCVDVFAPG+NI+STYIGSRNA+LSLSGTSMAAPHVAG+LSYF
Sbjct: 359 VGASTFSDDRAFFSDWGTCVDVFAPGVNILSTYIGSRNASLSLSGTSMAAPHVAGILSYF 418

Query: 421 LSLQPAPDSEYFDNALSPQELKEKVLKFSTHGVLGDIGDNTPNRLIYNGGGKILDDLW 478
           LSLQP+ DSE+FD+ +SPQ+LKEK++ FST GVLGD+G++TPNRLIYNGGG+ LD+ W
Sbjct: 419 LSLQPSSDSEFFDSTVSPQQLKEKIINFSTQGVLGDVGEDTPNRLIYNGGGRKLDNFW 476

>Skud_15.164 Chr15 (291471..292919) [1449 bp, 482 aa] {ON} YOR003W
           (REAL)
          Length = 482

 Score =  747 bits (1929), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/478 (74%), Positives = 408/478 (85%)

Query: 1   MKFSTILPILWASCNLCMIIPEFDEIVRFTQITDDSRNTKSLKNLRQQYSGGFLMGGLDN 60
           MK   IL IL A   LCMIIPE +EI  +++  ++ RN K+   L QQ      +G    
Sbjct: 3   MKLFNILLILCAGGTLCMIIPELNEIAYYSETFENFRNAKAQDGLGQQNIENLHLGRQKV 62

Query: 61  THKTELIPYRYIVVFNEDISIKSIESHRKMVQEAHSVSVSKLAEDDVFLEVVSSSIAPDL 120
              ++ +PYRYI+VFNEDI+ + IESH +M+Q+A  VSVSK+ EDD FL  VS+S +P+ 
Sbjct: 63  LRGSKSLPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTVSASASPNP 122

Query: 121 QLGGIDSSFDINGLFRGYAGYFTDEILNLVSQDPLIKFIEQESTVRLSNTSMQKDAPWGL 180
           Q GGID SFDINGLFRGY GYFTDE++ +V QDPL+KFIE ESTVR+SN+S Q+DAPWGL
Sbjct: 123 QFGGIDISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPWGL 182

Query: 181 HRISHREKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDTEHEDFEGRAVWGAVIPGNDEAS 240
           HRISHRE+AKYGQDLEYLYEDAAG GVTSYVLDTGIDTEHEDFEGRA WGAVIP NDEAS
Sbjct: 183 HRISHRERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDEAS 242

Query: 241 DLNGHGTHCAGIIGSKHYGVAKNTKLVAVKVLRSNGEGTVSDVIKGIEYVAREHIESSRK 300
           DLNGHGTHCAGIIGS+H+GVAKNT ++AVKVLRSNGEGTVSDVIKGIEYVA+ HI SS+K
Sbjct: 243 DLNGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIASSKK 302

Query: 301 KSKEFKGSTANLSLGSSKSLAMEMAVDAAVDSGVHFAIAAGNENEDACLSSPAGAQKSIT 360
           +  +FKGSTANLSLGSSKS AMEMAV+AAVD GVHFAIAAGNE+EDACLSSPAGA+KSIT
Sbjct: 303 RGSKFKGSTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKSIT 362

Query: 361 VGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGMLSYF 420
           VGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAG+LSY 
Sbjct: 363 VGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGILSYL 422

Query: 421 LSLQPAPDSEYFDNALSPQELKEKVLKFSTHGVLGDIGDNTPNRLIYNGGGKILDDLW 478
           LSLQPA DSE+F + +SPQ+LKEK+LKFST GVLGD+ + TPNRL+YNGGGK LD+ W
Sbjct: 423 LSLQPAQDSEFFYDTVSPQQLKEKILKFSTRGVLGDVNEETPNRLVYNGGGKKLDEFW 480

>Kwal_56.22387 s56 (107327..108958) [1632 bp, 543 aa] {ON} YEL060C
           (PRB1) - vacuolar protease B [contig 185] FULL
          Length = 543

 Score =  529 bits (1363), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/496 (52%), Positives = 344/496 (69%), Gaps = 18/496 (3%)

Query: 1   MKFSTILPI-LWASCNLCMIIPEFDEIVRFTQITDD-----------SRNTKSLKNLRQQ 48
           MK  T LP+ + A+    +++PE +E  +   +  +           S  +K +     +
Sbjct: 1   MKLQTTLPVAMVAALASALVLPEVEEASKDALVAVEETAASLGESILSSFSKEVTKKAAE 60

Query: 49  YSGGFLMGGLDNTHKT-ELIPYRYIVVFNEDISIKSIESHRKMVQEAHSVSVSKLAEDDV 107
              G  +  L       + IP+RYIVVF + +  + ++ H ++V EAH+ SV KL  +D 
Sbjct: 61  SGAGVTLSPLVTARNMYDAIPHRYIVVFKDRVLPEEVDFHMEVVSEAHAQSVGKLDANDA 120

Query: 108 FLEVV---SSSIAPDLQLGGIDSSFDINGLFRGYAGYFTDEILNLVSQDPLIKFIEQEST 164
           F E        I    + GGI  SFD+NG+ RGY GYFT EI++ +  +PL+ F+EQ+S 
Sbjct: 121 FFEATMDEEMGIMATSREGGILDSFDVNGMLRGYIGYFTQEIVDFIRMNPLVAFVEQDSM 180

Query: 165 VRLSNTSMQKDAPWGLHRISHREKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDTEHEDFE 224
           V  +    Q  APWGL RISHREK   G   +YLY+DAAG+GVTSYV+DTGI+ +H+DFE
Sbjct: 181 VYANEFDTQNGAPWGLSRISHREKLNLGSFNKYLYDDAAGKGVTSYVIDTGINIDHKDFE 240

Query: 225 GRAVWGAVIPGNDEASDLNGHGTHCAGIIGSKHYGVAKNTKLVAVKVLRSNGEGTVSDVI 284
           GRA WG  +P ND   D NGHGTHCAG I SKHYGVAKN  +VAVKVLRSNG G++SDV+
Sbjct: 241 GRAAWGKTVPTNDLDQDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGSMSDVV 300

Query: 285 KGIEYVAREHIESSRKKSKEFKGSTANLSLGSSKSLAMEMAVDAAVDSGVHFAIAAGNEN 344
           KG+E+ A+ H ++ +K  K FKGSTAN+SLG  KS A++MAV+AAV +G+HFA+AAGNEN
Sbjct: 301 KGVEFAAKSHQDAVKKNKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNEN 360

Query: 345 EDACLSSPAGAQKSITVGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLS 404
           +DAC SSPA A+ +ITVGAST +DDRA+FSNWG CVD+FAPG+N++STYIGS  AT +LS
Sbjct: 361 QDACNSSPAAAENAITVGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATATLS 420

Query: 405 GTSMAAPHVAGMLSYFLSLQPAPDSEYFDNA--LSPQELKEKVLKFSTHGVLGDIGDNTP 462
           GTSMA+PHVAG+L+YFLSLQP  DSEYF  A  ++P +LK+K++ +ST   LGD+ ++T 
Sbjct: 421 GTSMASPHVAGLLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNALGDLPEDTV 480

Query: 463 NRLIYNGGGKILDDLW 478
           N LIYNGGG+ LDD W
Sbjct: 481 NYLIYNGGGQDLDDFW 496

>Suva_5.7 Chr5 complement(15849..17843) [1995 bp, 664 aa] {ON}
           YEL060C (REAL)
          Length = 664

 Score =  522 bits (1345), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 246/418 (58%), Positives = 319/418 (76%), Gaps = 3/418 (0%)

Query: 64  TELIPYRYIVVFNEDISIKSIESHRKMVQEAHSVSVSKLAEDDVFLEVVSSSIAPDLQLG 123
           T++IP RYI+VF +D+  +    HR+ VQ+A   SV  LA +D F      +     + G
Sbjct: 204 TKIIPNRYIIVFKKDVPPEEAAFHRETVQQAQLQSVENLAAEDAFFISTRDAALSSSEAG 263

Query: 124 GIDSSFDINGLFRGYAGYFTDEILNLVSQDPLIKFIEQESTVRLSNTSMQKDAPWGLHRI 183
           GI  SF+I+ LF GY GYFT EI++L+ Q+PL+ F+E++S V  ++   Q  APWGL R+
Sbjct: 264 GIQDSFNIDSLFSGYIGYFTQEIVDLIRQNPLVDFVEKDSVVEATDFDTQNSAPWGLARV 323

Query: 184 SHREKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDTEHEDFEGRAVWGAVIPGNDEASDLN 243
           SHRE+   G   +YLY+D AGRGVTSYV+DTG++  H+DFE RA+WG  IP NDE  D N
Sbjct: 324 SHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHKDFEKRAIWGKTIPLNDEDLDGN 383

Query: 244 GHGTHCAGIIGSKHYGVAKNTKLVAVKVLRSNGEGTVSDVIKGIEYVAREHIESSRKKSK 303
           GHGTHCAG I SKHYGVAKN  +VAVKVLRSNG GT+SDV+KG+EY A+ H + + +K K
Sbjct: 384 GHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVLKGVEYAAKAHQKQAEEKKK 443

Query: 304 EFKGSTANLSLGSSKSLAMEMAVDAAVDSGVHFAIAAGNENEDACLSSPAGAQKSITVGA 363
            FKGSTAN+SLG  KS A+++AV+AAV++G+HFA+AAGNEN+DAC +SPA A K+ITVGA
Sbjct: 444 GFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADKAITVGA 503

Query: 364 STFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGMLSYFLSL 423
           ST SDDRA+FSN+G CVDVFAPG+NI+STYIGS  AT +LSGTSMA+PHVAG+L+YFLSL
Sbjct: 504 STLSDDRAYFSNYGKCVDVFAPGLNILSTYIGSDEATATLSGTSMASPHVAGLLTYFLSL 563

Query: 424 QPAPDSEYFD---NALSPQELKEKVLKFSTHGVLGDIGDNTPNRLIYNGGGKILDDLW 478
           QP  DSE+F+   ++L+PQ+LK+K++ +ST  +L DI D+TPN LIYNGGG+ L   W
Sbjct: 564 QPGSDSEFFEMGQDSLTPQQLKKKLIHYSTKDILFDIPDDTPNALIYNGGGQDLSAFW 621

>SAKL0E01012g Chr5 (75498..77132) [1635 bp, 544 aa] {ON} similar to
           uniprot|P09232 Saccharomyces cerevisiae YEL060C PRB1
           Vacuolar proteinase B (yscB) a serine protease of the
           subtilisin family involved in protein degradation in the
           vacuole and required for full protein degradation during
           sporulation
          Length = 544

 Score =  517 bits (1331), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 256/493 (51%), Positives = 344/493 (69%), Gaps = 20/493 (4%)

Query: 4   STILPILWASCNLCM-IIPEFDEI---VRFTQITDDSRNTKSLKNLRQQYSGGFLMGG-- 57
           STILPI   +      +IPE D+    V   +I  DS+    L +  ++ +      G  
Sbjct: 5   STILPIAALTTLAAALVIPEVDKSSKDVSVKEINSDSQEV--LASFAKEITRAAAEKGEE 62

Query: 58  ------LDNTHKTELIPYRYIVVFNEDISIKSIESHRKMVQEAHSVSVSKLAEDDVFLEV 111
                 + +     +IP+RYI+VF +D + + I  H++++ EAH+ SV+KL   D F   
Sbjct: 63  VKLAPLVSSPQPANIIPHRYIIVFKKDATPEEISFHKEIISEAHAESVAKLDSKDSFFAA 122

Query: 112 VSSS-----IAPDLQLGGIDSSFDINGLFRGYAGYFTDEILNLVSQDPLIKFIEQESTVR 166
              S     IA     GGI  SFDI  +  GY GYFTDE+++ +  +  ++FIE++S V 
Sbjct: 123 TKGSADEYGIAAKSSEGGIQESFDIANMLNGYIGYFTDEVVDFIRMNQWVEFIEKDSLVF 182

Query: 167 LSNTSMQKDAPWGLHRISHREKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDTEHEDFEGR 226
            S    Q  APWGL RISHRE+   G   +YLY+D AG+GVTSYV+DTGI+  H+DF GR
Sbjct: 183 ASEFDTQNGAPWGLSRISHRERLNLGSFNKYLYDDDAGKGVTSYVIDTGINVNHKDFNGR 242

Query: 227 AVWGAVIPGNDEASDLNGHGTHCAGIIGSKHYGVAKNTKLVAVKVLRSNGEGTVSDVIKG 286
           AVWG  +P NDE +D NGHGTHCAG I S+HYGVAKN ++VA+KVLRSNG GT+SDV+KG
Sbjct: 243 AVWGKTVPQNDEDADGNGHGTHCAGTIASEHYGVAKNAEVVAIKVLRSNGSGTMSDVVKG 302

Query: 287 IEYVAREHIESSRKKSKEFKGSTANLSLGSSKSLAMEMAVDAAVDSGVHFAIAAGNENED 346
           +E+ A+ H E+S+K  K FKGSTAN+SLG  KS A+++AV+AAV +G+HFA+AAGNEN+D
Sbjct: 303 VEFAAQSHQEASKKNKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQD 362

Query: 347 ACLSSPAGAQKSITVGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGT 406
           AC +SPA A+ +ITVGAST SDDRA+FSNWG CVD+FAPG+N++STYIGS  AT +LSGT
Sbjct: 363 ACNTSPAAAENAITVGASTLSDDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATATLSGT 422

Query: 407 SMAAPHVAGMLSYFLSLQPAPDSEYFD-NALSPQELKEKVLKFSTHGVLGDIGDNTPNRL 465
           SMA+PHVAG+L+YFLSLQP  DSE+F  + ++P +LK+K++ +ST  VL ++ ++TPN L
Sbjct: 423 SMASPHVAGLLTYFLSLQPDSDSEFFQASGITPAQLKKKLIAYSTKDVLYELPEDTPNYL 482

Query: 466 IYNGGGKILDDLW 478
           IYNGGG+ L D W
Sbjct: 483 IYNGGGQDLSDFW 495

>Skud_5.29 Chr5 complement(39160..40986) [1827 bp, 608 aa] {ON}
           YEL060C (REAL)
          Length = 608

 Score =  519 bits (1336), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 241/417 (57%), Positives = 319/417 (76%), Gaps = 3/417 (0%)

Query: 65  ELIPYRYIVVFNEDISIKSIESHRKMVQEAHSVSVSKLAEDDVFLEVVSSSIAPDLQLGG 124
           ++IP RYI+VF + +  ++ + H++ V +A   SV  L+ +D F      S     + GG
Sbjct: 150 KIIPNRYIIVFKKGVPQEATDFHKESVHQAQLQSVENLSAEDAFFISTRDSSLSTSETGG 209

Query: 125 IDSSFDINGLFRGYAGYFTDEILNLVSQDPLIKFIEQESTVRLSNTSMQKDAPWGLHRIS 184
           I  SF+I+ +F GY GYFT EI++L+ Q+PL+ F+E++S V  ++   Q  APWGL RIS
Sbjct: 210 IQDSFNIDNMFSGYIGYFTQEIIDLIRQNPLVDFVERDSVVEATDFDTQNSAPWGLARIS 269

Query: 185 HREKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDTEHEDFEGRAVWGAVIPGNDEASDLNG 244
           HRE+   G   +YLY+D AGRGVTSYV+DTG++  H+DFE RA+WG  IP NDE  D NG
Sbjct: 270 HRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHKDFEKRAIWGKTIPLNDEDLDGNG 329

Query: 245 HGTHCAGIIGSKHYGVAKNTKLVAVKVLRSNGEGTVSDVIKGIEYVAREHIESSRKKSKE 304
           HGTHCAG I SKHYGVAKN  +VAVKVLRSNG GT+SDV+KG+EY AR H + +++K K 
Sbjct: 330 HGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVVKGVEYAARAHQKQAQEKKKG 389

Query: 305 FKGSTANLSLGSSKSLAMEMAVDAAVDSGVHFAIAAGNENEDACLSSPAGAQKSITVGAS 364
           FKGSTAN+SLG  KS A+++AV+AAV++G+HFA+AAGNEN+DAC +SPA A K+ITVGAS
Sbjct: 390 FKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADKAITVGAS 449

Query: 365 TFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGMLSYFLSLQ 424
           T SDDRA+FSNWG CVD+FAPG+NI+STYIGS +AT +LSGTSMA+PHVAG+L+YFLSLQ
Sbjct: 450 TLSDDRAYFSNWGKCVDIFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLTYFLSLQ 509

Query: 425 PAPDSEYFD---NALSPQELKEKVLKFSTHGVLGDIGDNTPNRLIYNGGGKILDDLW 478
           P  DSE+F+   ++L+PQ+LK K++ +ST  +L D+ ++TPN LIYNGGG+ L   W
Sbjct: 510 PGSDSEFFEMGQDSLTPQQLKNKLIHYSTKDILFDVPEDTPNALIYNGGGQDLSAFW 566

>KLTH0C11396g Chr3 complement(936878..938530) [1653 bp, 550 aa] {ON}
           similar to uniprot|P09232 Saccharomyces cerevisiae
           YEL060C PRB1 Vacuolar proteinase B (yscB) a serine
           protease of the subtilisin family involved in protein
           degradation in the vacuole and required for full protein
           degradation during sporulation
          Length = 550

 Score =  516 bits (1329), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 246/427 (57%), Positives = 318/427 (74%), Gaps = 15/427 (3%)

Query: 67  IPYRYIVVFNEDISIKSIESHRKMVQEAHSVSVSKL-------------AEDDVFLEVVS 113
           IP+RYIVVF +++S + ++ H+++V EAH  SV+KL              ED  F     
Sbjct: 79  IPHRYIVVFKQNLSPEEVDFHKQIVSEAHLQSVAKLESTHEFFTSTENFVEDRDFELDYQ 138

Query: 114 SSIAPDLQLGGIDSSFDINGLFRGYAGYFTDEILNLVSQDPLIKFIEQESTVRLSNTSMQ 173
            S +   + GGI  SFD++GL  GY GYFTDEI++ +  +PL+ F+EQ+S V       Q
Sbjct: 139 RSFSAQTREGGIQDSFDVSGLLTGYIGYFTDEIVDFIRMNPLVDFVEQDSVVFAQEFGTQ 198

Query: 174 KDAPWGLHRISHREKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDTEHEDFEGRAVWGAVI 233
             APWGL RISHREK   G   +YLY+D AG+GVTSYV+DTG++ +H+DFEGRA WG  I
Sbjct: 199 NGAPWGLSRISHREKLNLGSFNKYLYDDDAGKGVTSYVIDTGVNVDHKDFEGRASWGKTI 258

Query: 234 PGNDEASDLNGHGTHCAGIIGSKHYGVAKNTKLVAVKVLRSNGEGTVSDVIKGIEYVARE 293
           P ND   D NGHGTHCAG I SKHYGVAKN  +VAVKVLRSNG G++SDV+KG+E+ A+ 
Sbjct: 259 PTNDLDQDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGSMSDVVKGVEFAAKS 318

Query: 294 HIESSRKKSKEFKGSTANLSLGSSKSLAMEMAVDAAVDSGVHFAIAAGNENEDACLSSPA 353
           H ++ ++  K FKGSTAN+SLG  KS A++MAV+AAV +G+HFA+AAGNEN+DAC SSPA
Sbjct: 319 HQDAVKENKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSPA 378

Query: 354 GAQKSITVGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHV 413
            A+ ++TVGAST +DDRA+FSNWG CVD+FAPG+N++STYIGS  AT +LSGTSMA+PHV
Sbjct: 379 SAENAVTVGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIGSDTATATLSGTSMASPHV 438

Query: 414 AGMLSYFLSLQPAPDSEYFDNA--LSPQELKEKVLKFSTHGVLGDIGDNTPNRLIYNGGG 471
           AG+L+YFLSLQP  DSEYF  A  ++P +LK+K++ +ST  VLGDI D+T N LI+NGGG
Sbjct: 439 AGLLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNVLGDIPDDTVNYLIFNGGG 498

Query: 472 KILDDLW 478
           + LDD W
Sbjct: 499 EGLDDFW 505

>Smik_5.27 Chr5 complement(42408..44234) [1827 bp, 608 aa] {ON}
           YEL060C (REAL)
          Length = 608

 Score =  518 bits (1334), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 242/418 (57%), Positives = 318/418 (76%), Gaps = 3/418 (0%)

Query: 64  TELIPYRYIVVFNEDISIKSIESHRKMVQEAHSVSVSKLAEDDVFLEVVSSSIAPDLQLG 123
           +++IP RYIVVF + +  + +  H++ V +A   SV  L+ +D F      +     + G
Sbjct: 149 SKIIPNRYIVVFKKGVPEEEVNFHKESVHQAQLQSVENLSAEDAFFTSTRDTYLSTSEAG 208

Query: 124 GIDSSFDINGLFRGYAGYFTDEILNLVSQDPLIKFIEQESTVRLSNTSMQKDAPWGLHRI 183
           GI  SF+I+ +F GY GYFT EI++L+ Q+PL+ F+E++S V  +    Q  APWGL RI
Sbjct: 209 GIQDSFNIDNIFSGYIGYFTQEIIDLIRQNPLVDFVERDSVVEATEFDTQNSAPWGLARI 268

Query: 184 SHREKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDTEHEDFEGRAVWGAVIPGNDEASDLN 243
           SHRE+   G   +YLY+D AGRGVTSYV+DTG++  H+DFE RA+WG  IP NDE  D N
Sbjct: 269 SHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDEDLDGN 328

Query: 244 GHGTHCAGIIGSKHYGVAKNTKLVAVKVLRSNGEGTVSDVIKGIEYVAREHIESSRKKSK 303
           GHGTHCAG I SKHYGVAKN  +VAVKVLRSNG GT+SDV+KG+EY A+ H + +++K K
Sbjct: 329 GHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVVKGVEYAAKAHQKQAQEKKK 388

Query: 304 EFKGSTANLSLGSSKSLAMEMAVDAAVDSGVHFAIAAGNENEDACLSSPAGAQKSITVGA 363
            FKGSTAN+SLG  KS A+++AV+AAV++G+HFA+AAGNEN+DAC +SPA A K+ITVGA
Sbjct: 389 GFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADKAITVGA 448

Query: 364 STFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGMLSYFLSL 423
           ST SDDRA+FSNWG CVDVFAPG+NI+STYIGS  AT +LSGTSMA+PHVAG+L+YFLSL
Sbjct: 449 STLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDEATATLSGTSMASPHVAGLLTYFLSL 508

Query: 424 QPAPDSEYFD---NALSPQELKEKVLKFSTHGVLGDIGDNTPNRLIYNGGGKILDDLW 478
           QP  DSE+F+   ++L+PQ+LK+K++ +ST  +L DI ++TPN LIYNGGG+ L   W
Sbjct: 509 QPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPEDTPNFLIYNGGGQDLSAFW 566

>YEL060C Chr5 complement(40046..41953) [1908 bp, 635 aa] {ON}
           PRB1Vacuolar proteinase B (yscB), a serine protease of
           the subtilisin family; involved in protein degradation
           in the vacuole and required for full protein degradation
           during sporulation; activity inhibited by Pbi2p
          Length = 635

 Score =  517 bits (1331), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 244/418 (58%), Positives = 318/418 (76%), Gaps = 3/418 (0%)

Query: 64  TELIPYRYIVVFNEDISIKSIESHRKMVQEAHSVSVSKLAEDDVFLEVVSSSIAPDLQLG 123
           +++IP RYI+VF      + I+ H++ VQ+A   SV  L+ +D F      +     + G
Sbjct: 176 SKIIPNRYIIVFKRGAPQEEIDFHKENVQQAQLQSVENLSAEDAFFISTKDTSLSTSEAG 235

Query: 124 GIDSSFDINGLFRGYAGYFTDEILNLVSQDPLIKFIEQESTVRLSNTSMQKDAPWGLHRI 183
           GI  SF+I+ LF GY GYFT EI++L+ Q+PL+ F+E++S V  +    Q  APWGL RI
Sbjct: 236 GIQDSFNIDNLFSGYIGYFTQEIVDLIRQNPLVDFVERDSIVEATEFDTQNSAPWGLARI 295

Query: 184 SHREKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDTEHEDFEGRAVWGAVIPGNDEASDLN 243
           SHRE+   G   +YLY+D AGRGVTSYV+DTG++  H+DFE RA+WG  IP NDE  D N
Sbjct: 296 SHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDEDLDGN 355

Query: 244 GHGTHCAGIIGSKHYGVAKNTKLVAVKVLRSNGEGTVSDVIKGIEYVAREHIESSRKKSK 303
           GHGTHCAG I SKHYGVAKN  +VAVKVLRSNG GT+SDV+KG+EY A+ H + +++K K
Sbjct: 356 GHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVVKGVEYAAKAHQKEAQEKKK 415

Query: 304 EFKGSTANLSLGSSKSLAMEMAVDAAVDSGVHFAIAAGNENEDACLSSPAGAQKSITVGA 363
            FKGSTAN+SLG  KS A+++AV+AAV+ G+HFA+AAGNEN+DAC +SPA A K+ITVGA
Sbjct: 416 GFKGSTANMSLGGGKSPALDLAVNAAVEVGIHFAVAAGNENQDACNTSPASADKAITVGA 475

Query: 364 STFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGMLSYFLSL 423
           ST SDDRA+FSNWG CVDVFAPG+NI+STYIGS +AT +LSGTSMA+PHVAG+L+YFLSL
Sbjct: 476 STLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLTYFLSL 535

Query: 424 QPAPDSEYFD---NALSPQELKEKVLKFSTHGVLGDIGDNTPNRLIYNGGGKILDDLW 478
           QP  DSE+F+   ++L+PQ+LK+K++ +ST  +L DI ++TPN LIYNGGG+ L   W
Sbjct: 536 QPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPEDTPNVLIYNGGGQDLSAFW 593

>NCAS0F00220 Chr6 (32791..34878) [2088 bp, 695 aa] {ON} Anc_6.14
           YEL060C
          Length = 695

 Score =  504 bits (1297), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 238/416 (57%), Positives = 321/416 (77%), Gaps = 6/416 (1%)

Query: 66  LIPYRYIVVFNEDISIKSIESHRKMVQEAHSVSVSKLAEDDVFLEVVSSSIAPD--LQLG 123
           +IP RYIVVF + I  + ++ H++++ +    S +KL +DD F    S+S   D  +  G
Sbjct: 98  IIPNRYIVVFKKSILPEEVDFHKELINQIQLESAAKLPKDDKFF---SASAIEDESINQG 154

Query: 124 GIDSSFDINGLFRGYAGYFTDEILNLVSQDPLIKFIEQESTVRLSNTSMQKDAPWGLHRI 183
           GI ++F+I+ L  GY GYFTDE+L L+  +PL++++E++S V+ +    Q +APWGL RI
Sbjct: 155 GILTTFNISNLLNGYVGYFTDEVLELIRMNPLVEYVEKDSLVQATEFDNQNNAPWGLARI 214

Query: 184 SHREKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDTEHEDFEGRAVWGAVIPGNDEASDLN 243
           SHRE+   G   +YLY+D AG+GVT YV+DTGI+TEH DF  RAVWG  IP ND+  D N
Sbjct: 215 SHRERLNLGSFNKYLYDDDAGKGVTCYVIDTGINTEHNDFNKRAVWGKTIPLNDKDIDGN 274

Query: 244 GHGTHCAGIIGSKHYGVAKNTKLVAVKVLRSNGEGTVSDVIKGIEYVAREHIESSRKKSK 303
           GHGTHCAG I S HYGVAKN ++VAVKVLRSNG G++SDVIKG+E+ A  HI+++++K K
Sbjct: 275 GHGTHCAGTIASTHYGVAKNAEVVAVKVLRSNGSGSMSDVIKGVEFAAESHIKAAKEKKK 334

Query: 304 EFKGSTANLSLGSSKSLAMEMAVDAAVDSGVHFAIAAGNENEDACLSSPAGAQKSITVGA 363
            FKGSTAN+SLG  KS  +++AV+AAVD+G+HFA+AAGNEN+DAC +SPA A+++ITVGA
Sbjct: 335 GFKGSTANMSLGGGKSPTLDLAVNAAVDAGIHFAVAAGNENQDACNTSPASAERAITVGA 394

Query: 364 STFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGMLSYFLSL 423
           ST SDDRA+FSNWG CVD+FAPG+NI+STYIG  +AT +LSGTSMA+PHVAG+L+YFLSL
Sbjct: 395 STLSDDRAYFSNWGKCVDIFAPGLNILSTYIGDDDATATLSGTSMASPHVAGLLTYFLSL 454

Query: 424 QPAPDSEYFD-NALSPQELKEKVLKFSTHGVLGDIGDNTPNRLIYNGGGKILDDLW 478
           QP  DSE+FD   L+P ++K+K++ +S+  VL D+ + TPN+LI+NG G  LDDLW
Sbjct: 455 QPGSDSEFFDPTELTPAQMKKKLINYSSKDVLFDLPEGTPNKLIFNGAGGNLDDLW 510

>KLLA0D00979g Chr4 (86703..88388) [1686 bp, 561 aa] {ON} similar to
           uniprot|P09232 Saccharomyces cerevisiae YEL060C PRB1
           Vacuolar proteinase B (yscB) a serine protease of the
           subtilisin family involved in protein degradation in the
           vacuole and required for full protein degradation during
           sporulation
          Length = 561

 Score =  499 bits (1284), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 238/419 (56%), Positives = 311/419 (74%), Gaps = 7/419 (1%)

Query: 67  IPYRYIVVFNEDISIKSIESHRKMVQEAHSVSVSKLAEDDVFLEVVSSS-----IAPDLQ 121
           IP RYI+VF +D S   ++ H+++V   H+ ++  LA++D F    S       +     
Sbjct: 97  IPNRYIIVFKKDASADEVKFHQELVSVEHAKALGSLADNDPFFTATSGEHSEFGVKAHSL 156

Query: 122 LGGIDSSFDINGLFRGYAGYFTDEILNLVSQDPLIKFIEQESTVRLSNTSMQKDAPWGLH 181
            GGI  SFDI G   GY GYFT E+++ + + PL++F+E++S V  ++ + Q  APWGL 
Sbjct: 157 EGGIQDSFDIAGSLSGYVGYFTKEVIDFIRRSPLVEFVEEDSMVFSNSFNTQNSAPWGLA 216

Query: 182 RISHREKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDTEHEDFEGRAVWGAVIPGNDEASD 241
           RISHREK   G   +YLY+D AG+GVT+YV+DTG++  H+DF+GRAVWG  IP +D   D
Sbjct: 217 RISHREKLNLGSFNKYLYDDDAGKGVTAYVVDTGVNVNHKDFDGRAVWGKTIPKDDPDVD 276

Query: 242 LNGHGTHCAGIIGSKHYGVAKNTKLVAVKVLRSNGEGTVSDVIKGIEYVAREHIESSRKK 301
            NGHGTHCAG IGS HYGVAKN  +VAVKVLRSNG GT+SDV+KG+EYVA  H ++  ++
Sbjct: 277 GNGHGTHCAGTIGSVHYGVAKNADIVAVKVLRSNGSGTMSDVVKGVEYVAEAHKKAVEEQ 336

Query: 302 SKEFKGSTANLSLGSSKSLAMEMAVDAAVDSGVHFAIAAGNENEDACLSSPAGAQKSITV 361
            K FKGSTAN+SLG  KS A+++AV+AAV +GVHFA+AAGNEN+DAC +SPA A+ +ITV
Sbjct: 337 KKGFKGSTANMSLGGGKSPALDLAVNAAVKAGVHFAVAAGNENQDACNTSPAAAENAITV 396

Query: 362 GASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGMLSYFL 421
           GAST SD+RA+FSNWG CVD+F PG+NI+STYIGS  AT +LSGTSMA PHV G+L+YFL
Sbjct: 397 GASTLSDERAYFSNWGKCVDIFGPGLNILSTYIGSDTATATLSGTSMATPHVVGLLTYFL 456

Query: 422 SLQPAPDSEYFDNA--LSPQELKEKVLKFSTHGVLGDIGDNTPNRLIYNGGGKILDDLW 478
           SLQP  DSEYF  A  ++P +LK+K++ FST  VL D+ ++T N LIYNGGG+ LDDLW
Sbjct: 457 SLQPDADSEYFHAAGGITPSQLKKKLIDFSTKNVLSDLPEDTVNYLIYNGGGQDLDDLW 515

>TBLA0A07300 Chr1 complement(1815683..1817404) [1722 bp, 573 aa]
           {ON} Anc_6.14 YOR003W
          Length = 573

 Score =  493 bits (1268), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 231/420 (55%), Positives = 310/420 (73%), Gaps = 7/420 (1%)

Query: 62  HKTELIPYRYIVVFNEDISIKSIESHRKMVQEAHSVSVSKLAEDDVFLEVVSSSIAPDLQ 121
           H   +IP+RYI+ F +D++ + I+ H++ + E    S+++L  D  +   V      DLQ
Sbjct: 120 HPQNIIPHRYIITFKKDVAPEEIDFHQQSINELQQQSIAQLPHDHPYFNSVE---GLDLQ 176

Query: 122 LGGIDSSFDINGLFRGYAGYFTDEILNLVSQDPLIKFIEQESTVRLSNTSMQKDAPWGLH 181
              IDS F+IN L +GY GYFTD++++ +  +PL++F+EQ+STV ++    Q  APWGL 
Sbjct: 177 QPIIDS-FNINSLLQGYIGYFTDDVIDFIRLNPLVQFVEQDSTVNINEFDTQNGAPWGLA 235

Query: 182 RISHREKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDTEHEDFEGRAVWGAVIPGNDEASD 241
           RISHRE+   G   +YL++D AG GVT+YV+DTG++ EH DFEGRA WG  IP NDE  D
Sbjct: 236 RISHRERLNLGSFNKYLFDDKAGEGVTAYVIDTGVNVEHNDFEGRASWGKTIPNNDEDLD 295

Query: 242 LNGHGTHCAGIIGSKHYGVAKNTKLVAVKVLRSNGEGTVSDVIKGIEYVAREHIESSRKK 301
            NGHGTHCAG I SKHYGVAKN  +VAVKVLRSNG G++SDV+KG+EY    H+   + K
Sbjct: 296 GNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGSMSDVLKGVEYATASHLADVKNK 355

Query: 302 SKEFKGSTANLSLGSSKSLAMEMAVDAAVDSGVHFAIAAGNENEDACLSSPAGAQKSITV 361
              FKGSTAN+SLG  KS ++++AV+AAV +G+HFA+AAGNEN+DAC +SPA A+ +ITV
Sbjct: 356 KSGFKGSTANMSLGGGKSPSLDLAVNAAVKAGIHFAVAAGNENQDACNTSPASAKYAITV 415

Query: 362 GASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGMLSYFL 421
           GAST SDDRA+FSNWG CVDVFAPG+NI+STYIGS +AT +LSGTSMA+PHVAG+LSYFL
Sbjct: 416 GASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLSYFL 475

Query: 422 SLQPAPDSEYFDN---ALSPQELKEKVLKFSTHGVLGDIGDNTPNRLIYNGGGKILDDLW 478
           SLQP  DSE+  +    ++P +LK++++ + T  +L DI + TPN L++NG G+ L D W
Sbjct: 476 SLQPEQDSEFATSRKGGITPAQLKKRLISYGTKDILLDIPELTPNVLVFNGAGQDLSDFW 535

>TDEL0G04550 Chr7 complement(829468..831162) [1695 bp, 564 aa] {ON}
           Anc_6.14 YOR003W
          Length = 564

 Score =  485 bits (1248), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 232/415 (55%), Positives = 305/415 (73%), Gaps = 9/415 (2%)

Query: 67  IPYRYIVVFNEDISIKSIESHRKMVQEAHSVSVSKLAEDDVFLEVVSSSIAPDLQLGGID 126
            P+RYIVV     S + I  H + + ++   SV +LA+DD F              GGI 
Sbjct: 111 FPHRYIVVLKHS-SPEEIALHMEAITQSQLQSVGELAQDDPFFSAQGVRTT-----GGIQ 164

Query: 127 SSFDINGLFRGYAGYFTDEILNLVSQDPLIKFIEQESTVRLSNTSMQKDAPWGLHRISHR 186
            SFD+ GL  GY GYFTD ++ L+ + P++ F+E +S V  S    Q  APWGL RISHR
Sbjct: 165 DSFDVAGLLNGYVGYFTDAVVELIRKSPMVDFVEMDSPVHASEFDTQNGAPWGLSRISHR 224

Query: 187 EKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDTEHEDFEGRAVWGAVIPGNDEASDLNGHG 246
           E+   G   +YL++D AG+GVTSYV+DTGI+ +H+DFEGRA WG  IP NDE  D NGHG
Sbjct: 225 ERLNLGSFNKYLFDDEAGKGVTSYVIDTGINVKHQDFEGRAHWGKTIPTNDEDLDGNGHG 284

Query: 247 THCAGIIGSKHYGVAKNTKLVAVKVLRSNGEGTVSDVIKGIEYVAREHIESSRKKSKEFK 306
           THCAG I SKHYGVAK   +VAVKVLRSNG G++SDVIKG+E+ A+ H ++ + K K FK
Sbjct: 285 THCAGTIASKHYGVAKGADVVAVKVLRSNGSGSMSDVIKGVEFAAQSHQKAVKDKKKGFK 344

Query: 307 GSTANLSLGSSKSLAMEMAVDAAVDSGVHFAIAAGNENEDACLSSPAGAQKSITVGASTF 366
           GSTAN+SLG  KS A+++AV+AAV +G+HFA+AAGNEN+DAC +SPA A++++TVGAST 
Sbjct: 345 GSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDACNTSPAAAEQAVTVGASTL 404

Query: 367 SDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGMLSYFLSLQPA 426
           SDDRA+FSN+G CVD+FAPG+NI+STYIGS +AT +LSGTSMA+PHVAG+L+YFLSLQP 
Sbjct: 405 SDDRAYFSNYGKCVDIFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLTYFLSLQPD 464

Query: 427 PDSEYFD---NALSPQELKEKVLKFSTHGVLGDIGDNTPNRLIYNGGGKILDDLW 478
            DS++FD     ++P++LK+K++ +ST  +L D+ ++TPN LIYNGGG  L   W
Sbjct: 465 SDSDFFDAGSQGVTPEQLKKKLIAYSTKDILYDLPEDTPNALIYNGGGHGLKGFW 519

>ACR012C Chr3 complement(378750..380375) [1626 bp, 541 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL060C
           (PRB1) and YOR003W (YSP3)
          Length = 541

 Score =  475 bits (1222), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 230/421 (54%), Positives = 300/421 (71%), Gaps = 6/421 (1%)

Query: 64  TELIPYRYIVVFNEDISIKSIESHRKMVQEAHSVSVSKLAEDDVFLEVVSSS-----IAP 118
           T  IP++YIVVF E +S +    H ++V+ AH+ SV++L E   F            IA 
Sbjct: 68  TRAIPHKYIVVFREGVSDEEAAFHMELVEAAHAESVARLDEQHAFFRSTRGENNEFGIAA 127

Query: 119 DLQLGGIDSSFDINGLFRGYAGYFTDEILNLVSQDPLIKFIEQESTVRLSNTSMQKDAPW 178
               GGI+  F +    RGY GYFT++++ L+  +P + F+E++S V  S+ + Q  APW
Sbjct: 128 TRAEGGIEGEFALGEQLRGYVGYFTEDMVGLLRSNPHVHFVEEDSMVFASDFTTQNGAPW 187

Query: 179 GLHRISHREKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDTEHEDFEGRAVWGAVIPGNDE 238
           GL R+SHREK   G   +YLY+D +G GVTSYV+DTGI+ +H DFE RA+WG  IP ND 
Sbjct: 188 GLARVSHREKLNSGSFNKYLYDDNSGEGVTSYVIDTGINIDHVDFEDRALWGKTIPNNDA 247

Query: 239 ASDLNGHGTHCAGIIGSKHYGVAKNTKLVAVKVLRSNGEGTVSDVIKGIEYVAREHIESS 298
             D NGHGTHCAG I SK YGVAK   +VAVKVLRSNG G++SDV++G+EY  + H +++
Sbjct: 248 DYDGNGHGTHCAGTIASKTYGVAKKANVVAVKVLRSNGTGSMSDVLRGVEYAVKAHRKAA 307

Query: 299 RKKSKEFKGSTANLSLGSSKSLAMEMAVDAAVDSGVHFAIAAGNENEDACLSSPAGAQKS 358
            K  K FKGSTAN+SLG  +S A+++AVDAAVD+G+HFA+AAGNEN+DAC +SPA +QK+
Sbjct: 308 EKADKGFKGSTANMSLGGGRSQALDLAVDAAVDAGIHFAVAAGNENQDACNTSPAASQKA 367

Query: 359 ITVGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGMLS 418
           ITVGAST +DDRA+FSNWG CVD+FAPG+NI+STYIGS  A  +LSGTSMA+PHVAG+L+
Sbjct: 368 ITVGASTLADDRAYFSNWGRCVDLFAPGMNILSTYIGSDTAVATLSGTSMASPHVAGLLT 427

Query: 419 YFLSLQPAPDSEYFD-NALSPQELKEKVLKFSTHGVLGDIGDNTPNRLIYNGGGKILDDL 477
           YFLSLQP  DSE+ +   +SP+ LK+KV+ F T   L  +   T N LIYNGGG  L D 
Sbjct: 428 YFLSLQPDGDSEFRNKQTISPEVLKKKVIDFGTKDALSSLPARTANVLIYNGGGADLSDF 487

Query: 478 W 478
           W
Sbjct: 488 W 488

>Kpol_1032.5 s1032 (6368..8410) [2043 bp, 680 aa] {ON} (6368..8410)
           [2043 nt, 681 aa]
          Length = 680

 Score =  478 bits (1230), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 231/425 (54%), Positives = 312/425 (73%), Gaps = 17/425 (4%)

Query: 58  LDNT-HKTELIPYRYIVVFNEDISIKSIESHRKMVQEAHSVSVSKLAEDDVFLEVVSSSI 116
           ++NT ++  +IP +YI+VF +D+S+K ++ H+ ++  A     S   E        SSSI
Sbjct: 222 MENTKYENLVIPNKYIIVFKKDVSVKDMQIHKDLIARAQFQYASVSDE-------TSSSI 274

Query: 117 APDLQLGGIDSSFDINGLFRGYAGYFTDEILNLVSQDPLIKFIEQESTVRLSNTSMQKDA 176
                LGGI+ +F++  LF GY G+F ++++  +   P++ F+EQ+S V  +    Q +A
Sbjct: 275 -----LGGIEEAFNVANLFHGYIGHFNEQLVQFIRLSPIVDFVEQDSIVHANEVDTQNNA 329

Query: 177 PWGLHRISHREKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDTEHEDFEGRAVWGAVIPGN 236
           PWGL RISHR+    G   +YLY+D AG GVT+YV+DTGI+ +H++F GRAVWG  IP N
Sbjct: 330 PWGLARISHRDGLNLGSYNKYLYDDVAGEGVTAYVIDTGINIKHKEFGGRAVWGKTIPEN 389

Query: 237 DEASDLNGHGTHCAGIIGSKHYGVAKNTKLVAVKVLRSNGEGTVSDVIKGIEYVAREHIE 296
           D+  D NGHGTHCAG I SK+YGVAKN ++VAVKVLRS+G GT+SDV+KG+EY A  H +
Sbjct: 390 DQDVDGNGHGTHCAGTIASKNYGVAKNAEVVAVKVLRSDGSGTMSDVLKGVEYAAFSHQK 449

Query: 297 SSRKKSKEFKGSTANLSLGSSKSLAMEMAVDAAVDSGVHFAIAAGNENEDACLSSPAGAQ 356
           + R+K K FKGSTAN+SLG  KS ++++AVDAAV SG+HFA+AAGNEN+DAC SSPA ++
Sbjct: 450 ALREKKKGFKGSTANMSLGGGKSRSLDLAVDAAVKSGIHFAVAAGNENQDACNSSPAASE 509

Query: 357 KSITVGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGM 416
            +ITVGAST SDDRA+FSNWG CVDVFAPG+NI+STYIGS  AT +LSGTSMA+PHVAG+
Sbjct: 510 NAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDEATATLSGTSMASPHVAGL 569

Query: 417 LSYFLSLQPAPDSEYF---DNALSPQELKEKVLKFSTHGVLGDIGDNTPNRLIYNGGGKI 473
           LSYFLS+QP  DSE+F    N++SP +LK+K++ +ST  +  D+ + TPN L+YN G  I
Sbjct: 570 LSYFLSMQPDADSEFFSSGSNSISPAQLKKKLIAYSTKNLFQDLPEKTPNLLVYNAGHNI 629

Query: 474 LDDLW 478
             D W
Sbjct: 630 -SDFW 633

>NDAI0K02880 Chr11 complement(651446..653560) [2115 bp, 704 aa] {ON}
           Anc_6.14
          Length = 704

 Score =  478 bits (1231), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 226/419 (53%), Positives = 309/419 (73%), Gaps = 6/419 (1%)

Query: 65  ELIPYRYIVVFNEDISIKSIESHRKMVQEAHSVSVSKLAEDDVFLEVVSSSIAPDLQLGG 124
            ++P +YI+VF + I+I  I  H++++ E    S S+L     F    S       + GG
Sbjct: 237 RILPNKYIIVFKDSINIDEISYHKELISEIQQQSASRLPPHHHFFHSTSEEEEESFRNGG 296

Query: 125 IDSSFDINGLFRGYAGYFTDEILNLVSQDPLIKFIEQESTVRLSNTSMQKDAPWGLHRIS 184
           I SSF+IN +  GY+GYFT E+++L+  +PL+K++E++S V+ +  + Q +APWGL RIS
Sbjct: 297 IISSFNINNILSGYSGYFTQEVIDLIRLNPLVKYVERDSIVQTTEFNTQNNAPWGLSRIS 356

Query: 185 HREKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDTEHEDFEGRAVWGAVIPGNDEASDLNG 244
           HRE+   G   +YLY+D AG+GVT +V+DTGI+  H DF  RA+WG  IP ND+  D NG
Sbjct: 357 HRERLNLGSFNKYLYDDDAGKGVTCFVIDTGINVNHVDFGKRAIWGKTIPSNDQDIDGNG 416

Query: 245 HGTHCAGIIGSKHYGVAKNTKLVAVKVLRSNGEGTVSDVIKGIEYVAREHIESSRKKSKE 304
           HGTHCAG I S HYGVAKN ++VAVKVLRSNG G++SDVIKG+E+ A  H+ + + K K+
Sbjct: 417 HGTHCAGTIASTHYGVAKNAEVVAVKVLRSNGSGSMSDVIKGVEFAAETHLNNEKNK-KD 475

Query: 305 FKGSTANLSLGSSKSLAMEMAVDAAVDSGVHFAIAAGNENEDACLSSPAGAQKSITVGAS 364
           +KGSTAN+SLG  KS  +++AV+AAV++G+HF++AAGNEN+DAC SSPA A+ +ITVGAS
Sbjct: 476 YKGSTANMSLGGGKSPTLDLAVNAAVEAGIHFSVAAGNENQDACNSSPASAENAITVGAS 535

Query: 365 TFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRN-ATLSLSGTSMAAPHVAGMLSYFLSL 423
           T SDDRA+FSNWG CVDVFAPG+NI+STY+G  N  T +LSGTSMA+PHVAG+L+YFLSL
Sbjct: 536 TLSDDRAYFSNWGRCVDVFAPGLNILSTYVGDGNDNTATLSGTSMASPHVAGLLTYFLSL 595

Query: 424 QPAPDSEYF----DNALSPQELKEKVLKFSTHGVLGDIGDNTPNRLIYNGGGKILDDLW 478
           QP   S +F    D  ++P++LK+K++ +ST  +L D+ D TPN+LIYNG G  + DLW
Sbjct: 596 QPDSKSGFFNSKSDGKITPEQLKKKLIAYSTSDILYDLPDGTPNKLIYNGAGGDISDLW 654

>ZYRO0C07942g Chr3 complement(605044..606690) [1647 bp, 548 aa] {ON}
           similar to uniprot|P09232 Saccharomyces cerevisiae
           YEL060C PRB1 Vacuolar proteinase B (yscB) a serine
           protease of the subtilisin family involved in protein
           degradation in the vacuole and required for full protein
           degradation during sporulation
          Length = 548

 Score =  469 bits (1206), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 245/510 (48%), Positives = 331/510 (64%), Gaps = 41/510 (8%)

Query: 1   MKFS-TILPI-LWASCNLCMIIPEF---DEIVRFTQITDDSRNTKSL------------- 42
           MKF  +++P+   A     +IIPE    +E  +  + TDD  N +S+             
Sbjct: 1   MKFQKSVIPVATLAGLGSALIIPELTGSNEYEKRPERTDDVNNGESVVATSFEKGPSKDE 60

Query: 43  -----KNLRQQYSGGF--------LMGGLDNTHKTELIPYRYIVVFNEDISIKSIESHRK 89
                  L Q+    F         +G L+N         RYI++F + ++ + I  HR+
Sbjct: 61  LAVFASKLTQEVQDRFAPLVVPEDTLGVLEN---------RYIILFKKGVNPQEIGFHRE 111

Query: 90  MVQEAHSVSVSKLAEDDVFLEVVSSSIAPDLQLGGIDSSFDINGLFRGYAGYFTDEILNL 149
           ++++ H   VS+L E+  F E +      D  LGGID +FDING+  GY+GYF  ++L++
Sbjct: 112 LIEQVHLQEVSQLPEEHSFFEGIRLDGVYDSPLGGIDHTFDINGMLMGYSGYFPSKVLDV 171

Query: 150 VSQDPLIKFIEQESTVRLSNTSMQKDAPWGLHRISHREKAKYGQDLEYLYEDAAGRGVTS 209
           +   PLI+ +EQ+S V       +  APWGL RISHRE+   G   +YLY++  G GVTS
Sbjct: 172 IRMSPLIEMVEQDSVVYTQKADTENGAPWGLARISHRERLNLGSYNKYLYDEQGGSGVTS 231

Query: 210 YVLDTGIDTEHEDFEGRAVWGAVIPGNDEASDLNGHGTHCAGIIGSKHYGVAKNTKLVAV 269
           YV+DTG++  H  F GRA WG  IP  D   D NGHGTHCAG IGS  YGVAK   +VAV
Sbjct: 232 YVIDTGVNVHHNQFGGRAKWGKTIPAGDLDEDGNGHGTHCAGTIGSSTYGVAKGADIVAV 291

Query: 270 KVLRSNGEGTVSDVIKGIEYVAREHIESSRKKSKEFKGSTANLSLGSSKSLAMEMAVDAA 329
           KVLRSNG G++SDV+KG+E+ A++H  + ++K   FKGSTAN+SLG  KS +++ AV+AA
Sbjct: 292 KVLRSNGSGSMSDVLKGVEWAAQDHQNAVKQKKPGFKGSTANMSLGGGKSPSLDQAVNAA 351

Query: 330 VDSGVHFAIAAGNENEDACLSSPAGAQKSITVGASTFSDDRAFFSNWGTCVDVFAPGINI 389
           V +G++FA+AAGNE++DAC +SPA A   ITVGAST SDDRA+FSN+G CVDVFAPG+NI
Sbjct: 352 VAAGLNFAVAAGNEDQDACNTSPASASGPITVGASTLSDDRAYFSNYGKCVDVFAPGLNI 411

Query: 390 MSTYIGSRNATLSLSGTSMAAPHVAGMLSYFLSLQPAPDSEY-FDNALSPQELKEKVLKF 448
           +STYIGS ++T +LSGTSMA+PHVAG+L+YFLSLQP  DSE+   +++SP +LK+K+L F
Sbjct: 412 LSTYIGSDSSTATLSGTSMASPHVAGLLAYFLSLQPGSDSEFDAGSSISPDQLKKKLLAF 471

Query: 449 STHGVLGDIGDNTPNRLIYNGGGKILDDLW 478
           ST  VL DI   TPN LIYNGGG  L   W
Sbjct: 472 STKDVLSDIPSGTPNLLIYNGGGGDLSGFW 501

>CAGL0B03619g Chr2 (361572..362978) [1407 bp, 468 aa] {ON} similar
           to uniprot|P09232 Saccharomyces cerevisiae YEL060c PRB1
           protease B or uniprot|P25036 Saccharomyces cerevisiae
           YOR003w YSP3
          Length = 468

 Score =  464 bits (1193), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 226/418 (54%), Positives = 309/418 (73%), Gaps = 9/418 (2%)

Query: 66  LIPYRYIVVFNEDISIKSIESHRKMVQEAHSVSVSKLAEDDVFLEVVSSSIAPDLQLGGI 125
           ++P++YIVV  + +S +++ +    V  AH+ ++  L ++  F   V+   A  L  GGI
Sbjct: 1   MVPHKYIVVLKKGVSPEAVATFLNDVSAAHAAAIRDLPKEHDFFNFVN---AEGLPRGGI 57

Query: 126 DSSFDINGLFRGYAGYFTDEILNLVSQDPLIKFIEQESTVRLSNTSMQKDAPWGLHRISH 185
              F+IN LF+G  GYF + ++ L+ +  +++F+E++S V  SN   Q +APWGL RISH
Sbjct: 58  KDLFNINDLFQGLIGYFPEPVVKLLEKSDIVEFVERDSVVHASNFDTQNNAPWGLARISH 117

Query: 186 REKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDTEHEDFEGRAVWGAVIPGNDEASDLNGH 245
           R++   G   +YLY++A G GVT+YV+DTGI+ +H +F+GRA WG  IP ND   D NGH
Sbjct: 118 RDRLNLGNFNKYLYDNAGGEGVTAYVIDTGINVKHVEFDGRAQWGKTIPLNDLDIDGNGH 177

Query: 246 GTHCAGIIGSKHYGVAKNTKLVAVKVLRSNGEGTVSDVIKGIEYVAREHIESSRKKSKEF 305
           GTHCAG I SKHYG+AK   +VAVKVL+S+G GT+SDVIKG+EY A+ H++ S K +K+F
Sbjct: 178 GTHCAGTIASKHYGIAKKANVVAVKVLKSDGSGTMSDVIKGVEYAAQAHLKES-KNNKKF 236

Query: 306 KGSTANLSLGSSKSLAMEMAVDAAVDSGVHFAIAAGNENEDACLSSPAGAQKSITVGAST 365
           KGSTAN+SLG  KS A++MAV+AAV +G+HFA+AAGNEN+DAC +SPA A+K+ITVGAST
Sbjct: 237 KGSTANMSLGGGKSPALDMAVNAAVSAGIHFAVAAGNENQDACNTSPASAEKAITVGAST 296

Query: 366 FSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRN-ATLSLSGTSMAAPHVAGMLSYFLSLQ 424
            SDDRA+FSNWG CVD+FAPG+NI+STYIG  N  T SLSGTSMA+PHVAG+L+YFLSLQ
Sbjct: 297 LSDDRAYFSNWGKCVDIFAPGLNILSTYIGDTNRETASLSGTSMASPHVAGLLTYFLSLQ 356

Query: 425 PAPDSEYFD---NALSPQELKEKVLKFSTHGVLGDIGD-NTPNRLIYNGGGKILDDLW 478
           P  DSE++D   + ++P +LK+K++ +ST  VL D+ D ++PN LIYNG G  L   W
Sbjct: 357 PDSDSEFYDASKHGVTPAQLKKKLIAYSTKNVLTDLPDPDSPNLLIYNGAGGDLGVFW 414

>Ecym_3018 Chr3 (33738..35465) [1728 bp, 575 aa] {ON} similar to
           Ashbya gossypii ACR012C
          Length = 575

 Score =  466 bits (1199), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 227/420 (54%), Positives = 302/420 (71%), Gaps = 7/420 (1%)

Query: 64  TELIPYRYIVVFNEDISIKSIESHRKMVQEAHSVSVSKLAEDDVFLEVVSS----SIAPD 119
           +  IP+RYIV+F + ++   +  H+ +V  AH  ++++L     F +         I+  
Sbjct: 106 SRAIPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHEGISAR 165

Query: 120 LQLGGIDSSFDINGLFRGYAGYFTDEILNLVSQDPLIKFIEQESTVRLSNTSMQKDAPWG 179
              GGI+  F+I G  RGY GYFTD +L+L+ +  L+K IEQ+S V  S+   Q  APWG
Sbjct: 166 SVEGGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWG 225

Query: 180 LHRISHREKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDTEHEDFEGRAVWGAVIPGNDEA 239
           L R+SHRE+   G   +YLY+D AG+GVT+YV+DTGI+ +H +FEGRA WG  IP ND  
Sbjct: 226 LARVSHRERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDAD 285

Query: 240 SDLNGHGTHCAGIIGSKHYGVAKNTKLVAVKVLRSNGEGTVSDVIKGIEYVAREHIESSR 299
            D NGHGTHCAG I SK YGVAKN K+VAVKVLR+NG GT+SDV++G+EYV  EH ++S 
Sbjct: 286 YDGNGHGTHCAGTIASKTYGVAKNAKVVAVKVLRTNGTGTMSDVLRGVEYVVAEHRKAS- 344

Query: 300 KKSKEFKGSTANLSLGSSKSLAMEMAVDAAVDSGVHFAIAAGNENEDACLSSPAGAQKSI 359
                FKGSTAN+SLG  KS A+E+AVDAAV +G+HFA+AAGNEN+DAC +SPA ++K I
Sbjct: 345 -GDPNFKGSTANMSLGGGKSAALELAVDAAVAAGIHFAVAAGNENQDACNTSPASSKKCI 403

Query: 360 TVGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGMLSY 419
           TV AST SDDRA+FSNWG+CVD+FAPG+NI+STYIGS  A  +LSGTSMA+PHVAG+L+Y
Sbjct: 404 TVAASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAGLLAY 463

Query: 420 FLSLQPAPDSEYFD-NALSPQELKEKVLKFSTHGVLGDIGDNTPNRLIYNGGGKILDDLW 478
           FLSLQP   SEY+  +++SP+ LK+K++ + +  +L ++   T N LI+NGGG  LD  W
Sbjct: 464 FLSLQPDSGSEYYTGSSISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLDSFW 523

>KAFR0L00360 Chr12 (64781..66289) [1509 bp, 502 aa] {ON} Anc_6.14
           YOR003W
          Length = 502

 Score =  455 bits (1171), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 219/429 (51%), Positives = 304/429 (70%), Gaps = 8/429 (1%)

Query: 55  MGGLDNTHKTELIPYRYIVVFNEDISIKSIESHRKMVQEAHSVSVSKLAEDDVFLEVVSS 114
           +  + N     +IP+RYI+VF + +S + I+ H++++   H    S  + D  F E + +
Sbjct: 46  LAPVHNADAENIIPHRYIIVFKDGVSKEQIQFHKELITTLHLQQSSAFSND--FTEYLQT 103

Query: 115 SI-APD---LQLGGIDSSFDINGLFRGYAGYFTDEILNLVSQDPLIKFIEQESTVRLSNT 170
            I  P+     LGGI S FDI+ L  GY  Y +DE+L+ +  +PLI FIE ++ V  ++ 
Sbjct: 104 DINVPESMRQSLGGIVSDFDISSLLSGYIAYLSDELLHFIRLNPLIAFIEHDTMVHTTDF 163

Query: 171 SMQKDAPWGLHRISHREKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDTEHEDFEGRAVWG 230
           + Q +APWGL RISHRE        +YLY+D AG+ V +YV+DTG+D  H +F  RA WG
Sbjct: 164 NTQNNAPWGLARISHRESLNLANFNKYLYDDDAGKNVDAYVIDTGVDVNHVEFHSRAHWG 223

Query: 231 AVIPGNDEASDLNGHGTHCAGIIGSKHYGVAKNTKLVAVKVLRSNGEGTVSDVIKGIEYV 290
             IP ND+  D NGHGTH AG IGS+HYGVAK+  ++AVKVLRSNG G++SDV+KG+E+ 
Sbjct: 224 KTIPLNDQDIDGNGHGTHVAGTIGSQHYGVAKSVNIIAVKVLRSNGSGSMSDVVKGVEFA 283

Query: 291 AREHIESSRKKSKEFKGSTANLSLGSSKSLAMEMAVDAAVDSGVHFAIAAGNENEDACLS 350
              H+E   K  K  KGS AN+SLG  KS A+++AV+AAV +G+HFA+AAGNEN++AC S
Sbjct: 284 VSSHLE-RMKNEKNLKGSVANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQNACNS 342

Query: 351 SPAGAQKSITVGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSR-NATLSLSGTSMA 409
           SPA A++++TVGAST SD+RA+FSNWG CVD+FAPG+NI+STYIG+  + T +LSGTSMA
Sbjct: 343 SPASAEQAVTVGASTISDERAYFSNWGECVDIFAPGLNILSTYIGANDDVTATLSGTSMA 402

Query: 410 APHVAGMLSYFLSLQPAPDSEYFDNALSPQELKEKVLKFSTHGVLGDIGDNTPNRLIYNG 469
           +PHVAG+L+Y+LSLQP   SE+   A+S  +LK+K+++++T  VL D+ + TPN LIYNG
Sbjct: 403 SPHVAGLLAYYLSLQPEKSSEFSTRAISTSQLKKKLIEYATKDVLEDLPEGTPNVLIYNG 462

Query: 470 GGKILDDLW 478
           GG+ L D W
Sbjct: 463 GGQDLSDFW 471

>KNAG0E00920 Chr5 complement(174432..176027) [1596 bp, 531 aa] {ON}
           Anc_6.14 YOR003W
          Length = 531

 Score =  451 bits (1160), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 213/410 (51%), Positives = 297/410 (72%), Gaps = 16/410 (3%)

Query: 70  RYIVVFNEDISIKSIESHRKMVQEAHSVSVSKLAEDDVFLEVVSSSIAPDLQLGGIDSSF 129
           +YI++F E ++ + I +H++++Q+             V LE  +S ++    +  +  SF
Sbjct: 97  KYIILFKEGVTAEQISAHKQLLQQ-------------VLLE--TSDVSAQGIVADVLDSF 141

Query: 130 DINGLFRGYAGYFTDEILNLVSQDPLIKFIEQESTVRLSNTSMQKDAPWGLHRISHREKA 189
           D+ G+  GY    +  +L LV + P ++ +EQ+S V  +    Q +APWGL RISHR+  
Sbjct: 142 DLEGVLSGYVAELSPMVLELVRRSPFVQLVEQDSEVHTNEFDTQNNAPWGLARISHRDPL 201

Query: 190 KYGQDLEYLYEDAAGRGVTSYVLDTGIDTEHEDFEGRAVWGAVIPGNDEASDLNGHGTHC 249
             G   +YLY+DAAG GV SY++DTGI+ +H++FEGRA WG  IP ND   D NGHGTHC
Sbjct: 202 SLGSFNKYLYDDAAGEGVDSYIIDTGINVKHKEFEGRAQWGKTIPDNDFDEDGNGHGTHC 261

Query: 250 AGIIGSKHYGVAKNTKLVAVKVLRSNGEGTVSDVIKGIEYVAREHIESSRKKSKEFKGST 309
           AG I SKHYGVAK   ++AVKVLRSNG G++SDVI G+E+ A++H   ++   K+FKGST
Sbjct: 262 AGTIASKHYGVAKRANVIAVKVLRSNGSGSMSDVIMGVEFAAKQHASKAKSNDKKFKGST 321

Query: 310 ANLSLGSSKSLAMEMAVDAAVDSGVHFAIAAGNENEDACLSSPAGAQKSITVGASTFSDD 369
           AN+SLG  KS +++  VDAAV  G+HF++AAGNEN+DAC +SPA ++++ITVGAST SDD
Sbjct: 322 ANMSLGGGKSPSLDRVVDAAVKLGLHFSVAAGNENQDACNTSPAASERAITVGASTLSDD 381

Query: 370 RAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGMLSYFLSLQPAPDS 429
           RA+FSNWG+CVD+FAPG+NI+STY GS +AT +LSGTSMA+PHVAG+L+YFLSLQP   S
Sbjct: 382 RAYFSNWGSCVDIFAPGLNILSTYTGSDDATATLSGTSMASPHVAGLLTYFLSLQPEKSS 441

Query: 430 EYFDNA-LSPQELKEKVLKFSTHGVLGDIGDNTPNRLIYNGGGKILDDLW 478
           ++  +A ++P++LK+K+L +ST GVL D+ ++TPN LIYNGGG  L D W
Sbjct: 442 QFGTSAQITPEQLKKKLLDYSTKGVLFDLPEDTPNALIYNGGGADLSDFW 491

>Kpol_1045.75 s1045 complement(174970..176403) [1434 bp, 477 aa]
           {ON} complement(174972..176405) [1434 nt, 478 aa]
          Length = 477

 Score =  446 bits (1148), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 218/423 (51%), Positives = 291/423 (68%), Gaps = 7/423 (1%)

Query: 61  THKTELIPYRYIVVFNEDISIKSIESHRKMVQEAHSVSVSKLAEDDVFLEVVSSS-IAPD 119
           T  +E+IPY YIVVFNE ++   I  H + + +    SV+ L  D  F  + +SS +  +
Sbjct: 29  TPNSEVIPYNYIVVFNEGVTQNEISLHIETMSQLQLQSVTDLPYDHEFFTISTSSDVNSN 88

Query: 120 LQLGGIDSSFDINGLFRGYAGYFTDEILNLVSQDPLIKFIEQESTVRLSNTSMQKDAPWG 179
             LGG+   F I     GY G FTDE++  +   PL+KFIE++S V  +  + Q +APWG
Sbjct: 89  GLLGGVRDMFKIGNDLHGYTGMFTDEVVEFLRLSPLVKFIERDSMVHTTEATTQYNAPWG 148

Query: 180 LHRISHREKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDTEHEDFEGRAVWGAVIPGNDEA 239
           L RISHR +       +YLY+D  G+GV +YV+DTGI+  + DF GRA WG  IP  +  
Sbjct: 149 LARISHRSRLNLSTFNKYLYDDLGGKGVKAYVIDTGINITNVDFGGRAYWGKTIPAGEAN 208

Query: 240 SDLNGHGTHCAGIIGSKHYGVAKNTKLVAVKVLRSNGEGTVSDVIKGIEYVAREHIESSR 299
            D NGHGTH AG I S HYGVAK  K+ AVKVLRSNG G++SDV+KG+EYV   H     
Sbjct: 209 VDGNGHGTHVAGTIASIHYGVAKQVKVYAVKVLRSNGAGSMSDVLKGVEYVVGAH--QRD 266

Query: 300 KKSKEFKGSTANLSLGSSKSLAMEMAVDAAVDSGVHFAIAAGNENEDACLSSPAGAQKSI 359
             +  FKGS AN+SLG  KS ++++AV+AAV +GVHFA+AAGNEN+DAC +SPA A+++I
Sbjct: 267 VGTAGFKGSVANMSLGGGKSRSLDLAVNAAVGAGVHFAVAAGNENQDACNTSPAAAERAI 326

Query: 360 TVGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGMLSY 419
           TVGAST SD RA+FSNWG CV +FAPG+NI+STYIGS +AT +LSGTSMA+PH+AG+++Y
Sbjct: 327 TVGASTLSDSRAYFSNWGQCVSIFAPGLNILSTYIGSPDATATLSGTSMASPHIAGLVAY 386

Query: 420 FLSLQPAPDSEYFDN----ALSPQELKEKVLKFSTHGVLGDIGDNTPNRLIYNGGGKILD 475
           FLSLQPA  S+++      A++P +LK+K++ F T   L D+  NTPN + YNG GK L+
Sbjct: 387 FLSLQPAVKSQFYSQGQATAITPDQLKKKIVAFGTKNALRDLPANTPNVIAYNGAGKSLE 446

Query: 476 DLW 478
           D W
Sbjct: 447 DFW 449

>CAGL0E02651g Chr5 (251868..253325) [1458 bp, 485 aa] {ON} similar
           to uniprot|P25036 Saccharomyces cerevisiae YOR003w YSP3
           or uniprot|P09232 Saccharomyces cerevisiae YEL060c PRB1
          Length = 485

 Score =  410 bits (1053), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 209/427 (48%), Positives = 285/427 (66%), Gaps = 14/427 (3%)

Query: 58  LDNTHKTELIPYRYIVVFNEDISIKSIESHRKMVQEAHSVSV----SKLAEDDVFLEVVS 113
            D+     +IP RYIV+F + ++ K I+SH   ++E +S S+    S   +   + ++ +
Sbjct: 65  FDSAKNDMIIPNRYIVLFKDFVTDKEIQSHLSAIEEINSSSIFLQDSDFGKATQYNDIST 124

Query: 114 SSIAPDLQLGGIDSSFDINGLFRGYAGYFTDEILNLVSQDPLIKFIEQESTVRLSNTSMQ 173
             I       G+   F I     GY GYFT+     ++  PL++ +E +S VR++N  MQ
Sbjct: 125 RGI-------GLQHEFSIGRSMTGYIGYFTETTAKFIANSPLVELVEHDSIVRINNYKMQ 177

Query: 174 KDAPWGLHRISHREKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDTEHEDFEGRAVWGAVI 233
           +  PWGL RIS REK        Y Y+D  G+   ++V+DTGI  +HEDFEGRA WG  I
Sbjct: 178 EHVPWGLGRISQREKLPILGKRFYHYDDRGGKDTVTFVIDTGIYVDHEDFEGRASWGKTI 237

Query: 234 PGNDEASDLNGHGTHCAGIIGSKHYGVAKNTKLVAVKVLRSNGEGTVSDVIKGIEYVARE 293
             ND   DLNGHGTHCAG I SKHYG+AK  +++AVKVLRS+G G++SDVI+G+EY    
Sbjct: 238 VENDNDYDLNGHGTHCAGTIASKHYGIAKQAEVIAVKVLRSDGSGSMSDVIRGVEYTVEA 297

Query: 294 HIESSRKKSKEFKGSTANLSLGSSKSLAMEMAVDAAVDSGVHFAIAAGNENEDACLSSPA 353
           + +  + KS   KG+  N+SLG+ KS A+  A+DAA  +G+ FA+AAGNE++DAC SSPA
Sbjct: 298 YNDLKKTKS-NLKGAAGNMSLGAWKSYALNRAMDAAAAAGISFAVAAGNESDDACNSSPA 356

Query: 354 GAQKSITVGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHV 413
            A   ITVG ST SDD AFFSN+G CVD+FAPG+NIMSTYIGS+NAT SLSGTSM++PHV
Sbjct: 357 SAWSPITVGGSTLSDDVAFFSNYGRCVDIFAPGVNIMSTYIGSKNATESLSGTSMSSPHV 416

Query: 414 AGMLSYFLSLQPAPDSEYF--DNALSPQELKEKVLKFSTHGVLGDIGDNTPNRLIYNGGG 471
           AG+L+Y+LSLQP   S+++   +A+SP+ LK+KVL ++T+G L  +   T N L+YNGGG
Sbjct: 417 AGVLAYYLSLQPDHKSQFYHEHSAISPKILKKKVLNYATNGTLSYLPAETVNLLVYNGGG 476

Query: 472 KILDDLW 478
           K L   W
Sbjct: 477 KNLSKFW 483

>TPHA0M00230 Chr13 (45121..46878) [1758 bp, 585 aa] {ON} Anc_6.14
           YOR003W
          Length = 585

 Score =  412 bits (1059), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 215/412 (52%), Positives = 293/412 (71%), Gaps = 20/412 (4%)

Query: 70  RYIVVFNEDISIKSIESHRKMVQEAHSVSVSKLAEDDVFLEVVSSSIAPDLQLGGID--- 126
           RYI+VF + +  + ++ H KM+    S    +L+E+        +S   D    G D   
Sbjct: 135 RYIIVFKKGVFKEQVDQHLKMM----SALFRRLSEEQRPAAAPGASALRD----GFDRVM 186

Query: 127 SSFDINGLFRGY-AGYFTDEILNLVSQDPLIKFIEQESTVRLSNTSMQKDAPWGLHRISH 185
            +F++ G F GY A   + +I++ +  +PL+ ++E++S V  S    Q +APWGL RISH
Sbjct: 187 DTFEVAGAFSGYIATVASPKIVDFIRLNPLVDYVEKDSVVH-SLDETQNNAPWGLARISH 245

Query: 186 REKAKYGQDLEYLY-EDAAGRGVTSYVLDTGIDTEHEDFEGRAVWGAVIPGNDEASDLNG 244
           RE    G   +YLY  ++AG+GVT+YV+DTGI   H +F  RA WG  IP ND   D NG
Sbjct: 246 REGLNLGNFNKYLYASNSAGKGVTAYVVDTGISVSHLEFGERAKWGKTIPINDYDIDGNG 305

Query: 245 HGTHCAGIIGSKHYGVAKNTKLVAVKVLRSNGEGTVSDVIKGIEYVAREH---IESSRK- 300
           HGTHCAG IGS+HYGVAK   LVAVKVLRS+G GT+SDV+KG+E+VA EH   +E SRK 
Sbjct: 306 HGTHCAGTIGSEHYGVAKGANLVAVKVLRSDGSGTMSDVLKGVEWVALEHTKHLEESRKD 365

Query: 301 KSKEFKGSTANLSLGSSKSLAMEMAVDAAVDSGVHFAIAAGNENEDACLSSPAGAQKSIT 360
           K+  +KG+TAN+SLG  KS A++ AV+AAV +GVHFA+AAGNEN+DAC SSPA A+ +IT
Sbjct: 366 KNSNYKGATANMSLGGGKSPALDQAVNAAVKAGVHFAVAAGNENQDACNSSPAAAENAIT 425

Query: 361 VGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGMLSYF 420
           VGAST SDDRA+FSN+G CVD+FAPG+NI+STYIG+ +AT +LSGTSMA+PHVAG+L+Y 
Sbjct: 426 VGASTLSDDRAYFSNYGKCVDIFAPGLNILSTYIGTNDATATLSGTSMASPHVAGLLTYL 485

Query: 421 LSLQPAPDSEYF--DNALSPQELKEKVLKFSTHGVLGDIGDNTPNRLIYNGG 470
           LSLQP   SE++  ++ L+P ++K+K++ ++T   L D+  +TPN+LIYNGG
Sbjct: 486 LSLQPDKGSEFYVPNSELTPLQMKKKIIDYATKNALADLPADTPNKLIYNGG 537

>KAFR0B06550 Chr2 (1359770..1361140) [1371 bp, 456 aa] {ON} Anc_6.14
           YOR003W
          Length = 456

 Score =  400 bits (1029), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 198/351 (56%), Positives = 249/351 (70%), Gaps = 6/351 (1%)

Query: 129 FDINGLFRGYAGYFTDEILNLVSQDPLIKFIEQESTVRLSNTSMQKDAPWGLHRISHREK 188
           F I     GY      E L L+ QDP+++ IE +S V      +Q+D PWGL RIS R +
Sbjct: 108 FKIGTTLSGYILRGPIETLQLLRQDPIVQLIEPDSKVHALKLKIQEDTPWGLSRISQRPR 167

Query: 189 AKYGQDLEYLYEDAAGRGVTSYVLDTGIDTEHEDFEGRAVWGAVIPGNDEASDLNGHGTH 248
            + GQD  Y Y+DA    VT+YVLDTGI   HE F GRA WG  I  ND   D +GHGTH
Sbjct: 168 VRIGQDQLYYYDDATSGNVTAYVLDTGIMISHEQFNGRARWGKTIVPNDVDEDNSGHGTH 227

Query: 249 CAGIIGSKHYGVAKNTKLVAVKVLRSNGEGTVSDVIKGIEYVAREHIESSRKKSKEF-KG 307
            AGII S  +GVAK  ++VAVKVLRSNGEG +SDV+KGIE+V  +H      K+K + KG
Sbjct: 228 VAGIIASDKFGVAKTCEVVAVKVLRSNGEGDMSDVLKGIEFVVDDH-----SKNKNYSKG 282

Query: 308 STANLSLGSSKSLAMEMAVDAAVDSGVHFAIAAGNENEDACLSSPAGAQKSITVGASTFS 367
           S  NLSLG+SKS A+ +A+DAA+   +HFA+AAGNEN DAC +SPA A+++ITVGAS FS
Sbjct: 283 SVVNLSLGASKSPALVLAIDAAISENIHFAVAAGNENMDACYTSPADARRAITVGASIFS 342

Query: 368 DDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGMLSYFLSLQPAP 427
           D+RAFFSNWG CVDVFAPG+N+MSTYIGS NATLSLSGTS AAP+ AG+++Y+LSLQP  
Sbjct: 343 DERAFFSNWGECVDVFAPGMNVMSTYIGSDNATLSLSGTSAAAPYTAGLIAYYLSLQPDK 402

Query: 428 DSEYFDNALSPQELKEKVLKFSTHGVLGDIGDNTPNRLIYNGGGKILDDLW 478
           DS YF   ++P +LKEK++ F +  VL ++ +NTPN +IYNG G+ L   W
Sbjct: 403 DSGYFTGEMTPSKLKEKIVAFGSKDVLYELPENTPNIVIYNGAGRNLSHFW 453

>NCAS0D02630 Chr4 (506222..507577) [1356 bp, 451 aa] {ON} Anc_6.14
          Length = 451

 Score =  390 bits (1003), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 208/423 (49%), Positives = 273/423 (64%), Gaps = 27/423 (6%)

Query: 62  HKTELIPYRYIVVFNEDISIKSIESHRKMVQEAHSVSVSKLAEDDVFLEVVSSSIAPDLQ 121
           H    IP +YIV+F  D +    E+H        +++   L  D  +  + S  +A DLQ
Sbjct: 48  HAASPIPNQYIVLFKSDTTDIQRETHLA------TLNSWLLNTDPQYTILHSFQLAHDLQ 101

Query: 122 LGGIDSSFDINGLFRGYAGYFTDEILNLVSQDPLIKFIEQESTVRLSNTSMQKDAPWGLH 181
                          GY     ++++  ++ DP+I+ IEQ+S V       Q D+PWGL 
Sbjct: 102 ---------------GYTSRLPEQLIRSLATDPIIQSIEQDSYVHALGRQKQIDSPWGLA 146

Query: 182 RISHREKAKYGQDLEYLYEDA-AGRGVTSYVLDTGIDTEHEDFEGRAVWGAVI-PGNDEA 239
           RIS RE+ K  QD  Y Y+D+ A      Y+LDTGI+  H +F+GRA WGAV  P     
Sbjct: 147 RISQRERLKLLQDQFYHYDDSGASSNTKCYILDTGINENHNEFQGRAKWGAVFTPMEPNQ 206

Query: 240 SDLNGHGTHCAGIIGSKHYGVAKNTKLVAVKVLRSNGEGTVSDVIKGIEYVAREHIESSR 299
            D NGHGTHCAG+IGS  YGVAKNT L+AVKVL + G+G +S VI+GIEYV ++H +  +
Sbjct: 207 EDENGHGTHCAGVIGSHEYGVAKNTTLIAVKVLDARGDGEMSAVIRGIEYVTQQHEQDMK 266

Query: 300 KKSKE-FKGSTANLSLGSSKSLAMEMAVDAAVDSGVHFAIAAGNENEDACLSSPAGAQKS 358
           K+ +  FKGS  NLSLG+ KS A+   ++AAV  GVHFA+AAGNE++DAC +SPA +  +
Sbjct: 267 KQDQTGFKGSVINLSLGAGKSPALLRVIEAAVKLGVHFAVAAGNEDDDACSTSPADSPHA 326

Query: 359 ITVGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSR-NATLSLSGTSMAAPHVAGML 417
           +TVGAS+FSDDR FFSNWG CVDVFAPGINIMSTYIG   N T SLSGTSM+AP V G++
Sbjct: 327 LTVGASSFSDDRVFFSNWGPCVDVFAPGINIMSTYIGPHNNETTSLSGTSMSAPFVTGLI 386

Query: 418 SYFLSLQPAPDSEYFDNALSPQ--ELKEKVLKFSTHGVLGDIGDNTPNRLIYNGGGKILD 475
           +YFLSLQP   S+++    SP   +LK K++ FST GVL +I + TPNR++YNGGG  L 
Sbjct: 387 AYFLSLQPDTKSQFYTGITSPTPYQLKYKIISFSTEGVLHEIPEGTPNRIVYNGGGHSLK 446

Query: 476 DLW 478
           D W
Sbjct: 447 DFW 449

>NDAI0I02280 Chr9 complement(519169..520617) [1449 bp, 482 aa] {ON} 
          Length = 482

 Score =  353 bits (907), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 200/426 (46%), Positives = 277/426 (65%), Gaps = 19/426 (4%)

Query: 63  KTELIPYRYIVVFNEDISIKSIESHRKMVQEAHSVSVSKLAEDDVFLEVVSS-SIAPDLQ 121
           +   IP +YIV+F  D +   I    + +         K   +D + +V+S   I+ D +
Sbjct: 59  QKNFIPDQYIVLFENDTTDLQISRFEQFLSSLIEEDNQKYNVNDNYSKVLSRFQISNDTK 118

Query: 122 LGGIDSSFDINGLFRGYAGYFTDEILNLVSQDPLIKFIEQESTVRLSNTSMQKDAPWGLH 181
              I +  D          +  D   N+ +   +IK IE++S V ++  + Q D+ WGL 
Sbjct: 119 GMIIRAPID---------DFLEDVKNNIFNYQKIIKIIERDSYVHMNKFTTQIDSSWGLS 169

Query: 182 RISHREKAKYGQDLEYLYED-AAGRGVTSYVLDTGIDTEHEDFEGRAVWGAVIPGNDEA- 239
           RIS R   K  QD  Y Y+D  +G+GV  Y+LDTGI++ H +FEGRA WG  +P  + + 
Sbjct: 170 RISQRNHLKLLQDQFYFYDDNGSGKGVDCYILDTGINSNHIEFEGRASWGVSLPVTEPSL 229

Query: 240 SDLNGHGTHCAGIIGSKHYGVAKNTKLVAVKVLRSNGEGTVSDVIKGIEYVAREH----- 294
            D NGHGTHCAGIIGSK YGVAK T L+AVKVL   G+G++SDVI G+E+VA  H     
Sbjct: 230 EDSNGHGTHCAGIIGSKTYGVAKETNLIAVKVLDFKGDGSMSDVILGLEFVANSHTNKTN 289

Query: 295 -IESSRKKSKEFKGSTANLSLGSSKSLAMEMAVDAAVDSGVHFAIAAGNENEDACLSSPA 353
            I SS     EFKGS  NLSLG+ KS ++++A+++A   G+H  +AAGNE+EDAC++SPA
Sbjct: 290 NISSSSSVHSEFKGSVVNLSLGAPKSPSLDIALESAKKIGIHITVAAGNEDEDACMTSPA 349

Query: 354 GAQKSITVGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIG-SRNATLSLSGTSMAAPH 412
            +   ITVGAS+FSDDRAFFSNWG CVDVFAPGINI STYIG + N TLSLSG+SM++P 
Sbjct: 350 DSPAVITVGASSFSDDRAFFSNWGPCVDVFAPGINIKSTYIGPNNNETLSLSGSSMSSPF 409

Query: 413 VAGMLSYFLSLQPAPDSEYFDNALSPQELKEKVLKFSTHGVLGDIGDNTPNRLIYNGGGK 472
           V+G+ +Y+LSLQP   S++ D+ ++P +LK K++ FST+G+L ++  +T N+L+YNGGGK
Sbjct: 410 VSGLTAYYLSLQPDVSSQFHDSLMTPDQLKRKIIDFSTNGMLKELPLDTANKLVYNGGGK 469

Query: 473 ILDDLW 478
            L   W
Sbjct: 470 DLSGFW 475

>KNAG0F02970 Chr6 (563666..564928) [1263 bp, 420 aa] {ON} 
          Length = 420

 Score =  342 bits (878), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 162/320 (50%), Positives = 225/320 (70%), Gaps = 5/320 (1%)

Query: 152 QDPLIKFIEQESTVRLSNTSMQKDAPWGLHRISHREKAKYGQDLEYLYED-AAGRGVTSY 210
           Q P ++ +E  S V   N ++Q+D PWGL R+S R++ + G +  Y Y+   + + V  Y
Sbjct: 101 QIPFVEMVETNSKVYALNVTVQEDVPWGLMRLSQRDRVRIGDEQVYRYDTRGSAKDVNVY 160

Query: 211 VLDTGIDTEHEDFEGRAVWGAVIPGNDEASDLNGHGTHCAGIIGSKHYGVAKNTKLVAVK 270
           +LDTGI  +HE+FEGRA WG  I  ND   D NGHGTHCAGI+G   YGVAK   L+AVK
Sbjct: 161 ILDTGIQVDHEEFEGRARWGKTIAWNDPDRDDNGHGTHCAGIVGGATYGVAKEANLIAVK 220

Query: 271 VLRSNGEGTVSDVIKGIEYVAREHIESSRKKSKEFKGSTANLSLGSSKSLAMEMAVDAAV 330
           VL + G+G +SDVI+GIE+   EH+    +   E +GS  NLSLG+ +S A++  V AA+
Sbjct: 221 VLHATGDGEMSDVIRGIEFAVNEHLT---RNQDEVRGSIINLSLGAGESPALQRVVTAAL 277

Query: 331 DSGVHFAIAAGNENEDACLSSPAGAQKSITVGASTFSDDRAFFSNWGTCVDVFAPGINIM 390
           + GVHFA+AAGNE+++AC SSPA     +TVG STFSDDRAFFSNWG C+DVFAPG+N+ 
Sbjct: 278 NKGVHFAVAAGNEDDNACYSSPANIDGVVTVGGSTFSDDRAFFSNWGPCIDVFAPGVNVK 337

Query: 391 STYIG-SRNATLSLSGTSMAAPHVAGMLSYFLSLQPAPDSEYFDNALSPQELKEKVLKFS 449
           S+Y+G ++N TLSLSGTS +APHVAG+++Y LSL+P   S++     +P +LK+K++  +
Sbjct: 338 SSYVGAAKNKTLSLSGTSTSAPHVAGLMAYLLSLEPDTKSQFHTAWSNPAQLKQKLVSLA 397

Query: 450 THGVLGDIGDNTPNRLIYNG 469
           T G L ++ D+T N +I+NG
Sbjct: 398 TEGKLFEVPDDTANLMIFNG 417

>CAGL0L13266g Chr12 (1418408..1420147) [1740 bp, 579 aa] {ON} some
           similarities with uniprot|P09232 Saccharomyces
           cerevisiae YEL060c or uniprot|P25036 Saccharomyces
           cerevisiae YOR003w YSP3
          Length = 579

 Score =  276 bits (707), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 151/429 (35%), Positives = 236/429 (55%), Gaps = 13/429 (3%)

Query: 57  GLDNTHKTELIPYRYIVVFNEDISIKSIESHRKMVQEAHSVSVSKLAEDDVFLEVVSSSI 116
           G ++  +  ++PYRYIV+F        I+ H + V +        LA +D F        
Sbjct: 59  GENDEIQNNIVPYRYIVMFKNFAYTNEIKLHIQTVAKLQLRGSISLAPNDPFFHHTRDKE 118

Query: 117 APDLQLGGIDSSFDINGLFRGYAGYFTDEILNLVSQDPLIKFIEQESTVRLSNTSMQKDA 176
               +LGG+  +FDI   F GY GYFTDE++  + +  ++ ++E +S + + +     ++
Sbjct: 119 FSTEELGGVLYTFDIGSGFNGYVGYFTDEVVEFIRKQSIVDYVEMDSILTIDDKETDSNS 178

Query: 177 PWGLHRISHREKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDTEHEDFEGRAVWGAVIPGN 236
            W L RISHR K       EY ++   G+ + +Y+LDTG+   H  +  R + G VI  N
Sbjct: 179 HWHLARISHRPKLGLSNFNEYKFDPNGGQNIDAYILDTGVYQTHAYYIERTIRGIVITPN 238

Query: 237 DEASDLNGHGTHCAGIIGSKHYGVAKNTKLVAVKVLRSNGEGTVSDVIKGIEYVAREHIE 296
           ++  D+NGHGT  AG++G +  GVA+   L+ VKVL   G GTVS++IKG+ +V   H +
Sbjct: 239 EDERDMNGHGTEMAGLVGGREVGVARKATLIDVKVLNWQGRGTVSNIIKGLSFVNHHHPQ 298

Query: 297 SSRKKSKEFKGSTANLSLGSSKSLAMEMAVDAAVDSGVHFAIAAGNENEDACLSSPAGAQ 356
             R +     G+    S+  +KS ++  A D  V SG+H  + AG +  +AC SSPA + 
Sbjct: 299 --RIEKNGVLGAVVLFSISGAKSRSLNTAFDKMVSSGIHVVVGAGTKGINACNSSPASSS 356

Query: 357 KSITVGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIG-SRNA---TLSLSGTSMAAPH 412
           K ITV   + +D+     NWG+CVD++ PG  + +TY    RN     +S++G+S AA  
Sbjct: 357 KPITVAGMSITDEPIDRGNWGSCVDIYGPGDRVRTTYPNLERNQFTNEISVTGSSAAAAQ 416

Query: 413 VAGMLSYFLSLQP---APDSEYFDNALSPQELKEKVLKFSTHGVLGDIGDNTPNRLIYNG 469
           VAG+L+YF SLQP    PD       L+P+ELKE+++ F T G L ++   +PN + +NG
Sbjct: 417 VAGLLAYFASLQPGLGTPDVI----PLTPEELKERLIDFGTKGKLTNLERMSPNIIAFNG 472

Query: 470 GGKILDDLW 478
            G  LD  +
Sbjct: 473 AGGNLDSFF 481

>NCAS0D04390 Chr4 complement(836796..838274) [1479 bp, 492 aa] {ON}
           Anc_6.313
          Length = 492

 Score =  216 bits (551), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 141/386 (36%), Positives = 208/386 (53%), Gaps = 62/386 (16%)

Query: 125 IDSSFDINGLFRGYAGYFTDEILNLVSQDPLIKFIEQESTVRL----------------- 167
           I  +F I G F+G+    TD++L  + ++PL+  +     V                   
Sbjct: 58  IGKTFSI-GSFKGFTVDLTDDLLEAIKKNPLVSDVVPNLRVHAFEDVKDEEGDDDGGQFD 116

Query: 168 -------SNTSMQKDAPWGLHRISHR--------EKAKYGQDLEYLYED-AAGRGVTSYV 211
                   +  +Q  AP  L R+S R        +K  Y   L+Y Y+  + G  V +Y+
Sbjct: 117 NKMQKGKCSVKVQYGAPRHLARLSRRKQLPYDFEDKEAYLDSLKYFYDKRSQGASVNAYI 176

Query: 212 LDTGIDTEHEDFEGRAVWGAVIPGNDEASDLNGHGTHCAGIIGSKHYGVAKNTKLVAVKV 271
           +D+GI  EHE+F GRA+ G  + G + + D NGHGTH AGI+GSK YGVAK  KL+ +KV
Sbjct: 177 IDSGIYLEHEEFNGRAIPGIDLTG-EGSGDYNGHGTHVAGIVGSKSYGVAKKVKLIEIKV 235

Query: 272 LRSNGEGTVSDVIKGIEYVAREHIESSRKKSKEFKGSTANLSLGSSKSLAMEMAVDAAVD 331
           L   G+G+++ V+ GIE+ A +H + + KK +      ANLSLGS ++  +  A+ AA+D
Sbjct: 236 LNRLGQGSLAMVLGGIEF-AVKHCQETSKKGR----CVANLSLGSMRTAILNKAIKAAID 290

Query: 332 SGVHFAIAAGNENEDACLSSPAGAQKSITVGASTFSDDR----AFFSNWGTCVDVFAPGI 387
           +G+   +AAGN N +AC  SPA A ++ITVGA    DDR    A FSNWG C+D+FAPG+
Sbjct: 291 AGLVVVVAAGNNNLNACWYSPASAPEAITVGA---FDDRIDAIAKFSNWGQCLDIFAPGV 347

Query: 388 NIMSTYIGSRNATLSLSGTSMAAPHVAGMLSYFLSLQPAPDSEYFDNALSPQELKEKVLK 447
            I S  I      ++ SGTSMA+P VAG+ +  L           D  +S +E+K+ +L+
Sbjct: 348 VIKSLSIFKDKEDVTYSGTSMASPTVAGLAALTL-----------DQGVSAEEVKDYILE 396

Query: 448 FSTHGVLGD----IGDNTPNRLIYNG 469
             T  V           TPN++ +NG
Sbjct: 397 MGTDNVFHRRSLLFKPGTPNKICFNG 422

>ZYRO0D08822g Chr4 (754340..755812) [1473 bp, 490 aa] {ON} similar
           to uniprot|P25381 Saccharomyces cerevisiae YCR045C
           Hypothetical ORF
          Length = 490

 Score =  214 bits (546), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 137/391 (35%), Positives = 207/391 (52%), Gaps = 54/391 (13%)

Query: 96  SVSVSKLAEDDVFLEVVSSSIAPDLQLGGIDSSFDINGLFRGYAGYFTDEILNLVSQDPL 155
           +V +S+   + +    + + + P++Q    D    +  L + Y G       NL  +D  
Sbjct: 65  TVDISQDVVEKIRNNPLVADLVPNIQFKAFDDVLGVQELQQNYHGD------NLDDEDGF 118

Query: 156 IKFIEQESTVRLSNTSMQKDAPWGLHRISHREKAKYGQDLEYLYEDA---------AGRG 206
             F             +Q +AP  L R+S R    Y  D E  YE++          GR 
Sbjct: 119 NPF----------KVKVQGEAPRHLARLSRRAPLPYEFDDELRYEESFNYYYYKWHKGRN 168

Query: 207 VTSYVLDTGIDTEHEDFEGRAVWGAVIPGNDEASDLNGHGTHCAGIIGSKHYGVAKNTKL 266
           + +Y++DTGI  EH+DF GRA++G    G +   D NGHGTH AGI+GS ++GVAK   L
Sbjct: 169 INAYIIDTGIYKEHKDFCGRAIFGRDFTG-EGPGDRNGHGTHVAGIVGSSNFGVAKKVNL 227

Query: 267 VAVKVLRSNGEGTVSDVIKGIEYVAREHIESSRKKSKEFKGSTANLSLGSSKSLAMEMAV 326
           + VK L + G+G ++ VI  +E+ A  H +SS K     KG  ANLSLG+ ++  +  A+
Sbjct: 228 IEVKALNNRGQGNLTTVISAVEF-AVNHCKSSGK-----KGCVANLSLGAVRNSVINQAI 281

Query: 327 DAAVDSGVHFAIAAGNENEDACLSSPAGAQKSITVGASTFSDDR----AFFSNWGTCVDV 382
            AA ++G+   +AAGN N +AC +SPA A ++ITVGA    DDR    A FSNWG CVD+
Sbjct: 282 KAAHEAGLIIVVAAGNSNINACWNSPASAPEAITVGA---FDDRTDTIAKFSNWGPCVDI 338

Query: 383 FAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGMLSYFLSLQPAPDSEYFDNALSPQELK 442
           FA G+ + S      +  ++ SGTSMA+P V G+++  L           D  + P+ +K
Sbjct: 339 FASGVKVKSLSAFPPHKPIAFSGTSMASPSVTGLVAILL-----------DKGVEPENIK 387

Query: 443 EKVLKFSTHGVLGD----IGDNTPNRLIYNG 469
            K+++ +TH +L          TPNR+ +NG
Sbjct: 388 AKLVELATHDLLQRRTLFFKPGTPNRIAFNG 418

>Suva_3.84 Chr3 complement(121533..123116) [1584 bp, 527 aa] {ON}
           YCR045C (REAL)
          Length = 527

 Score =  213 bits (541), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 145/391 (37%), Positives = 203/391 (51%), Gaps = 56/391 (14%)

Query: 125 IDSSFDINGLFRGYAGYFTDEILNLVSQDPLI-------KFIEQESTVRLS--------- 168
           I+  F I G FRG     +  ++N + + PLI       KF   ++   LS         
Sbjct: 89  IEKKFSI-GSFRGVTMNLSKNLVNKLKKSPLIADIVPNFKFEAFDTDAELSYMFNTTAKY 147

Query: 169 ---------NTSMQKDAPWGLHRISHR--------EKAKYGQDLEYLYEDA-AGRGVTSY 210
                    N + Q DAP  L RIS          +K +Y     Y YED   G+GV +Y
Sbjct: 148 AYQDIDEAQNVTYQPDAPRHLARISRHHQLPFDLEDKDRYKSWFNYYYEDEYQGQGVNAY 207

Query: 211 VLDTGIDTEHEDFEGRAVWGAVIPGNDEASDLNGHGTHCAGIIGSKHYGVAKNTKLVAVK 270
           ++DTGI  EH +FE R + G  +   +   D NGHGTH AG++GS+ +G AK   LV VK
Sbjct: 208 IMDTGIHAEHPEFEDRVIQGVDL-TKEGFGDENGHGTHVAGLVGSRTFGAAKKVSLVEVK 266

Query: 271 VLRSNGEGTVSDVIKGIEYVAREHIESSRKKSKEFKGSTANLSLGSSKSLAMEMAVDAAV 330
           VL  +G G  S+V+ G+E++     + SR + K+     ANLSLGS +S  + MAV+ A+
Sbjct: 267 VLGKDGSGEASNVLSGLEFIVEHCTKVSRPQGKK---CVANLSLGSFRSPIINMAVEGAI 323

Query: 331 DSGVHFAIAAGNENEDACLSSPAGAQKSITVGA-STFSDDRAFFSNWGTCVDVFAPGINI 389
           + G+ F  AAGN N DA  +SPA A+  ITVGA     D  A FSNWG CV++FAPG+ I
Sbjct: 324 EEGIVFVAAAGNFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEI 383

Query: 390 MSTYIGSRNATLSLSGTSMAAPHVAGMLSYFLSLQPAPDSEYFDNALSPQELKEKVLKFS 449
            S    + N +L LSGTSM+ P V G+ +  LS             + P+ + +++   S
Sbjct: 384 ESLSHLNDNESLVLSGTSMSTPIVTGVAAVLLS-----------KGIEPELIAQEIEYLS 432

Query: 450 THGVLGD----IGDNTPNRLIYNGGGKILDD 476
           T  V          +TPN+++YNG  K LDD
Sbjct: 433 TRNVFHRRTLFFKPSTPNQILYNGVDK-LDD 462

>SAKL0A02002g Chr1 (176105..177544) [1440 bp, 479 aa] {ON} similar
           to uniprot|P25381 Saccharomyces cerevisiae YCR045C
           Hypothetical ORF
          Length = 479

 Score =  211 bits (536), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 135/364 (37%), Positives = 193/364 (53%), Gaps = 49/364 (13%)

Query: 133 GLFRGYAGYFTDEILNLVSQDPLIKFIEQESTVRLSNTS------------MQKDAPWGL 180
           G F G+   F  + +  + ++PL+  +   S   + +              +Q+DAP  L
Sbjct: 59  GKFEGFTADFPKDFVEKLKKNPLVADVVPNSVFNVFDQKEQIAEEYSRRYKVQEDAPRHL 118

Query: 181 HRISHREKAKYG------QDLEYLYEDA-AGRGVTSYVLDTGIDTEHEDFEGRAVWGAVI 233
            R+S R    Y       Q+  Y Y+    G  V +Y++DTGI  +H+D  GRA +GA +
Sbjct: 119 ARLSRRGPLPYSEEDGWYQEFNYYYDRKHRGDSVNAYIIDTGIYKQHKDLGGRAYFGADM 178

Query: 234 PGNDEASDLNGHGTHCAGIIGSKHYGVAKNTKLVAVKVLRSNGEGTVSDVIKGIEYVARE 293
            G +   D NGHGTH AGI+GS+ +GVAK   LV VK L + G+G ++ VI  IE+    
Sbjct: 179 VG-EGPGDYNGHGTHVAGIVGSRTFGVAKKVNLVEVKALNAKGQGNLTSVISSIEFSVNH 237

Query: 294 HIESSRKKSKEFKGSTANLSLGSSKSLAMEMAVDAAVDSGVHFAIAAGNENEDACLSSPA 353
                 KKS       ANLSLGS ++  +  AV+AAV+SG+   +AAGN N +AC +SPA
Sbjct: 238 C-----KKSGML--CVANLSLGSLRNTVLNQAVEAAVESGLVVVVAAGNSNVNACWNSPA 290

Query: 354 GAQKSITVGASTFSDDR----AFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMA 409
            A  +ITVGA    DDR    A FSNWG CVDVFA G+ +MS         ++ SGTSMA
Sbjct: 291 SAISAITVGA---FDDRTDTIAKFSNWGMCVDVFASGVKVMSLSNMPPFKPVAYSGTSMA 347

Query: 410 APHVAGMLSYFLSLQPAPDSEYFDNALSPQELKEKVLKFSTHGVLGD----IGDNTPNRL 465
           +P VAG+ +  L           D+ + P ++K+K++  +T  V           TPNR+
Sbjct: 348 SPSVAGLAAVLL-----------DSGIDPPDIKQKIIDLATENVFQKRTLVFKPGTPNRI 396

Query: 466 IYNG 469
            +NG
Sbjct: 397 AFNG 400

>KLTH0A06094g Chr1 complement(513667..515157) [1491 bp, 496 aa] {ON}
           similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045C Hypothetical ORF
          Length = 496

 Score =  211 bits (536), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 131/323 (40%), Positives = 181/323 (56%), Gaps = 40/323 (12%)

Query: 173 QKDAPWGLHRISHREKAKY--------GQDLEYLYEDA-AGRGVTSYVLDTGIDTEHEDF 223
           QK AP  L RIS R    Y          +  Y Y+D  +G  V +YV+DTGI  EH   
Sbjct: 135 QKKAPRHLARISRRTALPYDPENISVPATNFSYYYDDEFSGTCVNAYVIDTGIYKEHPQL 194

Query: 224 EGRAVWGAVIPGNDEASDLNGHGTHCAGIIGSKHYGVAKNTKLVAVKVLRSNGEGTVSDV 283
           EGRA +GA + G +   D NGHGTH AG+IGS+ +GVAK+  L+ VK L + G+G ++ V
Sbjct: 195 EGRAKFGADLVG-EGPGDFNGHGTHVAGLIGSRKFGVAKDVSLIEVKALNAKGQGNLTSV 253

Query: 284 IKGIEYVAREHIESSRKKSKEFKGSTANLSLGSSKSLAMEMAVDAAVDSGVHFAIAAGNE 343
           I  IE+    H   SR+      G  ANLSLGS ++  +  AV+AA+++GV   +AAGN 
Sbjct: 254 ISAIEFTV-NHCRKSRR------GCVANLSLGSFRNTVLNQAVEAALEAGVVIVVAAGNS 306

Query: 344 NEDACLSSPAGAQKSITVGASTFSDDR----AFFSNWGTCVDVFAPGINIMSTYIGSRNA 399
           N +AC SSPA +  +ITVGA    DDR    A FSNWG CVD+FAPG+ I S        
Sbjct: 307 NANACWSSPASSLSAITVGA---FDDRTDTIARFSNWGNCVDIFAPGVKIESLSNVPPFK 363

Query: 400 TLSLSGTSMAAPHVAGMLSYFLSLQPAPDSEYFDNALSPQELKEKVLKFSTHGVLGD--- 456
            ++ SGTSMA+P V+GM++  L           D+ + P ++K +++  +T  V      
Sbjct: 364 PVAFSGTSMASPIVSGMVANLL-----------DSGIHPFDIKTELIDLATDSVFHKRTL 412

Query: 457 -IGDNTPNRLIYNGGGKILDDLW 478
                TPNR+ + G  K  DD++
Sbjct: 413 LFKPGTPNRVAFTGIDKT-DDVY 434

>YCR045C Chr3 complement(208135..209610) [1476 bp, 491 aa] {ON}
           RRT12Probable subtilisin-family protease with a role in
           formation of the dityrosine layer of spore walls;
           localizes to the spore wall and also the nuclear
           envelope and ER region in mature spores
          Length = 491

 Score =  207 bits (527), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 131/322 (40%), Positives = 179/322 (55%), Gaps = 30/322 (9%)

Query: 169 NTSMQKDAPWGLHRISHR--------EKAKYGQDLEYLYE-DAAGRGVTSYVLDTGIDTE 219
           N + Q DAP  L RIS          +K +Y     Y YE D  G+ V +Y++DTGI  +
Sbjct: 121 NITYQPDAPRHLARISRHYQLPFDVGDKDRYKSWFNYYYEHDYQGQDVNAYIMDTGIFAD 180

Query: 220 HEDFEGRAVWGAVIPGNDEASDLNGHGTHCAGIIGSKHYGVAKNTKLVAVKVLRSNGEGT 279
           H +FE R + G  +   +   D NGHGTH AG++GSK YG AK   LV VKVL  +G G 
Sbjct: 181 HPEFEDRVIQGIDL-TKEGFGDQNGHGTHVAGLVGSKTYGAAKRVNLVEVKVLGKDGSGE 239

Query: 280 VSDVIKGIEYVAREHIESSRKKSKEFKGSTANLSLGSSKSLAMEMAVDAAVDSGVHFAIA 339
            S+V+ G+E++     + SR + K+     ANLSLGS +S  + MAV+ A++ G+ F  A
Sbjct: 240 ASNVLSGLEFIVEHCTKVSRPQGKK---CVANLSLGSFRSPIINMAVEGAIEEGIVFVAA 296

Query: 340 AGNENEDACLSSPAGAQKSITVGA-STFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRN 398
           AGN N DA  +SPA A+  ITVGA     D  A FSNWG CV++FAPG+ I S    + N
Sbjct: 297 AGNFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIESLSHLNYN 356

Query: 399 ATLSLSGTSMAAPHVAGMLSYFLSLQPAPDSEYFDNALSPQELKEKVLKFSTHGVLGD-- 456
            TL LSGTSM+ P V G+ +  LS             + P+ + +++   ST  V     
Sbjct: 357 DTLILSGTSMSTPIVTGVAAILLS-----------KGIEPEMIAQEIEYLSTRNVFHRRT 405

Query: 457 --IGDNTPNRLIYNGGGKILDD 476
                +TPN+++YNG  K LDD
Sbjct: 406 LFFKPSTPNQILYNGVDK-LDD 426

>Smik_3.149 Chr3 complement(206258..207733) [1476 bp, 491 aa] {ON}
           YCR045C (REAL)
          Length = 491

 Score =  207 bits (526), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 131/324 (40%), Positives = 179/324 (55%), Gaps = 30/324 (9%)

Query: 169 NTSMQKDAPWGLHRISH--------REKAKYGQDLEYLYED-AAGRGVTSYVLDTGIDTE 219
           N + Q DAP  L RIS          +K +Y     Y YED   G+ V +Y++DTGI  +
Sbjct: 121 NITYQSDAPRHLARISRHYQLPFDIEDKERYKSWFNYYYEDDYQGQDVNAYIMDTGIFAD 180

Query: 220 HEDFEGRAVWGAVIPGNDEASDLNGHGTHCAGIIGSKHYGVAKNTKLVAVKVLRSNGEGT 279
           H +FE R + G  +   +   D NGHGTH AG++GSK YG AK   LV VKVL  +G G 
Sbjct: 181 HPEFEDRVIQGIDLT-KEGFGDQNGHGTHVAGLVGSKTYGAAKKVNLVEVKVLGKDGSGE 239

Query: 280 VSDVIKGIEYVAREHIESSRKKSKEFKGSTANLSLGSSKSLAMEMAVDAAVDSGVHFAIA 339
            S+V+ G+E++       SR + K+     ANLSLGS +S  + MAV+ A++ G+ F  A
Sbjct: 240 ASNVLSGLEFIVEHCTRVSRPQGKK---CVANLSLGSFRSPIINMAVEGAIEEGIVFVAA 296

Query: 340 AGNENEDACLSSPAGAQKSITVGA-STFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRN 398
           AGN N DA  +SPA A+  ITVGA     D  A FSNWG CV++FAPG+ I S    + N
Sbjct: 297 AGNFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIESLSHLNFN 356

Query: 399 ATLSLSGTSMAAPHVAGMLSYFLSLQPAPDSEYFDNALSPQELKEKVLKFSTHGVLGD-- 456
            TL LSGTSM+ P V G+ +  LS             + P+ + +++   ST  V     
Sbjct: 357 DTLVLSGTSMSTPIVTGVAAVLLS-----------KGIEPEMIAQELEYLSTRNVFHRRT 405

Query: 457 --IGDNTPNRLIYNGGGKILDDLW 478
                +TPN+++YNG  K LDD +
Sbjct: 406 LFFKPSTPNQILYNGVDK-LDDRY 428

>Kpol_1028.61 s1028 (138312..139868) [1557 bp, 518 aa] {ON}
           (138312..139868) [1557 nt, 519 aa]
          Length = 518

 Score =  205 bits (522), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 129/318 (40%), Positives = 182/318 (57%), Gaps = 37/318 (11%)

Query: 171 SMQKDAPWGLHRISHR--------EKAKYGQDLEYLYEDA-AGRGVTSYVLDTGIDTEHE 221
           ++Q  AP  L RIS R         + ++ + + Y YED   G  + +Y+LDTGI  EH 
Sbjct: 152 NVQYGAPRHLGRISSRGQLPFDIRNENEFKEFIHYYYEDQFKGSNIAAYILDTGIYAEHP 211

Query: 222 DFEGRAVWGAVIPGNDEASDLNGHGTHCAGIIGSKHYGVAKNTKLVAVKVLRSNGEGTVS 281
           DFE R + GA + G +   D NGHGTH AGI+GSK +GVAKN  LV VKVL   G G ++
Sbjct: 212 DFENRVIVGADMTG-EGPGDSNGHGTHVAGILGSKTFGVAKNVTLVEVKVLTGRGSGNLT 270

Query: 282 DVIKGIEYVAREHIESSRKKSKEFKGSTANLSLGSSKSLAMEMAVDAAVDSGVHFAIAAG 341
            V+ GI++ A +H    R+   + K   AN+SLG+ ++  +  A+  A  +G+   +AAG
Sbjct: 271 TVLSGIQF-AVDHCRLMRE--TQGKQCVANMSLGTVRNNIINAAIHEAFKAGLIMVVAAG 327

Query: 342 NENEDACLSSPAGAQKSITVGASTFSDDR----AFFSNWGTCVDVFAPGINI--MSTYIG 395
           N N  AC +SPA A+ +ITVGA    DDR    A+FSNWG CVD+FAPG+ I  +S    
Sbjct: 328 NSNVSACWTSPASAKNAITVGA---FDDRTETIAYFSNWGACVDIFAPGVKIRSLSNSPE 384

Query: 396 SRNATLSLSGTSMAAPHVAGMLSYFLSLQPAPDSEYFDNALSPQELKEKVLKFSTHGVLG 455
           S +  ++ SGTSMA+P VAG+ +  L           D  + P ++K+K+L  ST  V  
Sbjct: 385 SHHKHVTHSGTSMASPVVAGLAAILL-----------DKGVEPFDVKDKLLHLSTKDVFN 433

Query: 456 DI----GDNTPNRLIYNG 469
            +       TPN++ YNG
Sbjct: 434 KLTLFFKYGTPNKIAYNG 451

>Kpol_1018.5 s1018 (14365..15762) [1398 bp, 465 aa] {ON}
           (14365..15762) [1398 nt, 466 aa]
          Length = 465

 Score =  203 bits (516), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 126/322 (39%), Positives = 183/322 (56%), Gaps = 40/322 (12%)

Query: 172 MQKDAPWGLHRISHREKA--------KYGQDLEYLYEDAA--GRGVTSYVLDTGIDTEHE 221
           +Q++AP  L R+S R +         +Y    +Y Y DA   G  V +Y++DTGI  EH 
Sbjct: 114 IQREAPRHLSRLSRRGQLPYDINNIDRYDNAFDY-YFDAKYQGSSVNAYIIDTGIYKEHP 172

Query: 222 DFEGRAVWGAVIPGNDEASDLNGHGTHCAGIIGSKHYGVAKNTKLVAVKVLRSNGEGTVS 281
           +FEGR  + A+    +   D NGHGTH AGI+GSK +GVAK   ++ VK L   G+G +S
Sbjct: 173 EFEGRVKF-AIDLTQEGPGDENGHGTHIAGIVGSKTFGVAKKVNIIDVKALDKKGQGQLS 231

Query: 282 DVIKGIEYVAREHIESSRKKSKEFKGSTANLSLGSSKSLAMEMAVDAAVDSGVHFAIAAG 341
            ++K +E+  R   ES  KK        ANLS G+ ++  ++ A+  A ++G+   +AAG
Sbjct: 232 TILKALEFTIRHCKESVDKK------CVANLSFGAIRTAIIDEAIKEAHNAGIVLVVAAG 285

Query: 342 NENEDACLSSPAGAQKSITVGASTFSDDR----AFFSNWGTCVDVFAPGINIMSTYIGSR 397
           N N DAC +SPA ++  ITVGA    DDR    A FSNWG+CVDVFAPG+ + S    + 
Sbjct: 286 NSNIDACWNSPASSKDVITVGA---FDDRTETIARFSNWGSCVDVFAPGVKVKSLSHING 342

Query: 398 NATLSLSGTSMAAPHVAGMLSYFLSLQPAPDSEYFDNALSPQELKEKVLKFSTHGVLGD- 456
           +  L LSGTSMA+P V+G+ +  L           D  L+P+ +K K+++ ST  +    
Sbjct: 343 SDVLLLSGTSMASPSVSGIAAILL-----------DKGLNPKFVKSKIIESSTKNIFHQG 391

Query: 457 ---IGDNTPNRLIYNGGGKILD 475
              I  NTPN +++NG  K+ D
Sbjct: 392 TIMIKPNTPNLIVFNGIEKMDD 413

>TDEL0A07280 Chr1 complement(1276408..1277718) [1311 bp, 436 aa]
           {ON} Anc_6.313 YCR045C
          Length = 436

 Score =  201 bits (512), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 127/318 (39%), Positives = 179/318 (56%), Gaps = 39/318 (12%)

Query: 173 QKDAPWGLHRISHREKAKYGQDLE---------YLYEDA-AGRGVTSYVLDTGIDTEHED 222
           Q+ AP  L R+S R +  Y  + E         Y Y++   G G+ +Y++DTGI  EH +
Sbjct: 114 QRGAPRHLSRLSRRSQLPYDFEEEDDNYEGSFNYYYDNKHRGDGINAYIIDTGIYKEHAE 173

Query: 223 FEGRAVWGAVIPGNDEASDLNGHGTHCAGIIGSKHYGVAKNTKLVAVKVLRSNGEGTVSD 282
           F GRAV+G  + G +   D NGHGTH AGI+GS  YGVAK+  LV VK L + G+G ++ 
Sbjct: 174 FGGRAVFGEDLTG-EGPGDGNGHGTHVAGIVGSSKYGVAKDITLVEVKALTAKGQGNLTT 232

Query: 283 VIKGIEYVAREHIESSRKKSKEFKGSTANLSLGSSKSLAMEMAVDAAVDSGVHFAIAAGN 342
           VI  +E+ A  H  SS     E KG   NLSLG+ ++  +  AV AA ++G+   +AAGN
Sbjct: 233 VISAMEF-AVNHCRSS-----EGKGCVINLSLGAIRNSVINQAVKAAHEAGIVVVVAAGN 286

Query: 343 ENEDACLSSPAGAQKSITVGASTFSDDR----AFFSNWGTCVDVFAPGINIMSTYIGSRN 398
            N +ACL+SPA A ++ITVGA    DDR    A FSNWG+CVD+FAPG+ + S       
Sbjct: 287 SNINACLNSPASAPEAITVGA---FDDRTDSIAKFSNWGSCVDIFAPGVRVKSLASAPHL 343

Query: 399 ATLSLSGTSMAAPHVAGMLSYFLSLQPAPDSEYFDNALSPQELKEKVLKFSTHGVLGD-- 456
             +  SGTSMA+P + G+ +  L           D  +   ++K+ +LK +T+ V     
Sbjct: 344 KPILFSGTSMASPSITGLAAILL-----------DEGVPYDKIKDYILKMATNDVFQRRT 392

Query: 457 --IGDNTPNRLIYNGGGK 472
                 TPNR+ +NG  K
Sbjct: 393 LVFKPGTPNRVAFNGVKK 410

>KNAG0I02470 Chr9 complement(479068..480495) [1428 bp, 475 aa] {ON}
           Anc_6.313 YCR045C
          Length = 475

 Score =  200 bits (509), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 133/393 (33%), Positives = 202/393 (51%), Gaps = 54/393 (13%)

Query: 112 VSSSIAPDLQL---GGIDSSFDINGLFRGYAGYFTDEILNLVSQDPLIKFIEQESTVR-- 166
           ++S ++ DL+    G I+  F I G  +G     + ++L+ + + P +K +     V+  
Sbjct: 36  MNSVLSKDLKWFMGGKINKRFQI-GELKGLTMNLSHDVLDKIKRHPFVKEVVPNIMVKAF 94

Query: 167 ----------LSNTSMQKDAPWGLHRISHR--------EKAKYGQDLEYLYED-AAGRGV 207
                     L     Q+ AP  L RIS R         K +Y     Y Y+  A G   
Sbjct: 95  EGDAVEDESWLPKMKRQRGAPRHLARISRRMQLPYDMNNKTRYRDSFNYYYDRWAQGATT 154

Query: 208 TSYVLDTGIDTEHEDFEGRAVWGAVIPGNDEASDLNGHGTHCAGIIGSKHYGVAKNTKLV 267
            +Y+LDTG+  +H++FE R  +G    G  E  DLNGHGTH AG++GSK +GVAK+ +LV
Sbjct: 155 RAYILDTGVMRDHKEFEDRVEFGTDCTGEGEG-DLNGHGTHVAGLVGSKTFGVAKHVQLV 213

Query: 268 AVKVLRSNGEGTVSDVIKGIEYVAREHIESSRKKSKEFKGSTANLSLGSSKSLAMEMAVD 327
            VK L + G GT+  ++  +E+  ++  E       E      N+SLGS KS  +  A++
Sbjct: 214 DVKCLDALGAGTLVSILSALEFAVQDCQE------HEDSQCVLNMSLGSVKSNILNQAIN 267

Query: 328 AAVDSGVHFAIAAGNENEDACLSSPAGAQKSITVGASTFSDDR----AFFSNWGTCVDVF 383
                G+   +AAGN N +AC +SP+ A  +ITVGA    DDR    A FSNWG CVD+F
Sbjct: 268 EVEKKGIVVVVAAGNFNMNACWTSPSSATGAITVGA---FDDRFDTIAKFSNWGPCVDIF 324

Query: 384 APGINIMSTYIGSRNATLSLSGTSMAAPHVAGMLSYFLSLQPAPDSEYFDNALSPQELKE 443
           APG+N+ S       + +  SGTSMA+P V GM++  L           D+ + P+++++
Sbjct: 325 APGVNVASLVNRDWPSFVKYSGTSMASPIVCGMVALLL-----------DDGVPPEDIRD 373

Query: 444 KVLKFSTHGVLGD----IGDNTPNRLIYNGGGK 472
            + + +T GV           TPN ++YNG  K
Sbjct: 374 YLQELATDGVFKKRTLVFKPGTPNSVLYNGNKK 406

>Skud_3.124 Chr3 complement(192464..194086) [1623 bp, 540 aa] {ON}
           YCR045C (REAL)
          Length = 540

 Score =  201 bits (510), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 131/318 (41%), Positives = 176/318 (55%), Gaps = 22/318 (6%)

Query: 169 NTSMQKDAPWGLHRISH--------REKAKYGQDLEYLYED-AAGRGVTSYVLDTGIDTE 219
           N + Q DAP  L RIS          +K +Y     Y YED   G+ V +Y++DTGI ++
Sbjct: 170 NITYQSDAPRHLARISRHYQLPFDIEDKNRYKSWFNYYYEDDYLGQDVNAYIMDTGIFSD 229

Query: 220 HEDFEGRAVWGAVIPGNDEASDLNGHGTHCAGIIGSKHYGVAKNTKLVAVKVLRSNGEGT 279
           H +FE R + G  +   +   D NGHGTH AG++GSK YG AK   LV VKVL  +G G 
Sbjct: 230 HPEFEDRVIQGIDL-TKEGFGDQNGHGTHVAGLVGSKTYGAAKKVNLVEVKVLGKDGSGE 288

Query: 280 VSDVIKGIEYVAREHIESSRKKSKEFKGSTANLSLGSSKSLAMEMAVDAAVDSGVHFAIA 339
            S+V+ G+E++       SR + K+     ANLSLGS +S  + MAV+ A++ G+ F  A
Sbjct: 289 ASNVLSGLEFIVEHCTRVSRPQGKK---CVANLSLGSFRSPIINMAVEGAIEEGIVFVAA 345

Query: 340 AGNENEDACLSSPAGAQKSITVGA-STFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRN 398
           AGN N DA  +SPA A+  ITVGA     D  A FSNWG CV++FAPG+ I S    +  
Sbjct: 346 AGNFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIESLSHLNYE 405

Query: 399 ATLSLSGTSMAAPHVAGMLSYFLSLQPAPDSEYFDNALSPQELKEKVLKFSTHGVLGDIG 458
            TL LSGTSM+ P V G+ +  LS    P       AL  QE++    +   H       
Sbjct: 406 DTLILSGTSMSTPIVTGVAAVLLSKGIEP-------ALIAQEIEYLSTRNVFHRRTLFFK 458

Query: 459 DNTPNRLIYNGGGKILDD 476
            +T N+++YNG  K LDD
Sbjct: 459 PSTANQILYNGVDK-LDD 475

>Kwal_23.6183 s23 complement(1485143..1486624) [1482 bp, 493 aa]
           {ON} YCR045C - Hypothetical ORF [contig 15] FULL
          Length = 493

 Score =  196 bits (499), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 129/314 (41%), Positives = 180/314 (57%), Gaps = 39/314 (12%)

Query: 173 QKDAPWGLHRISHREKAKYG--------QDLEYLYEDA-AGRGVTSYVLDTGIDTEHEDF 223
           QK+AP  L RIS R    Y          +  Y Y+D+  G  V +YV+DTGI  EH  F
Sbjct: 133 QKNAPRHLARISRRSALPYNPENIAPKTSNFSYYYDDSFPGTCVNAYVIDTGIFKEHRQF 192

Query: 224 EGRAVWGAVIPGNDEASDLNGHGTHCAGIIGSKHYGVAKNTKLVAVKVLRSNGEGTVSDV 283
           +GRA +GA + G +   DLNGHGTH AG+IGS+ YGVAK+  L+ VK L + G+G ++ V
Sbjct: 193 QGRAKFGADLVG-EGPGDLNGHGTHVAGLIGSQKYGVAKDVSLIEVKALNAKGQGNLTSV 251

Query: 284 IKGIEYVAREHIESSRKKSKEFKGSTANLSLGSSKSLAMEMAVDAAVDSGVHFAIAAGNE 343
           I  IE+    H   S+      +G  ANLSLGS ++  +  AV+AA+++GV   +AAGN 
Sbjct: 252 ISAIEFTV-NHCRKSK------RGCVANLSLGSFRNSVLNQAVEAALEAGVVVVVAAGNS 304

Query: 344 NEDACLSSPAGAQKSITVGASTFSDDR----AFFSNWGTCVDVFAPGINIMSTYIGSRNA 399
           N +AC SSPA +  +I+VGA    DDR    A FSNWG CVD+FAPG+ I S        
Sbjct: 305 NANACWSSPASSLSAISVGA---FDDRTDTIARFSNWGNCVDLFAPGVKIASLSNIPPFK 361

Query: 400 TLSLSGTSMAAPHVAGMLSYFLSLQPAPDSEYFDNALSPQELKEKVLKFSTHGVLGD--- 456
           +++ SGTSMA+P V GM++  L           D+ + P ++KE+++  +T  V      
Sbjct: 362 SVAYSGTSMASPLVTGMVAVLL-----------DSGIHPFDIKEELINTATDSVFHKRAL 410

Query: 457 -IGDNTPNRLIYNG 469
                TPNR+ + G
Sbjct: 411 LFKPGTPNRVAFTG 424

>TBLA0F03970 Chr6 complement(985334..987538) [2205 bp, 734 aa] {ON}
           Anc_6.313 YCR045C
          Length = 734

 Score =  200 bits (508), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 127/319 (39%), Positives = 174/319 (54%), Gaps = 37/319 (11%)

Query: 168 SNTSMQKDAPWGLHRISHREKA--------KYGQDLEYLYEDA-AGRGVTSYVLDTGIDT 218
           S   +Q+ AP  L RIS R+K         ++ + L Y Y+D   G GV +YV+DTGI  
Sbjct: 282 SKFKVQRGAPRHLARISTRDKLPFNFRNANQFEEQLNYYYDDNDKGEGVLAYVIDTGILK 341

Query: 219 EHEDFEGRAVWGAVIPGNDEASDLNGHGTHCAGIIGSKHYGVAKNTKLVAVKVLRSNGEG 278
           EH+DFE R  +G  + G + A DLNGHGTH AG+IGSK YGV K  K++ VK +   G  
Sbjct: 342 EHKDFEDRVEFGTDLTG-EGAGDLNGHGTHVAGLIGSKTYGVDKKVKIIDVKAVSLTGST 400

Query: 279 TVSDVIKGIEYVAREHIESSRKKSKEFKGSTANLSLGSSKSLAMEMAVDAAVDSGVHFAI 338
            +S +I+ IEY   +      KK+        N+SLGS     +  AV++A+  GV F +
Sbjct: 401 QLSHIIEAIEYTVNDCNSRVDKKA-----CVVNMSLGSFYVKVINEAVESAIAEGVVFVV 455

Query: 339 AAGNENEDACLSSPAGAQKSITVGASTFSDDR----AFFSNWGTCVDVFAPGINIMSTYI 394
           AAGN N DAC SSP  ++ +ITVGA    DDR    A FSNWG CVD+FA G+ + S   
Sbjct: 456 AAGNNNIDACWSSPGSSKNAITVGA---FDDRLDVIAKFSNWGECVDIFASGVEVKSLSS 512

Query: 395 GSRNATLSLSGTSMAAPHVAGMLSYFLSLQPAPDSEYFDNALSPQELKEKVLKFSTHGVL 454
                 +  SGTSMA+P V G +S  LS             + P +++E+++K ST G  
Sbjct: 513 QVPYKYIKYSGTSMASPIVCGFVSILLS-----------QGVKPNDVQEEMVKLSTKGDF 561

Query: 455 GD----IGDNTPNRLIYNG 469
                     T NR+++NG
Sbjct: 562 TRRSLIFKPFTSNRILFNG 580

>KAFR0J02450 Chr10 complement(469452..470888) [1437 bp, 478 aa] {ON}
           Anc_6.313 YCR045C
          Length = 478

 Score =  195 bits (495), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 130/356 (36%), Positives = 184/356 (51%), Gaps = 52/356 (14%)

Query: 145 EILNLVSQDPLIKFI--------------EQESTVRLSNTSMQKDAPWGLHRISHREK-- 188
           +I+  + Q+PL+  I                E T    +  +Q +AP  L RIS R+K  
Sbjct: 77  KIMEKLKQNPLVADIVPNILFKAFENDELNNEQTQEYVSHVVQSEAPRHLARISRRDKLP 136

Query: 189 ------AKYGQDLEYLY-EDAAGRGVTSYVLDTGIDTEHEDFEGRAVWGAVIPGNDEASD 241
                 + Y +   Y Y ++  G  V +Y+LD+G+     DFEGR  +G    G+ E  D
Sbjct: 137 YDFTNVSSYKKSFNYYYGKEHKGADVRAYILDSGVSRNLTDFEGRVEFGFDFTGDGEG-D 195

Query: 242 LNGHGTHCAGIIGSKHYGVAKNTKLVAVKVLRSNGEGTVSDVIKGIEYVAREHIESSRKK 301
            NGHGTH AG++GSK YGVAK   +V VK L   G GT+  V+  IE+   +  E   K+
Sbjct: 196 SNGHGTHVAGLVGSKTYGVAKGVTMVDVKCLDEIGFGTLITVLSAIEFAVNDCHEHPEKR 255

Query: 302 SKEFKGSTANLSLGSSKSLAMEMAVDAAVDSGVHFAIAAGNENEDACLSSPAGAQKSITV 361
                   ANLSLGS K+  +  A+ AA + GV   +AAGN N +AC +SPA A+++ITV
Sbjct: 256 ------CVANLSLGSFKNAIINKAIQAATEDGVVMVVAAGNFNINACWTSPASAEEAITV 309

Query: 362 GASTFSDDR----AFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGML 417
           GA    DDR    A FSNWG CVD++APG+ + S         +S SGTSMA+P V G +
Sbjct: 310 GA---FDDRIDTIAKFSNWGPCVDIYAPGVAVESLANFPMVKNISYSGTSMASPIVCGQV 366

Query: 418 SYFLSLQPAPDSEYFDNALSPQELKEKVLKFSTHGVLGD----IGDNTPNRLIYNG 469
           +  L           D  +   ++K  ++K +T  V          NTPNR+++NG
Sbjct: 367 AILL-----------DKGIPNDDIKSTLIKMATDDVFQKRTLLFKPNTPNRVLFNG 411

>Ecym_2105 Chr2 (185014..186846) [1833 bp, 610 aa] {ON} similar to
           Ashbya gossypii AAR069W
          Length = 610

 Score =  194 bits (493), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 124/312 (39%), Positives = 176/312 (56%), Gaps = 32/312 (10%)

Query: 171 SMQKDAPWGLHRISHREKAKY----GQDLEY-LYEDAA--GRGVTSYVLDTGIDTEHEDF 223
           +MQ  AP  L R   R    +     +D E+  Y DA   G  V  Y+LD+GI   H +F
Sbjct: 268 AMQSGAPRHLARNCRRSGLPFDTSGSKDYEFNYYYDAEHLGETVNVYILDSGIHKSHPEF 327

Query: 224 EGRAVWGAVIPGNDEASDLNGHGTHCAGIIGSKHYGVAKNTKLVAVKVLRSNGEGTVSDV 283
           EGRAV+G +   N+   DLNGHGTH AG++GSK YG AK   +  VKV+  +G G+ S++
Sbjct: 328 EGRAVFG-IDTTNEGPGDLNGHGTHVAGLVGSKTYGAAKKATIYEVKVMTVDGRGSTSNI 386

Query: 284 IKGIEYVAREHIESSRKKSKEFKGSTANLSLG--SSKSLAMEMAVDAAVDSGVHFAIAAG 341
           I G+E+  + H + S KK        AN+SLG  S    A++ AV+AA++ G+ F +AAG
Sbjct: 387 IAGVEFAVK-HCQQSGKK------CVANMSLGGLSFGHSALDSAVEAAIEEGLVFVVAAG 439

Query: 342 NENEDACLSSPAGAQKSITVGA-STFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNAT 400
           N  E AC  SPA  + +ITVGA    SD  A FSN+G CVD+FAPG+ + S      N  
Sbjct: 440 NSKERACWYSPAKVKTAITVGAFDDRSDIIASFSNYGKCVDIFAPGVAVSSLSNSPYNTV 499

Query: 401 LSLSGTSMAAPHVAGMLSYFLSLQPAPDSEYFDNALSPQELKEKVLKFSTHGVLGD---I 457
             L+GTSM+AP  AG+++  L           D  +  +++KE+++  ST GV      +
Sbjct: 500 RVLNGTSMSAPITAGVVAVLL-----------DQGVKHEDVKERLIDLSTKGVFHRRRLV 548

Query: 458 GDNTPNRLIYNG 469
              TP+R ++NG
Sbjct: 549 SSRTPDRTLFNG 560

>CAGL0L10802g Chr12 complement(1159230..1160783) [1554 bp, 517 aa]
           {ON} similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045c
          Length = 517

 Score =  191 bits (485), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 123/340 (36%), Positives = 174/340 (51%), Gaps = 51/340 (15%)

Query: 173 QKDAPWGLHRISHREK--------AKYGQDLEYLYED-AAGRGVTSYVLDTGIDTEHEDF 223
           Q +AP  L R+S R +         +Y  D  Y Y     GR V +YVLD+G+  +H DF
Sbjct: 160 QSEAPRHLARLSRRSQLPYDFNDPTRYESDFNYYYYGWHQGRSVNAYVLDSGVMIDHCDF 219

Query: 224 EGRAVWGAVIPGNDEASDLNGHGTHCAGIIGSKHYGVAKNTKLVAVKVLRSNGEGTVSDV 283
           EGRA +GA    +  + D NGHGTH AG+IGSK YGV+K   ++ VKVL S G GT+  V
Sbjct: 220 EGRAYYGADFIRSGNSGDQNGHGTHVAGLIGSKTYGVSKKVNIIDVKVLDSVGSGTLDTV 279

Query: 284 IKGIEYVAREHI-------------------ESSRKKSKEFKGSTANLSLGSSKSLAMEM 324
           + G+E+V+  H                    E S     E K    NLSLG+ +S  +  
Sbjct: 280 MSGLEFVS-NHCNYKGKQGKQGKQGKPVWGSEDSHDDDVESKRCVINLSLGTFRSTIINE 338

Query: 325 AVDAAVDSGVHFAIAAGNENEDACLSSPAGAQKSITVGASTFSDDR----AFFSNWGTCV 380
           A++  +  G+   +AAGN N +AC +SPA     ITVGA    DDR    A FSNWG CV
Sbjct: 339 AIEELIKQGIVVVVAAGNSNMNACWTSPASVADVITVGA---FDDRIDSIAKFSNWGNCV 395

Query: 381 DVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGMLSYFLSLQPAPDSEYFDNALSPQE 440
           D+FAPG+ + S         +  +GTSMA P V G+++  L           D+ + P +
Sbjct: 396 DIFAPGVLVKSLSNKFPYYPIEQTGTSMATPIVTGLVALLL-----------DSGIKPTQ 444

Query: 441 LKEKVLKFSTHGVLGD----IGDNTPNRLIYNGGGKILDD 476
           +K+++ + +T  +           TPNR+ +NG  +  DD
Sbjct: 445 IKKRLNELATDNIFPRRTLLFKPGTPNRIAFNGVKRDDDD 484

>NDAI0I00560 Chr9 (114935..116386) [1452 bp, 483 aa] {ON} Anc_6.313
          Length = 483

 Score =  190 bits (483), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 143/398 (35%), Positives = 198/398 (49%), Gaps = 65/398 (16%)

Query: 123 GGIDSSFDINGLFRGYAGYFTDEILNLVSQDPLI-----------------------KFI 159
           G I  +F   G FRG     T ++++ + ++PL+                         I
Sbjct: 54  GKISKTFSF-GSFRGLTVNLTKDVVSAIKENPLVVDVVPNMKIHAFDYDDFENNDGYDDI 112

Query: 160 EQESTVRLSNT---SMQKDAPWGLHRISHR--------EKAKYGQDLEYLYED-AAGRGV 207
           +Q   +   N+    +Q  AP  L R+S R        +K  Y   L Y Y     G  V
Sbjct: 113 KQPEELFDKNSYLVKVQNGAPRHLARLSRRMPLPYDFDDKDAYNDSLSYYYSKWHQGTDV 172

Query: 208 TSYVLDTGIDTEHEDFEGRAVWGAVIPGNDEASDLNGHGTHCAGIIGSKHYGVAKNTKLV 267
            +Y++D+GID   E+FEGRA  G  + G +   D NGHGTH AG++GSK YGVAKN  LV
Sbjct: 173 NAYIIDSGIDINQEEFEGRATHGLDLTG-EGPGDRNGHGTHVAGLVGSKTYGVAKNVTLV 231

Query: 268 AVKVLRSNGEGTVSDVIKGIEYVAREHIESSRKKSKEFKGSTANLSLGSSKSLAMEMAVD 327
            VK L   G G++  VI  +E+V     +S  KK        ANLSLG+     +  A+ 
Sbjct: 232 EVKALDRQGSGSLITVISALEFVVNHCGKSKSKK------CVANLSLGAFMMPLLNEAIK 285

Query: 328 AAVDSGVHFAIAAGNENEDACLSSPAGAQKSITVGASTFSDDR----AFFSNWGTCVDVF 383
           A VDSGV   +AAGN N DAC  SPA  + +ITVGA    DDR    A FSNWG+CVD+F
Sbjct: 286 ATVDSGVVVVVAAGNGNIDACWCSPASEKSAITVGA---FDDRIDTIAKFSNWGSCVDIF 342

Query: 384 APGINIMSTYIGSRNATLSLSGTSMAAPHVAGMLSYFLSLQPAPDSEYFDNALSPQELKE 443
           APG+ I S  I     ++  SGTSMA+P VAG++S  L           D  +  +++++
Sbjct: 343 APGVAISSLSIKDNQKSVEFSGTSMASPQVAGIVSILL-----------DQGVENEDIRD 391

Query: 444 KVLKFSTHGVLGD----IGDNTPNRLIYNGGGKILDDL 477
            + + +T  V           TPNR+ +NG  K  +D 
Sbjct: 392 YLFELATDDVFQKRTLLFKPRTPNRITFNGISKKDEDF 429

>KLLA0F06028g Chr6 (576687..578213) [1527 bp, 508 aa] {ON} some
           similarities with uniprot|P25036 Saccharomyces
           cerevisiae YOR003W YSP3 subtilisin-like protease III
          Length = 508

 Score =  188 bits (478), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 132/321 (41%), Positives = 180/321 (56%), Gaps = 39/321 (12%)

Query: 173 QKDAPWGLHRISHR------EKAKYGQDLEYLY-EDAAGRGVTSYVLDTGIDTEHEDFEG 225
           Q  AP  L RIS R      EK      L+Y Y E+  G GV  YVLD+G++ +H DFEG
Sbjct: 154 QSRAPRHLARISRRAQLPVIEKDDTSSGLKYHYHEEHQGEGVFVYVLDSGVNHDHPDFEG 213

Query: 226 RAVWGAVIPGNDEASDLNGHGTHCAGIIGSKHYGVAKNTKLVAVKVLRSNGEGTVSDVIK 285
           RA+ G    G + + DL GHGTH AG+IGSK YGVAK   +V VKVL S G+GTV+++I+
Sbjct: 214 RAMKGIDTTG-EGSGDLVGHGTHVAGLIGSKTYGVAKKVNIVEVKVLDSMGKGTVTNIIE 272

Query: 286 GIEYVAREHIESSRKKSKEFKGSTANLSLGSSKSLA-MEMAVDAAVDSGVHFAIAAGNEN 344
           G+EYV  + I   RK          N+SLG+  + + ++ AV A ++ GV   +A GN  
Sbjct: 273 GLEYVVNQCIGKKRK-------CVINMSLGAPGTHSILDKAVSAVIEEGVVVVVAGGNSG 325

Query: 345 EDACLSSPAGAQKSITVGASTFSDDR----AFFSNWGTCVDVFAPGINIMSTYIGSRNAT 400
            +AC  SPA  +K+ITV A    DDR    A FSNWG C+D++APG+N+ S     R  T
Sbjct: 326 LNACWYSPAKVRKAITVAA---MDDRTDLMAPFSNWGACIDIWAPGVNVKSLSNKGR-GT 381

Query: 401 LSLSGTSMAAPHVAGMLSYFLSLQPAPDSEYFDNALSPQELKEKVLKFSTHGVLGD---- 456
             LSGTSMA+P VAG  +            Y D    P E+++ + K +T GV       
Sbjct: 382 FVLSGTSMASPIVAGAAAI-----------YLDQGADPAEVRKILSKTATRGVFKKRAIA 430

Query: 457 IGDNTPNRLIYNGGGKILDDL 477
           +   TPN+++Y G  +  D+ 
Sbjct: 431 VRPRTPNKVLYTGNNQEDDEF 451

>AAR069W Chr1 (460781..463087) [2307 bp, 768 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR045C
          Length = 768

 Score =  192 bits (489), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 120/319 (37%), Positives = 176/319 (55%), Gaps = 38/319 (11%)

Query: 167 LSNTSMQKDAPWGLHRISHREKAKYGQ--DLEYLY-----EDAAGRGVTSYVLDTGIDTE 219
           L   ++Q DAP  L R   R    +    D EY +     E+  G GV  YVLD+GI   
Sbjct: 422 LHQYAIQVDAPRHLARTCRRTGLPFDPSGDKEYTFNYYYDEEHLGEGVNVYVLDSGIYKS 481

Query: 220 HEDFEGRAVWGAVIPGNDEASDLNGHGTHCAGIIGSKHYGVAKNTKLVAVKVLRSNGEGT 279
           H +F+GRA +G +    +   DLNGHGTH AG++GS+ +G+AK   +  +KV+  +G G+
Sbjct: 482 HPEFDGRAHFG-IDTTKEGPGDLNGHGTHVAGLVGSRTFGIAKKANIYEIKVMTVDGRGS 540

Query: 280 VSDVIKGIEYVAREHIESSRKKSKEFKGSTANLSLG--SSKSLAMEMAVDAAVDSGVHFA 337
            S++I G+E+  + H + S K+        AN+SLG  S    A++ AV+AA++ G+ F 
Sbjct: 541 TSNIIAGVEFAVK-HCQQSGKR------CVANMSLGGLSFGHSALDSAVEAAIEEGLVFV 593

Query: 338 IAAGNENEDACLSSPAGAQKSITVGASTFSDDR----AFFSNWGTCVDVFAPGINIMSTY 393
           +AAGN  E AC  SPA  + +ITVGA    DDR    A FSN+G CVD+FAPG+ + S  
Sbjct: 594 VAAGNSKERACWYSPAKVKTAITVGA---FDDRSDIIASFSNYGKCVDIFAPGVAVASLS 650

Query: 394 IGSRNATLSLSGTSMAAPHVAGMLSYFLSLQPAPDSEYFDNALSPQELKEKVLKFSTHGV 453
               N    L+GTSM+AP  AG+++  L           D  + P E+K+ +L  ST G+
Sbjct: 651 NSPSNTMRVLNGTSMSAPITAGVVAVLL-----------DQGIEPHEVKDHLLSISTKGL 699

Query: 454 LGD---IGDNTPNRLIYNG 469
                 +   TP+R ++ G
Sbjct: 700 FHKRRLVSSRTPDRALFTG 718

>TPHA0D03760 Chr4 complement(792115..793938) [1824 bp, 607 aa] {ON}
           Anc_6.313 YCR045C
          Length = 607

 Score =  174 bits (442), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 115/321 (35%), Positives = 170/321 (52%), Gaps = 35/321 (10%)

Query: 172 MQKDAPWGLHRISHREKAKYG-------QDLEYLYEDAAGRGVTS--YVLDTGIDTEHED 222
           +Q  AP  L ++S R +  Y        ++  + Y D   +G  S  Y++DTG+  EH++
Sbjct: 149 IQFGAPRHLGKLSSRHQLPYNVKDEKEFKEFIHYYYDRYYQGTNSVVYIIDTGVYKEHKE 208

Query: 223 FEGRAVWGAVIPGNDEASDLNGHGTHCAGIIGSKHYGVAKNTKLVAVKVLRSNGEGTVSD 282
           F  R  +G    G  +  D NGHGTH AG+IGSK +GVAKN  L  VKVL   G G ++ 
Sbjct: 209 FGNRVHFGGDFIGEGKG-DYNGHGTHVAGLIGSKTFGVAKNVTLFDVKVLDQKGFGNLTS 267

Query: 283 VIKGIEYVAREHIESSRKKSKEFKGSTANLSLGSSKSLAMEMAVDAAVDSGVHFAIAAGN 342
           V++GIE+          K+    K    N+SLG+ ++  +  A+  A  SG+   +AAGN
Sbjct: 268 VLEGIEFAVN---NCKLKQQPMGKNCVINMSLGTIRNPIINEAIKEAFLSGITPVVAAGN 324

Query: 343 ENEDACLSSPAGAQKSITVGASTFSDDR----AFFSNWGTCVDVFAPGINIMSTYIGSRN 398
            N  AC +SPA +  +ITVGA    DDR    A FSNWG CVD+FAPG+ I S       
Sbjct: 325 NNFSACWTSPASSNFAITVGA---MDDRTDTIAVFSNWGQCVDIFAPGVRIKSLSNRMLE 381

Query: 399 ATLSLSGTSMAAPHVAGMLSYFLSLQPAPDSEYFDNALSPQELKEKVLKFSTHGVLGDI- 457
             +  SGTSMA+P VAG+++  +           +      E+K+K++  S+  +   + 
Sbjct: 382 NGVIHSGTSMASPIVAGLVAILM-----------EKGYKCDEIKQKLIDDSSKSIFSKLT 430

Query: 458 ---GDNTPNRLIYNGGGKILD 475
                 TPNR+IYNG  ++++
Sbjct: 431 LFFKYGTPNRVIYNGIEEVIN 451

>Kwal_33.13372 s33 (190864..191997) [1134 bp, 377 aa] {ON} YCR045C -
           Hypothetical ORF [contig 118] FULL
          Length = 377

 Score =  152 bits (383), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 99/293 (33%), Positives = 154/293 (52%), Gaps = 12/293 (4%)

Query: 135 FRGYAGYFTDEILNLVSQDPLIKFIEQESTVRLSNTSMQKDAPWGLHRISHREKAKYGQD 194
           FR   G F   +L  +  D  I  +  +  +  +   +Q+ AP  L R+S +   + G D
Sbjct: 55  FRAIYGDFPQRLLENLYYDGRITAMSMDHILTPAEYIVQEHAPAHLARLSQKSTLR-GSD 113

Query: 195 LEYLYEDAAGRGVTSYVLDTGIDTEHEDFEGRAVWGAVIPGNDEA-SDLNGHGTHCAGII 253
             Y+Y    G GV  Y+LDTGID  H + EGR    A +  N  +  D +GHGT  AG+I
Sbjct: 114 GTYIYHSNGGNGVDVYLLDTGIDDLHPELEGRVQKIADLTSNPVSHGDPHGHGTAVAGVI 173

Query: 254 GSKHYGVAKNTKLVAVKVLRSNGEGTVSDVIKGIEYVAREHIESSRKKSKEFKGSTANLS 313
           GS  +G AK   L  V+V  S G  T+  VI+ +E+       +S+  S   + S   + 
Sbjct: 174 GSATFGSAKKCNLFDVRVADSTGNATLIGVIRALEH-------ASKLASVTQRPSVVVIP 226

Query: 314 LGSSKSLAMEMAVDAAV-DSGVHFAIAAGNENEDACLSSPAGAQKSITVGA--STFSDDR 370
               K++ +  A++A + D  +   +A GN N++AC SSPA A  ++T+G+   T  D  
Sbjct: 227 FTMRKNVILNSAIEAVIRDQSLPVVVAGGNFNQNACDSSPASAYGALTIGSIDVTKGDSL 286

Query: 371 AFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGMLSYFLSL 423
           A F+N+G C+D FA G+NI S   G   +    SGTS++A   +G+++Y++SL
Sbjct: 287 APFTNYGDCIDTFAAGVNITSLTTGDYESNTQYSGTSISAGIASGVVAYYMSL 339

>TBLA0A06700 Chr1 (1634983..1636476) [1494 bp, 497 aa] {ON}
           Anc_6.313 YCR045C
          Length = 497

 Score =  152 bits (385), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 97/267 (36%), Positives = 142/267 (53%), Gaps = 12/267 (4%)

Query: 171 SMQKDAPWGLHRISHREKAKYGQDLEYLY---EDAAGRGVTSYVLDTGIDTEHEDFEGRA 227
           S Q +AP  L R S   K     +  Y Y    D  G  VT YVLD+GI  +H +FEGR 
Sbjct: 143 STQFNAPRHLSRASRITKLPTASNFTYNYYYPRDYQGANVTVYVLDSGIRMDHPEFEGR- 201

Query: 228 VWGAVIPGNDEASDLNGHGTHCAGIIGSKHYGVAKNTKLVAVKVLRSNGEGTVSDVIKGI 287
           +  A    +    D  GHGT  AGIIGSK YGVAKN  L+ +KVL + G+G V  +++G+
Sbjct: 202 ILEAYDFTDSGVGDNYGHGTSVAGIIGSKTYGVAKNVNLIDIKVLNNKGKGNVFSILQGL 261

Query: 288 EYVAREHIESSRKKSKEFKGSTANLSLGSSKSLAMEMAVDAAVDSGVHFAIAAGNENEDA 347
           +++ + H E +   +        N SLG+     +  A +   ++G+    AAGN   +A
Sbjct: 262 QFITK-HCEENTNGN-----CIINASLGAINIQILNKAFEEVHNAGIPVICAAGNNAVNA 315

Query: 348 CLSSPAGAQKSITVGASTFSDDR-AFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGT 406
           C  +PAG++   TVG+    DD  A FSNWG CVD+ APG+ + +    ++  +   SGT
Sbjct: 316 CWITPAGSKGVFTVGSFDDRDDTIATFSNWGRCVDMMAPGVYVRTLLYTNQKGSRESSGT 375

Query: 407 SMAAPHVAGMLSYFLSLQPAPDSEYFD 433
           S++ P V G+ +  LS +  P    +D
Sbjct: 376 SVSTPIVTGLAAILLS-KGVPKENLYD 401

>KLTH0F02288g Chr6 (186895..188037) [1143 bp, 380 aa] {ON} weakly
           similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045C Hypothetical ORF
          Length = 380

 Score =  144 bits (363), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 102/332 (30%), Positives = 172/332 (51%), Gaps = 16/332 (4%)

Query: 99  VSKLAEDDVFLEVVSSSIAPDLQLGGIDSSFDINGLFRGYAGYFTDEILNLVSQDPLIKF 158
           V++L +     EV+    A  +  GG+  +  +   FR   G F  ++L    +   I  
Sbjct: 20  VAELGDTASVEEVLGEQYAATVAGGGV-GAITLGNSFRAIYGEFPQQLLEDFYRSGQIVA 78

Query: 159 IEQESTVRLSNTSMQKDAPWGLHRISHREKAKYGQDLE---YLYEDAAGRGVTSYVLDTG 215
           +  +  + ++   +Q+ AP  L R+S +   + G   +   Y+Y   AG GV  Y+LDTG
Sbjct: 79  MSMDRPLGVAEYMVQQHAPNHLARLSQKSSLRGGNGSDNGAYIYHSNAGNGVDVYLLDTG 138

Query: 216 IDTEHEDFEGRAVWGAVIPGNDEAS-DLNGHGTHCAGIIGSKHYGVAKNTKLVAVKVLRS 274
           ID  H  FEGR    A    +  A+ D +GHGT  AG+IGS  +GVAK   L  V+V  S
Sbjct: 139 IDGTHPAFEGRVQKAADFSSDPVATGDPHGHGTAVAGVIGSSVFGVAKKCNLFDVRVANS 198

Query: 275 NGEGTVSDVIKGIEYVAREHIESSRKKSKEFKGSTANLSLGSSKSLAMEMAVDAAV-DSG 333
            G  ++  V++ +E+ ++    + R        S   + L   ++  +  AV+A V D  
Sbjct: 199 TGHASLIGVLRALEHASKLAAVTKRP-------SLITIPLEMPRNTILNSAVEAVVRDLS 251

Query: 334 VHFAIAAGNENEDACLSSPAGAQKSITVGASTFS--DDRAFFSNWGTCVDVFAPGINIMS 391
           +   +AAGNEN  AC  SPAGA  ++T+G+   +  D  A F+N+  CVD+F  G+++ +
Sbjct: 252 IPVVVAAGNENRSACSVSPAGAYGALTIGSIDVARNDALAPFTNFAECVDLFTAGVDVAT 311

Query: 392 TYIGSRNATLSLSGTSMAAPHVAGMLSYFLSL 423
             +   ++   LSGTS++A   +G+++Y++S+
Sbjct: 312 LGL-DHSSEHHLSGTSISAGVASGLVAYYMSI 342

>Kpol_2000.69 s2000 complement(151054..152214) [1161 bp, 386 aa]
           {ON} complement(151054..152214) [1161 nt, 387 aa]
          Length = 386

 Score =  129 bits (324), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 94/307 (30%), Positives = 158/307 (51%), Gaps = 30/307 (9%)

Query: 135 FRGYAGYFTDEILNLVSQDPLIKFIEQESTVRLSNTSMQKDAPWGLHRISH---REKAKY 191
           F G++G F DE+++ +  DP +  I  +  + L     Q DAP  L R+S+     +   
Sbjct: 61  FHGFSGEFEDEVMSELYGDPRVASISIDRMLYLQEYLRQNDAPEHLARLSNGVSNSRVSA 120

Query: 192 GQDLEYLYEDAAGRGVTSYVLDTGIDTEHEDFEGRAVWGAV------IPGNDEASDLNGH 245
             +  +++   AG GV  Y++D+GID++H  F  R +   +      IP      D +GH
Sbjct: 121 KNENAFIFHSHAGIGVDVYIVDSGIDSQHPAFMNRHISKLIDLTDNPIP----VGDPHGH 176

Query: 246 GTHCAGIIGSKHYGVAKNTKLVAVKVLRSNGEGT-VSDVIKGIEYVAREHIESSRKKSKE 304
           GT  AG++ S  +GV K   L  V+V+ +   G  +S ++K +E+     IE+  + +  
Sbjct: 177 GTAIAGLVTSDTFGVMKKANLFDVRVVDAESNGVKLSKLLKSLEF-----IENHSRAT-- 229

Query: 305 FKGSTANLSLGSSKSLAMEMAVDAAVDSGVHFAIAAGNENEDACLSSPAGAQKS---ITV 361
            + S A L    SK+  +  A+++  +S +   + AGN++  AC  SPA A+ S   ++V
Sbjct: 230 MRPSVAVLPFSMSKNAILNSAIESMPNS-IAIVVPAGNQHHMACNFSPASARNSQSILSV 288

Query: 362 GASTF--SDDRAFFSNWGTCVDVFAPGIN---IMSTYIGSRNATLSLSGTSMAAPHVAGM 416
           G+  +  S + A FSN+G CVDVF  G+    + +T     N    +SGTSM+    AG 
Sbjct: 289 GSLDYRSSIEIASFSNYGECVDVFTSGVQMDTLHATTNSDENYISKVSGTSMSCAIAAGT 348

Query: 417 LSYFLSL 423
           + Y++SL
Sbjct: 349 VGYYMSL 355

>TPHA0B04520 Chr2 complement(1065861..1067027) [1167 bp, 388 aa]
           {ON} Anc_1.78
          Length = 388

 Score =  126 bits (316), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 94/336 (27%), Positives = 170/336 (50%), Gaps = 45/336 (13%)

Query: 109 LEVVSSSIAPDLQLGGIDSSFDINGLFRGYAGYFTDEILNLVSQDPLIKFIEQESTVRLS 168
           ++V+ S+I P           +I   F  ++G  + E ++ V +D     I  E  + L 
Sbjct: 43  IDVMDSNILP----------IEIGNSFIAFSGDLSKEQVSSVFEDNAAAAISTEKYLELQ 92

Query: 169 NTSMQKDAPWGLHRISHREKAKYGQ----DLEYLYEDAAGRGVTSYVLDTGIDTEHEDFE 224
               Q DAP  L R++ ++  K  Q    + +Y++ D +G GV  Y++DTGID +H  + 
Sbjct: 93  GYLKQTDAPKHLGRLT-KDSIKSSQYHYANNQYIFSDTSGNGVDIYIVDTGIDIQHPIYL 151

Query: 225 GRAVWGAV------IPGNDEASDLNGHGTHCAGIIGSKHYGVAKNTKLVAVKVLRSNGE- 277
              +   +      IP    + D NGHGT  AGII S  +GV K+  LV V+V+ +N + 
Sbjct: 152 QNNIHKLIDLTTSPIP----SGDFNGHGTAMAGIINSDPFGVLKSANLVDVRVVDANTKH 207

Query: 278 GTVSDVIKGIEYVAREHIESSRKKSKEFKGSTANLSLGSSKSLAMEMAVDAAVDSGVHFA 337
            T+S V+  +  + +        + K  + S   L   + K+  +E A++  +   +   
Sbjct: 208 ATMSRVLSALSLIEKH-------EQKTMRPSIIVLPFQTEKNTILESAIE-NISKKIPVI 259

Query: 338 IAAGNENEDACLSSPAGAQK---SITVGASTFSDDRAF-----FSNWGTCVDVFAPGINI 389
           I AGN++++AC  SP G +K    + VG+  +S+++ +     FSN+G+CVD++  G++I
Sbjct: 260 IPAGNKHQNACKLSPMGIKKLSNVLVVGSLEYSEEQNYLDIAKFSNYGSCVDIYTSGVDI 319

Query: 390 MSTYI---GSRNATLSLSGTSMAAPHVAGMLSYFLS 422
            +      G +    +++GTS +   VAG++ Y++S
Sbjct: 320 STLKTSSNGGKELIHNVTGTSYSCGIVAGVVGYYMS 355

>ZYRO0F16764g Chr6 complement(1390437..1391597) [1161 bp, 386 aa]
           {ON} conserved hypothetical protein
          Length = 386

 Score =  125 bits (313), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 102/339 (30%), Positives = 166/339 (48%), Gaps = 32/339 (9%)

Query: 104 EDDVFLEVV--SSSIAPDLQLGGIDSSFDINGLFRGYAGYFTDEILNLVSQDPLIKFIEQ 161
           +D   L  V  S +++ D Q   I   F++ G FR + G F+  IL  +  DP +  I +
Sbjct: 22  QDKTALNAVLNSYALSSDQQGPEITDIFEL-GSFRAFTGDFSGPILQKLYNDPNVLAISR 80

Query: 162 ESTVRLSNTSMQKDAPWGLHRISHREKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDTEHE 221
           + +++L    +Q +AP  L  +S      +     ++Y    G GV  Y+LDTGID +H 
Sbjct: 81  DGSLKLQEIVLQNNAPSHLVGLSSISPLSHQ---PFIYRSNGGNGVDVYLLDTGIDIKHP 137

Query: 222 DFEGRAVW------GAVIPGNDEASDLNGHGTHCAGIIGSKHYGVAKNTKLVAVKVLRSN 275
           +     +        + +P   + +D  GHGT  AGII S+ +GV K   LV V+V  SN
Sbjct: 138 NLSKLNILRMADLTQSPVP---QGTDPQGHGTAMAGIIASETFGVLKKCNLVDVRVADSN 194

Query: 276 GEGTVSDVIKGIEYVAREHIESSRKKSKEFKGSTANLSLGSSKSLAMEMAVDAAVDSGVH 335
           G+  +S +++ +    R HIE +++ S         L +    +  +  A+ A+ D  V 
Sbjct: 195 GDVKLSTILQALTLTQR-HIEGTKRPSV----VVIPLEVEDGNNPILTEAI-ASFDQSVP 248

Query: 336 FAIAAGNENEDACLSSPAGAQKS----ITVGASTFSDDRAFFSNWGTCVDVFAPG---IN 388
             I AGN  +DA   SPA         I VG+   +++   F+N+G+ VDVF  G     
Sbjct: 249 IIIPAGNNAQDALNFSPANVNPKPKNIIVVGSVDVNNNPTKFTNYGSNVDVFTVGEQITT 308

Query: 389 IMSTYIGSRNATLSL----SGTSMAAPHVAGMLSYFLSL 423
           + ST + S+  + SL    SGTS ++   AG++ Y++SL
Sbjct: 309 LQSTDLDSQGLSNSLTRQVSGTSASSAITAGVIGYYMSL 347

>TBLA0A05410 Chr1 (1328472..1329620) [1149 bp, 382 aa] {ON} Anc_1.78
          Length = 382

 Score =  112 bits (279), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 99/369 (26%), Positives = 173/369 (46%), Gaps = 34/369 (9%)

Query: 79  ISIKSIESHRKMVQEAHSVSVSKLAEDDVFLEVVSSSIAPDLQLGGIDSSFDINGLFRGY 138
           +++KS+ + R ++Q  + V + K   +    E   +S    ++L      + +   F+ +
Sbjct: 10  LTLKSVFATRFIIQLTNEVELHKYT-NKFLREFGINSDEAQVEL------YSVGKNFQAF 62

Query: 139 AGYFTDEILNLVSQDPLIKFIEQESTVRLSNTSMQKDAPWGLHRISHREKAKYGQDLEYL 198
           +     + L  +  D  I  I  +  +      +QKDAP  L ++   E      D E++
Sbjct: 63  SAILEQDHLRSLYNDLNIAAISIDRQLEPQEMIVQKDAPRHLTKLLETEAG----DNEFV 118

Query: 199 YEDAAGRGVTSYVLDTGIDTEHEDFEGRAVWGAV-IPGND-EASDLNGHGTHCAGIIGSK 256
           Y+  AG GV  Y+ DTGI           +     +PG      ++  HGT  +G+IGS 
Sbjct: 119 YDSTAGNGVDIYIFDTGIARNSPGLSASRIHDMPGMPGPPIRDQEILEHGTAMSGLIGSP 178

Query: 257 HYGVAKNTKLVAVKVLRSNGEGTVSDVIKGIEYVAREHIESSRKKSKEFKGSTANLSLGS 316
            +GV K   L+ V V   NG+  +S V+KG+  V ++H++ + +       S  N S  +
Sbjct: 179 AFGVLKKCNLIDVNVGDENGKVFMSKVLKGLNLV-QQHVKHTNRP------SVINFSYCT 231

Query: 317 SKSLAMEMAVDAAVDSGVHFAIAAGNENEDACLSSPAGAQKS---ITVGASTFSDD---R 370
            K+  +  A D      V  A+AAGN  +  C  SP G Q++   +  G+   +DD    
Sbjct: 232 LKNAILNSAFD-NFPRDVPIAVAAGNYKQPGCSFSPVGCQRNKSLLAFGSLLMNDDGITL 290

Query: 371 AFFSNWGTCVDVFAPGINIMSTYI------GSRNATLSLSGTSMAAPHVAGMLSYFLSLQ 424
           + FSN+G+CV  +APG  +++  I       SR+  + +SGTS ++   AG++ Y+++ Q
Sbjct: 291 SDFSNYGSCVGSYAPGEGLLTFGIPDTSRPNSRDTVIIISGTSGSSALGAGVIGYYMA-Q 349

Query: 425 PAPDSEYFD 433
             P  E  D
Sbjct: 350 GIPGEEVVD 358

>TDEL0C06230 Chr3 complement(1135740..1136834) [1095 bp, 364 aa]
           {ON} Anc_1.78
          Length = 364

 Score =  102 bits (253), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 91/350 (26%), Positives = 159/350 (45%), Gaps = 36/350 (10%)

Query: 83  SIESHRKMVQEAHSVSVSKLAEDDVFLEVVSSSIAPDLQLGGIDSSFDINGLFRGYAGYF 142
           ++ + R +VQ A   S+ +L+ D  F   V  +    + +G           F+  AG F
Sbjct: 10  TMAAERFVVQLASDTSLVELSRDCSFSIGVGKNFIEMITVGD---------QFKALAGEF 60

Query: 143 TDEILNLVSQDPLIKFIEQESTVRLSNTSMQKDAPWGLHRISHREKAKYGQDLEYLYEDA 202
           + E L  +  D  +  I ++  ++L    +Q  +P  L ++S            + ++  
Sbjct: 61  SVEDLEYLYHDERVVAISRDRDLKLQEYKVQYGSPRHLSQLSSGG--------SFTFDPV 112

Query: 203 AGRGVTSYVLDTGIDTEHEDFEG------RAVWGAVIPGNDEASDLNGHGTHCAGIIGSK 256
           +G  V  YV DTGID +H   +            + +P     +D +GHGT  AG+I S+
Sbjct: 113 SGNLVDVYVFDTGIDFKHPGLQNVNPHKLADFTSSPVP---RGADPHGHGTMMAGLIASE 169

Query: 257 HYGVAKNTKLVAVKVLRSNGEGTVSDVIKGIEYVAREHIESSRKKSKEFKGSTANLSLGS 316
            +GV K+  LV V+V   +GE  +S ++KGI   +  H   +++ S         +++G 
Sbjct: 170 TFGVLKSCSLVDVRVADKDGEVKLSTLMKGIS-ASVAHARFTKRPSV----FVLPMTIGK 224

Query: 317 SKSLAMEMAVDAAVDSGVHFAIAAGNENEDACLSSPAGAQKSITVGASTFSDDRAFFSNW 376
              +        A+   +   + AGN+  DAC  SP      + +G+    +  A FSN+
Sbjct: 225 KNHILDNFL--QAIPKDIAIVLPAGNQQTDACDLSPPNDHNILVIGSLDRDNRLADFSNY 282

Query: 377 GTCVDVFAPGINIM---STYIGSRNATLSLSGTSMAAPHVAGMLSYFLSL 423
           G CVDV+  G +I+   ST  G+     S +GTS +    AG++ Y +S+
Sbjct: 283 GNCVDVYTSGTDILTLRSTDSGNEVLLQSSNGTSASCAIGAGIVGYHMSM 332

>NDAI0F03890 Chr6 complement(921561..924062) [2502 bp, 833 aa] {ON}
           Anc_2.6 YNL238W
          Length = 833

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 75/294 (25%), Positives = 113/294 (38%), Gaps = 34/294 (11%)

Query: 155 LIKFIEQESTVRLSNTSMQKDAPWGLHRISHREKAKYGQDLEYLYEDAAGRGVTSYVLDT 214
           LI   + +  +R+++ S  K   W  H I+           +  YE+  G G+   ++D 
Sbjct: 135 LIPIKDVQDKLRINDPSFPKQ--W--HLINPEFPGNDVNVKKLWYENITGEGIVVAIVDD 190

Query: 215 GIDTEHED----FEGRAVW----GAVIPGNDEASDLNGHGTHCAGIIGSKH------YGV 260
           G+D E+ D    F     W       +P    A D   HGT CAG I +         GV
Sbjct: 191 GLDYENPDLKDNFSAEGSWDFNDNTQLPKPRLADDY--HGTRCAGEIAATKDNGFCGIGV 248

Query: 261 AKNTKLVAVKVLRSNGEGTVSDVIKGIEYVAREHIESSRKKSKEFKGSTANLSLGSSKSL 320
           A N K+  +++L  +GE T  D    + +    +   S     +  G+         K  
Sbjct: 249 AYNAKVAGIRIL--SGELTAEDEAASLVHALDVNDIYSCSWGPKDDGTHLQGPTDLVKKA 306

Query: 321 AMEMAVDAAVDSGVHFAIAAGNENE--DAC-LSSPAGAQKSITVGASTFSDDRAFFSNWG 377
            +    D     G  +  A+GN     D C       +  SIT+GA         +S   
Sbjct: 307 MIRGTSDGRDKKGAIYVFASGNGGAFGDNCNYDGYTNSIYSITIGALDHKGLHPPYSE-- 364

Query: 378 TCVDVFA------PGINIMSTYIGSRNATLSLSGTSMAAPHVAGMLSYFLSLQP 425
           +C  V A       G  I ST IG++  +    GTS AAP  AG+ S  L + P
Sbjct: 365 SCSAVMAVTYSSGSGEYIHSTDIGNK-CSDHHGGTSAAAPLAAGIFSLVLQVNP 417

>Smik_14.97 Chr14 (181672..184116) [2445 bp, 814 aa] {ON} YNL238W
           (REAL)
          Length = 814

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 69/259 (26%), Positives = 103/259 (39%), Gaps = 38/259 (14%)

Query: 195 LEYLYEDAAGRGVTSYVLDTGIDTEHED----FEGRAVW----GAVIPGNDEASDLNGHG 246
           L+  Y +  G GV + ++D G+D E+ED    F     W       +P      D   HG
Sbjct: 157 LDVWYNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPKPRLLDDY--HG 214

Query: 247 THCAGIIGSKH------YGVAKNTKLVAVKVLRSNGEGTVSDVIKGIEYVAREHIESSRK 300
           T CAG I +K        GV  N K+  +++L  +GE T  D    + Y     ++++  
Sbjct: 215 TRCAGEIAAKKGNNFCGIGVGYNAKISGIRIL--SGELTTEDEAASLIY----GLDTNDI 268

Query: 301 KSKEFKGSTANLSLGSSKSLAMEMAVDAAVD----SGVHFAIAAGN--ENEDAC-LSSPA 353
            S  +  +     L     L  +  V    +     G  +  A+GN   + D C      
Sbjct: 269 YSCSWGPADDGRHLQGPSDLVKKALVKGVTEGRDSKGAIYVFASGNGGAHGDNCNYDGYT 328

Query: 354 GAQKSITVGASTFSDDRAFFSNWGTCVDVFA------PGINIMSTYIGSRNATLSLSGTS 407
            +  SIT+GA    D    +S    C  V A       G  I S+ I  R +  S  GTS
Sbjct: 329 NSIYSITIGAIDHKDLHPPYSE--GCSAVMAVTYSSGSGEYIHSSDINGRCSN-SHGGTS 385

Query: 408 MAAPHVAGMLSYFLSLQPA 426
            AAP  AG+ +  L   P+
Sbjct: 386 AAAPLAAGVYTLLLEANPS 404

>Suva_14.106 Chr14 (196428..198857) [2430 bp, 809 aa] {ON} YNL238W
           (REAL)
          Length = 809

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 65/259 (25%), Positives = 104/259 (40%), Gaps = 38/259 (14%)

Query: 195 LEYLYEDAAGRGVTSYVLDTGIDTEHED----FEGRAVW----GAVIPGNDEASDLNGHG 246
           ++  Y +  G GV + ++D G+D E+ED    F     W       +P    + D   HG
Sbjct: 157 VDLWYNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPKPRLSDDY--HG 214

Query: 247 THCAGIIGSKH------YGVAKNTKLVAVKVLRSNGEGTVSDVIKGIEYVAREHIESSRK 300
           T CAG I +K        GV  N K+  +++L  +GE T  D    + Y     ++++  
Sbjct: 215 TRCAGEIAAKKGNDFCGVGVGYNAKISGIRIL--SGEITTEDEAASLIY----GLDTNDI 268

Query: 301 KSKEFKGSTANLSLGSSKSLAMEMAVDAAVD----SGVHFAIAAGN---ENEDACLSSPA 353
            S  +  +     L     L  +  V    +     G  +  A+GN     ++       
Sbjct: 269 YSCSWGPADDGRHLQGPSDLVKKALVKGVTEGRDSKGAIYVFASGNGGARGDNCNYDGYT 328

Query: 354 GAQKSITVGASTFSDDRAFFSNWGTCVDVFA------PGINIMSTYIGSRNATLSLSGTS 407
            +  SIT+GA    D    +S   +C  V A       G  I S+ I  +  + S  GTS
Sbjct: 329 NSIYSITIGAIDHKDLHPPYSE--SCSAVMAVTYSSGSGEYIHSSDINGK-CSDSHGGTS 385

Query: 408 MAAPHVAGMLSYFLSLQPA 426
            AAP  AG+ +  L   P+
Sbjct: 386 AAAPLAAGVYTLLLEANPS 404

>YNL238W Chr14 (202428..204872) [2445 bp, 814 aa] {ON}
           KEX2Subtilisin-like protease (proprotein convertase), a
           calcium-dependent serine protease involved in the
           activation of proproteins of the secretory pathway
          Length = 814

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 66/258 (25%), Positives = 101/258 (39%), Gaps = 38/258 (14%)

Query: 195 LEYLYEDAAGRGVTSYVLDTGIDTEHED----FEGRAVW----GAVIPGNDEASDLNGHG 246
           L+  Y +  G GV + ++D G+D E+ED    F     W       +P    + D   HG
Sbjct: 157 LDLWYNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPKPRLSDDY--HG 214

Query: 247 THCAGIIGSKH------YGVAKNTKLVAVKVLRSNGEGTVSDVIKGIEYVAREHIESSRK 300
           T CAG I +K        GV  N K+  +++L  +G+ T  D    + Y     ++ +  
Sbjct: 215 TRCAGEIAAKKGNNFCGVGVGYNAKISGIRIL--SGDITTEDEAASLIY----GLDVNDI 268

Query: 301 KSKEFKGSTANLSLGSSKSLAMEMAVDAAVD----SGVHFAIAAGN---ENEDACLSSPA 353
            S  +  +     L     L  +  V    +     G  +  A+GN     ++       
Sbjct: 269 YSCSWGPADDGRHLQGPSDLVKKALVKGVTEGRDSKGAIYVFASGNGGTRGDNCNYDGYT 328

Query: 354 GAQKSITVGASTFSDDRAFFSNWGTCVDVFA------PGINIMSTYIGSRNATLSLSGTS 407
            +  SIT+GA    D    +S    C  V A       G  I S+ I  R +  S  GTS
Sbjct: 329 NSIYSITIGAIDHKDLHPPYSE--GCSAVMAVTYSSGSGEYIHSSDINGRCSN-SHGGTS 385

Query: 408 MAAPHVAGMLSYFLSLQP 425
            AAP  AG+ +  L   P
Sbjct: 386 AAAPLAAGVYTLLLEANP 403

>Kwal_56.24800 s56 complement(1150009..1152420) [2412 bp, 803 aa]
           {ON} YNL238W (KEX2) - Ca2+-dependent serine protease
           [contig 160] FULL
          Length = 803

 Score = 43.9 bits (102), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 70/251 (27%), Positives = 100/251 (39%), Gaps = 33/251 (13%)

Query: 199 YEDAAGRGVTSYVLDTGIDTEHED----FEGRAVW----GAVIPGNDEASDLNGHGTHCA 250
           YE+  G  V   V+D G+D E ED    F     W       +P    + D   HGT CA
Sbjct: 156 YENITGHNVVVAVVDDGLDYESEDLKDNFSAEGSWDFNDNVALPKPRLSDDY--HGTRCA 213

Query: 251 GII--GSKHY---GVAKNTKLVAVKVLRSNGEGTVSDVIKGIEYVAREHIESSRKKSKEF 305
           G I  G   +   GVA N K+  +++L  + E T  D    + +     ++ +   S  +
Sbjct: 214 GEIAAGKNQFCGVGVAYNAKVAGLRIL--SAEVTSEDEAASLIHA----LDVNDIYSCSW 267

Query: 306 KGSTANLSLGSSKSLAMEMAVDAAV----DSGVHFAIAAGNEN--EDAC-LSSPAGAQKS 358
             S    SL     L  +  V   +    + G  +  A+GN    +D C       +  S
Sbjct: 268 GPSDDGRSLQGPDDLVKKALVTGVLKGRDEKGALYVFASGNGGMFDDNCNYDGYTNSIYS 327

Query: 359 ITVGASTFSDDRAFFSNWGTCVDVFA----PGINIMSTYIGSRNATLSLSGTSMAAPHVA 414
           ITVGA         +S   + V V       G +I ST I  R  + +  GTS AAP  A
Sbjct: 328 ITVGAIDHKGLHPPYSESCSAVMVVTYSSGSGEHIHSTDIHGR-CSDTHGGTSAAAPLAA 386

Query: 415 GMLSYFLSLQP 425
           G+ S  L   P
Sbjct: 387 GVYSLVLEANP 397

>NCAS0A00880 Chr1 (173726..176227) [2502 bp, 833 aa] {ON} Anc_2.6
           YNL238W
          Length = 833

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 110/465 (23%), Positives = 178/465 (38%), Gaps = 72/465 (15%)

Query: 10  LWASCNLCMIIPEFDEIVRFTQITDDSRNTKSLKNLRQQYSGG--FLMGGLDNTHKTELI 67
           ++  C LC+ I       R  Q   ++  TK   + +Q         M  LD+   T LI
Sbjct: 1   MFQVCALCLFI----ITTRKFQFIMNNETTKQQTHQKQPQRAPRQTAMTALDD--HTTLI 54

Query: 68  P------YRYIVVFNEDISIKSIESHRKMVQEAHSVSVSKLAEDDVFLEVVSSSIAPDLQ 121
           P      YRY  V +     + +E H     E     V  L +  VF + +SS++     
Sbjct: 55  PTKDYARYRYFAVESTLSVAELLERHPDWTYEH---PVRALPDHYVFSQPLSSTLQ---- 107

Query: 122 LGGIDSSFDINGLFRGYAGY--FTDEILNLVSQDP-------LIKFIEQESTVRLSNTSM 172
                 S  ++ L    A     T +  ++V + P       +   ++ +  + +S+ S 
Sbjct: 108 ----RRSLPLDPLPNHIASLQDLTPQRDHIVKRAPVPIIDSSMEPIVQAQKQLHISDPSF 163

Query: 173 QKDAPWGLHRISHREKAKYGQDL---EYLYEDAAGRGVTSYVLDTGIDTEH----EDFEG 225
            K   W  H I+    A  G D+   +  YE+  G G+ + ++D G+D ++    ++F  
Sbjct: 164 PKQ--W--HLIN---AAFPGNDVNVKQLWYENVTGTGIVAAIVDDGVDYDNDNIKDNFSR 216

Query: 226 RAVW----GAVIPGNDEASDLNGHGTHCAG-IIGSKH-----YGVAKNTKLVAVKVLRSN 275
              W       +P      D   HGT CAG I  SK+      GVA + K+  +++L  +
Sbjct: 217 EGSWDFNDNGPLPKPKLKDDY--HGTRCAGEIAASKNNGICGVGVAYDAKVAGIRIL--S 272

Query: 276 GEGTVSDVIKGIEYVAREHIESSRKKSKEFKGSTANLSLGSSKSLAMEMAVDAAVDSGVH 335
           GE T  D    + +    +   S        G+         K   +    +     G  
Sbjct: 273 GELTAEDEAASLVHALDVNDIYSCSWGPRDDGTHLQGPTDLVKKAMIRGVTEGRDQKGAL 332

Query: 336 FAIAAGNENE--DAC-LSSPAGAQKSITVGASTFSDDRAFFSNWGTCVDVFA----PGIN 388
           +  A+GN     D C       +  SITVGA         +S   + V V       G  
Sbjct: 333 YVFASGNGGAYGDNCNYDGYTNSIYSITVGAIDHKGLHPPYSESCSAVMVVTCSSGSGEF 392

Query: 389 IMSTYIGSRNATLSLSGTSMAAPHVAGMLSYFLSLQPAPDSEYFD 433
           I +T IG + +  +  GTS AAP  AG+  Y L LQ  P+  + D
Sbjct: 393 IHTTDIGDKCSN-THGGTSAAAPLAAGV--YTLVLQANPELTWRD 434

>Skud_14.101 Chr14 (191111..193570) [2460 bp, 819 aa] {ON} YNL238W
           (REAL)
          Length = 819

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 67/259 (25%), Positives = 105/259 (40%), Gaps = 38/259 (14%)

Query: 195 LEYLYEDAAGRGVTSYVLDTGIDTEHED----FEGRAVW----GAVIPGNDEASDLNGHG 246
           L+  Y +  G GV + ++D G+D E+ED    F     W       +P    + D   HG
Sbjct: 157 LKLWYNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPKPRLSDDY--HG 214

Query: 247 THCAGIIGSKH------YGVAKNTKLVAVKVLRSNGEGTVSDVIKGIEYVAREHIESSRK 300
           T CAG I +K        GV  N K+  +++L  +G+ T  D    + Y     ++++  
Sbjct: 215 TRCAGEIAAKKGNNFCGVGVGYNAKISGIRIL--SGDITTEDEAASLIY----GLDTNDI 268

Query: 301 KSKEFKGSTANLSLGSSKSL---AMEMAVDAAVDS-GVHFAIAAGN---ENEDACLSSPA 353
            S  +  +     L     L   A+   V    DS G  +  A+GN     ++       
Sbjct: 269 YSCSWGPADDGRHLQGPNDLVKKALVKGVTQGRDSKGAIYVFASGNGGARGDNCNYDGYT 328

Query: 354 GAQKSITVGASTFSDDRAFFSNWGTCVDV--FAPGINIMSTYIGSRNATLSLS----GTS 407
            +  SIT+GA    D    +S   + V V  ++ G      YI S +     S    GTS
Sbjct: 329 NSIYSITIGAIDHKDLHPPYSEGCSAVMVVTYSSG---SGEYIHSSDINGGCSNTHGGTS 385

Query: 408 MAAPHVAGMLSYFLSLQPA 426
            AAP  AG+ +  L   P+
Sbjct: 386 AAAPLAAGVYTLLLEANPS 404

>TBLA0B00130 Chr2 (12377..14905) [2529 bp, 842 aa] {ON} Anc_2.6
           YNL238W
          Length = 842

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 70/277 (25%), Positives = 108/277 (38%), Gaps = 31/277 (11%)

Query: 203 AGRGVTSYVLDTGIDTEHEDFEGRAVWGAVIPGNDEASDL------NGHGTHCAGIIGSK 256
            G+ VT  ++D G+D E+ED + +  +      ND  +        + HGT CAG I + 
Sbjct: 166 TGKNVTVAIVDDGVDYENEDLKDKFCFEGSWDFNDNTAKPKPRLSDDYHGTRCAGEIAAV 225

Query: 257 H-----YGVAKNTKLVAVKVLRSNGEGTVSDVIKGIEYVAREHIESSRKKSKEFKGSTAN 311
                  GVA +  +  +++L  +GE TV D    + Y  + +   S        G    
Sbjct: 226 RNDYCGVGVAFDAHISGLRIL--SGELTVEDEAAALIYGLKYNDIFSCSWGPPDDGQHLQ 283

Query: 312 LSLGSSKSLAMEMAVDAAVDSGVHFAIAAGN---ENEDACLSSPAGAQKSITVGASTFSD 368
                 K   ++   D   + G  +  A+GN     ++        +  SIT+GA    D
Sbjct: 284 GPYDLVKKAFIKGIQDGRDEKGAIYVFASGNGAISGDNCNYDGYTNSIYSITIGA---ID 340

Query: 369 DRAFFSNWG-TCVDVFA------PGINIMSTYIGSRNATLSLSGTSMAAPHVAGMLSYFL 421
            R     +  +C  V A       G  I +T I  + +T    GTS AAP  AG+ +  L
Sbjct: 341 HRGLHPAYSESCSAVMAVTYSSGSGKFIETTDINGKCST-HHGGTSAAAPLAAGVYALLL 399

Query: 422 SLQPA---PDSEYFDNALSPQELKEKVLKFSTHGVLG 455
              P     D +Y    LS + L E        G LG
Sbjct: 400 EANPELTWRDVQYL-TILSSKTLDENTDGKWQEGALG 435

>KAFR0A08040 Chr1 complement(1609550..1611850) [2301 bp, 766 aa]
           {ON} Anc_2.6 YNL238W
          Length = 766

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 69/256 (26%), Positives = 102/256 (39%), Gaps = 28/256 (10%)

Query: 199 YEDAAGRGVTSYVLDTGIDTEHED----FEGRAVW----GAVIPGNDEASDLNGHGTHCA 250
           Y++  G+GV + V+D G+D E+ D    F     W       +P    A D   HGT CA
Sbjct: 152 YQNITGKGVVAAVVDDGLDYENPDIKDNFCKEGSWDFNANTNLPKPTLADDY--HGTRCA 209

Query: 251 GIIGSKH------YGVAKNTKLVAVKVLRSNGEGTVSDVIKGIEYVAREHIESSRKKSKE 304
           G I +         GVA + K+  +++L  +GE T  D    +      +   S     +
Sbjct: 210 GEIAAVKNNGICGIGVAYDAKVAGIRIL--SGEITAEDEAAALINALDINDIYSCSWGPQ 267

Query: 305 FKGSTANLSLGSSKSLAMEMAVDAAVDSGVHFAIAAGNENE--DAC-LSSPAGAQKSITV 361
             G+         K   ++   D   + G  +  A+GN     D C       +  SITV
Sbjct: 268 DDGTHLQGPSDLVKKALIKGVNDGRKNKGAIYVFASGNGGSFGDNCNYDGYTNSIYSITV 327

Query: 362 GASTFSDDRAFFSNWGTCVDVFA----PGINIMSTYIGSRNATLSLSGTSMAAPHVAGML 417
           GA    D    +S   + V V       G  I +T I ++       GTS AAP  AG+ 
Sbjct: 328 GAIDHKDLHPPYSESCSAVMVVTYSSGSGEYIHTTDINNK-CNDRHGGTSAAAPLAAGI- 385

Query: 418 SYFLSLQPAPDSEYFD 433
            Y L LQ  P+  + D
Sbjct: 386 -YTLLLQANPNLTWRD 400

>SAKL0G00440g Chr7 (41016..43526) [2511 bp, 836 aa] {ON} similar to
           uniprot|P13134 YNL238W Saccharomyces cerevisiae KEX2
           Subtilisin-like protease (proprotein convertase)
          Length = 836

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 67/255 (26%), Positives = 102/255 (40%), Gaps = 27/255 (10%)

Query: 199 YEDAAGRGVTSYVLDTGIDTEHED----FEGRAVW----GAVIPGNDEASDLNGHGTHCA 250
           YE+  G GV + ++D G+D E+ D    F     W       +P      D   HGT CA
Sbjct: 185 YENITGHGVVAAIVDDGLDYENRDLKDNFCAEGSWDFNDNTPLPKPRLRDDY--HGTRCA 242

Query: 251 GIIGSKH-----YGVAKNTKLVAVKVLRSNGEGTVSDVIKGIEYVAREHIESSRKKSKEF 305
           G I +        GVA N K+  +++L  +GE T  D    + Y    +   S       
Sbjct: 243 GEIAAVKNDACGVGVAYNAKVAGIRIL--SGEITSEDEAASLVYGLGVNDIYSCSWGPAD 300

Query: 306 KGSTANLSLGSSKSLAMEMAVDAAVDSGVHFAIAAGNEN--EDAC-LSSPAGAQKSITVG 362
            G          K   ++  ++   + G  +  A+GN    +D C       +  SITVG
Sbjct: 301 DGRQMQAPDELVKKAIVKGVLEGRDEKGALYVFASGNGGLYDDNCNYDGYTNSIYSITVG 360

Query: 363 ASTFSDDRAFFSNWGTCVDVFA----PGINIMSTYIGSRNATLSLSGTSMAAPHVAGMLS 418
           A         ++   + V V       G +I ST + ++  +    GTS AAP  AG+  
Sbjct: 361 AIDHKGLHPPYAEACSAVLVVTYSSGSGEHIHSTDVNNQ-CSHRHGGTSAAAPLAAGI-- 417

Query: 419 YFLSLQPAPDSEYFD 433
           Y L L+  PD  + D
Sbjct: 418 YSLVLEANPDLTWRD 432

>KLLA0D19811g Chr4 complement(1672338..1674608) [2271 bp, 756 aa]
           {ON} uniprot|P09231 Kluyveromyces lactis KLLA0D19811g
           KEX1 protease precursor
          Length = 756

 Score = 40.0 bits (92), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 63/249 (25%), Positives = 105/249 (42%), Gaps = 31/249 (12%)

Query: 200 EDAAGRGVTSYVLDTGIDTEHEDFEGRAVWGAVIPGNDEASDLNG----------HGTHC 249
           E+  G GV + ++D G+D E+ED +        + G+ + +D N           HGT C
Sbjct: 151 ENITGYGVVAALVDDGLDYENEDLKDN----FCVEGSWDFNDNNPLPKPRLKDDYHGTRC 206

Query: 250 AGIIGSKH-----YGVAKNTKLVAVKVL--RSNGEGTVSDVIKGIEYVAREHIESSRKKS 302
           AG I +        GVA N+K+  +++L  +   E   + +I G++    +    S   S
Sbjct: 207 AGEIAAFRNDICGVGVAYNSKVSGIRILSGQITAEDEAASLIYGLD--VNDIYSCSWGPS 264

Query: 303 KEFKGSTANLSLGSSKSLAMEMAVDAAVDSGVHFAIAAGNENE--DAC-LSSPAGAQKSI 359
            + K   A  +L   K   ++   +     G  +  A+GN     D+C       +  SI
Sbjct: 265 DDGKTMQAPDTL--VKKAIIKGVTEGRDAKGALYVFASGNGGMFGDSCNFDGYTNSIFSI 322

Query: 360 TVGASTFSDDRAFFSNWGTCVDV--FAPGI-NIMSTYIGSRNATLSLSGTSMAAPHVAGM 416
           TVGA  +      +S   + V V  ++ G  N + T       + +  GTS AAP  AG+
Sbjct: 323 TVGAIDWKGLHPPYSESCSAVMVVTYSSGSGNYIKTTDLDEKCSNTHGGTSAAAPLAAGI 382

Query: 417 LSYFLSLQP 425
            +  L   P
Sbjct: 383 YTLVLEANP 391

>ZYRO0F15598g Chr6 complement(1278928..1281300) [2373 bp, 790 aa]
           {ON} similar to uniprot|P13134 YNL238W Saccharomyces
           cerevisiae KEX2 Subtilisin-like protease (proprotein
           convertase)
          Length = 790

 Score = 39.7 bits (91), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 46/103 (44%), Gaps = 13/103 (12%)

Query: 199 YEDAAGRGVTSYVLDTGIDTEHEDFEGRAVWGAVIPGNDEAS------DLNGHGTHCAGI 252
           YE+  G GV + ++D G+D E ED +           ND         D + HGT CAG 
Sbjct: 154 YENITGHGVVAAIVDDGLDYESEDLKDNFCKEGSWDFNDNTKLPKPRLDDDYHGTRCAGE 213

Query: 253 IGSK-----HYGVAKNTKLVAVKVLRS--NGEGTVSDVIKGIE 288
           I +        GVA N KL  +++L      E   + +I G++
Sbjct: 214 IAAVPNDFCAVGVAFNAKLSGIRILSGEITAEQEAASLIYGLD 256

>Ecym_6486 Chr6 complement(941694..944039) [2346 bp, 781 aa] {ON}
           similar to Ashbya gossypii ABL203W
          Length = 781

 Score = 38.9 bits (89), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 44/100 (44%), Gaps = 18/100 (18%)

Query: 192 GQDL---EYLYEDAAGRGVTSYVLDTGIDTEHED----FEGRAVW----GAVIPGNDEAS 240
           G DL   E  Y +  G GV + ++D G+D E ED    F     W       +P      
Sbjct: 144 GNDLNITELWYNNITGHGVVAAIVDDGLDYESEDLKDNFCAEGSWDFNANTALPKPILGD 203

Query: 241 DLNGHGTHCAGIIGSKH-----YGVAKNTKLVAVKVLRSN 275
           D   HGT CAG I +        GVA N K+  +++L ++
Sbjct: 204 D--NHGTRCAGEIAAAKNKVCGVGVAYNAKVSGIRILSAD 241

>KLTH0H00418g Chr8 (46022..48457) [2436 bp, 811 aa] {ON} similar to
           uniprot|P13134 YNL238W Saccharomyces cerevisiae KEX2
           Subtilisin-like protease (proprotein convertase)
          Length = 811

 Score = 38.5 bits (88), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 66/251 (26%), Positives = 96/251 (38%), Gaps = 33/251 (13%)

Query: 199 YEDAAGRGVTSYVLDTGIDTEHED----FEGRAVW----GAVIPGNDEASDLNGHGTHCA 250
           YE+  G  V   V+D G+D E ED    F     W       +P    + D   HGT CA
Sbjct: 155 YENVTGHNVVVAVVDDGLDYESEDLKDNFSAEGSWDFNDNGPMPKPRLSDDY--HGTRCA 212

Query: 251 GIIGSKH-----YGVAKNTKLVAVKVLRSNGEGTVSDVIKGIEYVAREHIESSRKKSKEF 305
           G I +        GVA N K+  +++L  + E T  D    + +     ++ +   S  +
Sbjct: 213 GEIAAVKNKACGIGVAYNAKVAGIRIL--SAEVTAEDEAASLIHA----LDVNDIYSCSW 266

Query: 306 KGSTANLSLGSSKSLAMEMAVDAAV----DSGVHFAIAAGNEN--EDAC-LSSPAGAQKS 358
                   L     L  +  V        + G  +  A+GN    +D C       +  S
Sbjct: 267 GPLDDGRVLQGPDDLVRKALVTGVTKGRNEKGALYVFASGNGGMYDDNCNYDGYTNSIYS 326

Query: 359 ITVGASTFSDDRAFFSNWGTCVDVF----APGINIMSTYIGSRNATLSLSGTSMAAPHVA 414
           ITVGA         +S   + V V       G +I ST I  +  + +  GTS AAP  A
Sbjct: 327 ITVGAIDHKGLHPPYSESCSAVMVVTYSSGSGEHIHSTDIHGK-CSDTHGGTSAAAPLAA 385

Query: 415 GMLSYFLSLQP 425
           G+ S  L   P
Sbjct: 386 GVYSLVLEANP 396

>KNAG0F00770 Chr6 (137641..140121) [2481 bp, 826 aa] {ON} Anc_2.6
           YNL238W
          Length = 826

 Score = 38.1 bits (87), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 39/136 (28%), Positives = 60/136 (44%), Gaps = 28/136 (20%)

Query: 155 LIKFIEQESTVRLSNTSMQKDAPWGLHRISHREKAKY-GQDL---EYLYEDAAGRGVTSY 210
           +I   E E  + +++ + +K   W      H   A Y G D+   +  Y +  G GV   
Sbjct: 125 MIPLKEAEEKLEINDPNFEKQ--W------HLINANYPGNDVNVKDVWYGNVTGSGVVVA 176

Query: 211 VLDTGIDTEHED----FEGRAVW----GAVIPGNDEASDLNGHGTHCAG-IIGSKH---- 257
           ++D G+D E+ D    F     W       +P    A D   HGT CAG I  SK+    
Sbjct: 177 IVDDGVDYENPDIADNFCAEGSWDFNDNTTLPKPRLADDY--HGTRCAGEIAASKNNGFC 234

Query: 258 -YGVAKNTKLVAVKVL 272
             GVA N+K+  +++L
Sbjct: 235 GIGVAYNSKVSGLRIL 250

>TBLA0A02660 Chr1 (645270..648086) [2817 bp, 938 aa] {ON} Anc_5.457
           YOR129C
          Length = 938

 Score = 37.4 bits (85), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 38/124 (30%), Positives = 67/124 (54%), Gaps = 19/124 (15%)

Query: 59  DNTHK--TELIPYRYIVVFNEDISIKSIESHRKMVQEAHSVSVSKLAEDDVFLEVVSSSI 116
           DN H     LI Y+ I+ F  + +IK I++ ++ +Q   + ++ KL+ DD+F ++   S 
Sbjct: 612 DNLHDFVNTLIIYKSILPFTINNNIKYIDNKKQFLQ---NFNIQKLSMDDLFFQINELSR 668

Query: 117 APDLQLGGIDSSFDING-LFRGYAGYFTDEILNLVSQDPLIKFIEQESTVRLSNTSM--Q 173
            PD+ L  I  + DIN  L + +      E+L L    PLI   +++ +++ S ++M  Q
Sbjct: 669 YPDI-LNNIHLNKDINNILIKPFM-----ELLFL----PLIITQKRKHSIK-SRSTMHSQ 717

Query: 174 KDAP 177
           KD P
Sbjct: 718 KDKP 721

>Kpol_1015.8 s1015
           complement(19725..20576,20692..20940,20990..20998,
           21041..22462) [2532 bp, 843 aa] {ON}
           complement(19725..20576,20692..20940,20990..20998,
           21041..22462) [2532 nt, 844 aa]
          Length = 843

 Score = 34.7 bits (78), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 45/102 (44%), Gaps = 13/102 (12%)

Query: 199 YEDAAGRGVTSYVLDTGIDTEHED----FEGRAVWGAVIPGNDEASDL--NGHGTHCAGI 252
           YE   G+GV   ++D G+D E ED    F     W      N     L  + HGT CAG 
Sbjct: 157 YEGITGKGVVVAIVDDGLDYESEDLKDNFCKEGSWDFNENQNLPKPLLYDDYHGTRCAGE 216

Query: 253 IGSKH-----YGVAKNTKLVAVKVLRSNGEGTVSDVIKGIEY 289
           I +        GVA  +K+  +++L  +G+ T  D    + Y
Sbjct: 217 IAAAKNEYCGLGVAYGSKVSGIRIL--SGQITAEDEAASLVY 256

>ABL203W Chr2 (26256..28562) [2307 bp, 768 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YNL238W (KEX2)
          Length = 768

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 37/82 (45%), Gaps = 15/82 (18%)

Query: 204 GRGVTSYVLDTGIDTEHED----FEGRAVW----GAVIPGNDEASDLNGHGTHCAGIIGS 255
           G G+   V+D G+D E ED    F     W       +P    + D   HGT CAG I +
Sbjct: 156 GHGIVVAVVDDGLDYESEDLKDNFCAEGSWDFNSNTALPKPMLSDDT--HGTRCAGEIAA 213

Query: 256 KH-----YGVAKNTKLVAVKVL 272
                   GVA N+K+  +++L
Sbjct: 214 AKNQFCGLGVAFNSKVSGIRIL 235

>KAFR0I01730 Chr9 (351397..352599) [1203 bp, 400 aa] {ON} Anc_2.571
           YKL047W
          Length = 400

 Score = 32.0 bits (71), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 43/155 (27%), Positives = 66/155 (42%), Gaps = 16/155 (10%)

Query: 48  QYSGGFLMGGLDNTHKTELIPYRY----IVVFNEDISIKSIESHRKMVQEAHSVSVSKLA 103
           QY      GG+     TE +PY       ++F   I    + + + +V      S    +
Sbjct: 131 QYYKEQKTGGITRRSMTEYVPYWMEQLGPLIF--PIWKSCLLNEKILVLIPFGCSFETCS 188

Query: 104 EDDVFLEVVS-SSIAPDLQLGGIDSSFDINGLFRGYAGYF---TDEILNLVSQ--DPLIK 157
               FL +VS SS   + QL     +FD++ + +G  GY    +DEIL L  +  D LIK
Sbjct: 189 ALCYFLHLVSNSSSVQETQLLFTIGTFDVDSMLKGTCGYIACTSDEILTLNDKLYDKLIK 248

Query: 158 F---IEQESTVRLSNTS-MQKDAPWGLHRISHREK 188
               +E  +   L+NT+ + K  P  L      EK
Sbjct: 249 IPGDVENATVQFLTNTNELIKGTPHELELFQISEK 283

>ZYRO0A03278g Chr1 (264444..267179) [2736 bp, 911 aa] {ON} similar
           to uniprot|Q12071 Saccharomyces cerevisiae YDR027C VPS54
           Component of the GARP (Golgi-associated retrograde
           protein) complex
          Length = 911

 Score = 31.6 bits (70), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 28/54 (51%), Gaps = 2/54 (3%)

Query: 343 ENEDACLSSPAGAQKSITVGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGS 396
           ENE     + AG +KS+ V  +TF    +  +N G   +VF   +N+ S Y+ +
Sbjct: 761 ENEKK--EAQAGHKKSVVVEDNTFVASDSLLTNIGLIKEVFILAVNLPSAYLAN 812

>TPHA0P01790 Chr16 complement(373247..375646) [2400 bp, 799 aa] {ON}
           Anc_2.6 YNL238W
          Length = 799

 Score = 31.2 bits (69), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 65/253 (25%), Positives = 96/253 (37%), Gaps = 31/253 (12%)

Query: 203 AGRGVTSYVLDTGIDTEHED----FEGRAVW----GAVIPGNDEASDLNGHGTHCAGIIG 254
            G+GV + ++D G+D   ED    F     W       +P      D   HGT CAG I 
Sbjct: 162 TGKGVVAAIVDDGLDHNSEDLKDNFCEEGSWDFNENKKLPTPKLIDDY--HGTRCAGEIA 219

Query: 255 SKH-----YGVAKNTKLVAVKVLRSNGEGTVSDVIKGIEYVAREHIESSRKKSKEFKGST 309
           +        GVA   K+  +++L  +G+ T  D    + Y    +   S        G  
Sbjct: 220 AVKNEYCGLGVAYGAKVAGIRIL--SGQITAEDEAASLMYGLDINDIFSCSWGPPDDGKH 277

Query: 310 ANLSLGSSKSLAMEMAVDAAVDSGVHFAIAAGNENE--DAC-LSSPAGAQKSITVGASTF 366
                   K   ++   +   + G  +  A+GN     D C       +  SIT+GA   
Sbjct: 278 LQGPSDLVKKAMIKGTQEGRNEKGSIYVFASGNGGHYGDNCNYDGYTNSIYSITIGAIDH 337

Query: 367 SDDRAFFSNWGTCVDVFA------PGINIMSTYIGSRNATLSLSGTSMAAPHVAGMLSYF 420
                 +S   +C  V A       G  I ST I S+  +    GTS AAP  AG+  Y 
Sbjct: 338 KGLHPPYSE--SCSAVLAVTYSSGSGEYIHSTDIKSQ-CSDRHGGTSAAAPLAAGI--YA 392

Query: 421 LSLQPAPDSEYFD 433
           L L+  P+  + D
Sbjct: 393 LVLEANPELTWRD 405

>Kwal_55.20464 s55 complement(414783..418352) [3570 bp, 1189 aa] {ON}
            YPR122W (AXL1) - putative homolog of human
            insulin-degrading endoprotease [contig 148] FULL
          Length = 1189

 Score = 31.2 bits (69), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 59/124 (47%), Gaps = 20/124 (16%)

Query: 75   FNEDISIKSIESHRKMVQEAHSVSVSKLAEDDVFLEVVSSSIAPDLQLGGID-SSFDIN- 132
            F+E ISI S++  +  V  A  ++  ++++  +FL+V S      L+L G+  SS D++ 
Sbjct: 1041 FSEKISIYSLKRSKLSVMIASPMTAEEISQKRLFLQVESF-----LKLKGLKISSSDLHD 1095

Query: 133  ----------GLFRGYAGYFTDEILNLVSQDPLIKFIEQESTVRLSNTSMQK---DAPWG 179
                      G+ RG   YF+     +   + +IK I +   + L N S +    DA  G
Sbjct: 1096 IIETSLGRTSGILRGLFRYFSANGETMKLCNVIIKEISKALVLSLKNPSQRTRVDDALRG 1155

Query: 180  LHRI 183
            L +I
Sbjct: 1156 LSKI 1159

>TBLA0G03060 Chr7 complement(808675..811491) [2817 bp, 938 aa] {ON}
           Anc_3.257 YDR027C
          Length = 938

 Score = 31.2 bits (69), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 37/93 (39%), Gaps = 19/93 (20%)

Query: 301 KSKEFKGSTANLSLGSSKSLAMEMAVDAAVDSGVHFAIAAGNENEDACLSSPAGAQKSIT 360
           KSKE K +  NLS G++KS    +A DA  +S                   P G +KS+ 
Sbjct: 767 KSKENKTNINNLSAGTTKSSEPSIA-DATKESK------------------PVGHKKSVV 807

Query: 361 VGASTFSDDRAFFSNWGTCVDVFAPGINIMSTY 393
           V   TF       +      D     IN+ S+Y
Sbjct: 808 VADKTFVASETLINAITILKDTLILSINLPSSY 840

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.133    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 50,861,971
Number of extensions: 2219539
Number of successful extensions: 6520
Number of sequences better than 10.0: 89
Number of HSP's gapped: 6498
Number of HSP's successfully gapped: 89
Length of query: 478
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 365
Effective length of database: 40,524,141
Effective search space: 14791311465
Effective search space used: 14791311465
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)