Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_15.1706.25ON77377341080.0
YOR001W (RRP6)6.25ON73373330740.0
Suva_15.1766.25ON74574929960.0
Skud_15.1626.25ON73473429930.0
NCAS0H008606.25ON75575119910.0
KAFR0G026606.25ON73573719880.0
SAKL0E01452g6.25ON73774419570.0
Kpol_1037.296.25ON74674619380.0
KNAG0M012306.25ON73874618890.0
CAGL0E02585g6.25ON73775018390.0
TPHA0J003706.25ON74375018320.0
NDAI0D008506.25ON79077318310.0
ZYRO0C07678g6.25ON74174418090.0
TBLA0A071706.25ON77175718010.0
KLLA0D01309g6.25ON74474917980.0
TDEL0G044406.25ON73574317960.0
ACL001C6.25ON74574817570.0
Ecym_30306.25ON74775517280.0
Kwal_56.224476.25ON73574316620.0
KLTH0C11066g6.25ON73574716000.0
NDAI0A011308.379ON478109960.007
SAKL0D00902g8.857ON441146930.017
Smik_13.3896.263ON19852820.15
KLTH0F06886g8.857ON44183830.23
KLTH0D11616g8.691ON302112780.70
KLLA0D12936g6.268ON283131761.2
TBLA0D026108.63ON30366771.2
Kwal_33.142848.857ON44183771.4
Kwal_23.34812.335ON908107761.9
Smik_21.8singletonON55581734.0
YDR402C (DIT2)5.493ON48989724.9
TBLA0B006302.57ON51676716.5
YOR251C (TUM1)8.691ON304151708.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_15.170
         (773 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_15.170 Chr15 (294013..296334) [2322 bp, 773 aa] {ON} YOR001...  1587   0.0  
YOR001W Chr15 (326832..329033) [2202 bp, 733 aa] {ON}  RRP6Nucle...  1188   0.0  
Suva_15.176 Chr15 (301216..303453) [2238 bp, 745 aa] {ON} YOR001...  1158   0.0  
Skud_15.162 Chr15 (286822..289026) [2205 bp, 734 aa] {ON} YOR001...  1157   0.0  
NCAS0H00860 Chr8 complement(156180..158447) [2268 bp, 755 aa] {O...   771   0.0  
KAFR0G02660 Chr7 (549718..551925) [2208 bp, 735 aa] {ON} Anc_6.2...   770   0.0  
SAKL0E01452g Chr5 (108911..111124) [2214 bp, 737 aa] {ON} simila...   758   0.0  
Kpol_1037.29 s1037 complement(68981..71221) [2241 bp, 746 aa] {O...   751   0.0  
KNAG0M01230 Chr13 complement(223471..225687) [2217 bp, 738 aa] {...   732   0.0  
CAGL0E02585g Chr5 (246427..248640) [2214 bp, 737 aa] {ON} simila...   712   0.0  
TPHA0J00370 Chr10 complement(81371..83602) [2232 bp, 743 aa] {ON...   710   0.0  
NDAI0D00850 Chr4 complement(190801..193173) [2373 bp, 790 aa] {O...   709   0.0  
ZYRO0C07678g Chr3 (582236..584461) [2226 bp, 741 aa] {ON} simila...   701   0.0  
TBLA0A07170 Chr1 (1784984..1787299) [2316 bp, 771 aa] {ON} Anc_6...   698   0.0  
KLLA0D01309g Chr4 (114713..116947) [2235 bp, 744 aa] {ON} simila...   697   0.0  
TDEL0G04440 Chr7 (805881..808088) [2208 bp, 735 aa] {ON} Anc_6.2...   696   0.0  
ACL001C Chr3 complement(354804..357041) [2238 bp, 745 aa] {ON} S...   681   0.0  
Ecym_3030 Chr3 (58929..61172) [2244 bp, 747 aa] {ON} similar to ...   670   0.0  
Kwal_56.22447 s56 (133578..135785) [2208 bp, 735 aa] {ON} YOR001...   644   0.0  
KLTH0C11066g Chr3 complement(910359..912566) [2208 bp, 735 aa] {...   620   0.0  
NDAI0A01130 Chr1 complement(240944..242380) [1437 bp, 478 aa] {O...    42   0.007
SAKL0D00902g Chr4 complement(70897..72222) [1326 bp, 441 aa] {ON...    40   0.017
Smik_13.389 Chr13 (612617..613213) [597 bp, 198 aa] {ON} YMR184W...    36   0.15 
KLTH0F06886g Chr6 complement(604652..605977) [1326 bp, 441 aa] {...    37   0.23 
KLTH0D11616g Chr4 complement(951182..952090) [909 bp, 302 aa] {O...    35   0.70 
KLLA0D12936g Chr4 complement(1106301..1107070,1107164..1107245) ...    34   1.2  
TBLA0D02610 Chr4 (641823..642734) [912 bp, 303 aa] {ON} Anc_8.63...    34   1.2  
Kwal_33.14284 s33 complement(600693..602018) [1326 bp, 441 aa] {...    34   1.4  
Kwal_23.3481 s23 (310853..313579) [2727 bp, 908 aa] {ON} YGL141W...    34   1.9  
Smik_21.8 Chr21 (8409..10076) [1668 bp, 555 aa] {ON} YBR158W (REAL)    33   4.0  
YDR402C Chr4 complement(1272234..1273703) [1470 bp, 489 aa] {ON}...    32   4.9  
TBLA0B00630 Chr2 (130354..131904) [1551 bp, 516 aa] {ON} Anc_2.5...    32   6.5  
YOR251C Chr15 complement(802550..803464) [915 bp, 304 aa] {ON}  ...    32   8.2  

>Smik_15.170 Chr15 (294013..296334) [2322 bp, 773 aa] {ON} YOR001W
           (REAL)
          Length = 773

 Score = 1587 bits (4108), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 773/773 (100%), Positives = 773/773 (100%)

Query: 1   MLINNIRPSENFSLVTLFMYFKDRYEERRLNNQKAPTPYVMASQNPDVLLSKVVNVIRAA 60
           MLINNIRPSENFSLVTLFMYFKDRYEERRLNNQKAPTPYVMASQNPDVLLSKVVNVIRAA
Sbjct: 1   MLINNIRPSENFSLVTLFMYFKDRYEERRLNNQKAPTPYVMASQNPDVLLSKVVNVIRAA 60

Query: 61  SSLAGQDVDFYKNLDREFGKVLKSKSDKLADMANEIILSIDEHHESFELKDEDISGLWND 120
           SSLAGQDVDFYKNLDREFGKVLKSKSDKLADMANEIILSIDEHHESFELKDEDISGLWND
Sbjct: 61  SSLAGQDVDFYKNLDREFGKVLKSKSDKLADMANEIILSIDEHHESFELKDEDISGLWND 120

Query: 121 FGNIMDNLLEMSDHSLDKLNRAVTSKPNGADLQYLGDFSEKNLSPAKRVEKPQLKFKTPI 180
           FGNIMDNLLEMSDHSLDKLNRAVTSKPNGADLQYLGDFSEKNLSPAKRVEKPQLKFKTPI
Sbjct: 121 FGNIMDNLLEMSDHSLDKLNRAVTSKPNGADLQYLGDFSEKNLSPAKRVEKPQLKFKTPI 180

Query: 181 DNSESHPFIPLLKEKPNALKPLSDSLRLIEEDDNTPSHYPHPYEYEIDHQEYGSNILQIR 240
           DNSESHPFIPLLKEKPNALKPLSDSLRLIEEDDNTPSHYPHPYEYEIDHQEYGSNILQIR
Sbjct: 181 DNSESHPFIPLLKEKPNALKPLSDSLRLIEEDDNTPSHYPHPYEYEIDHQEYGSNILQIR 240

Query: 241 KEIPSKSWNDSEPIWIDTMPKLESMLEELKNVQEIAVDLEHHDYRSYYGIVCLMQISTRE 300
           KEIPSKSWNDSEPIWIDTMPKLESMLEELKNVQEIAVDLEHHDYRSYYGIVCLMQISTRE
Sbjct: 241 KEIPSKSWNDSEPIWIDTMPKLESMLEELKNVQEIAVDLEHHDYRSYYGIVCLMQISTRE 300

Query: 301 KDYLVDTLELRETLHILNEVFTDPSIVKVFHGAFMDIIWLQRDLGLYVVGLFDTYHASKA 360
           KDYLVDTLELRETLHILNEVFTDPSIVKVFHGAFMDIIWLQRDLGLYVVGLFDTYHASKA
Sbjct: 301 KDYLVDTLELRETLHILNEVFTDPSIVKVFHGAFMDIIWLQRDLGLYVVGLFDTYHASKA 360

Query: 361 IGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMIAYARADTHFLLNIYDQLRNKL 420
           IGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMIAYARADTHFLLNIYDQLRNKL
Sbjct: 361 IGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMIAYARADTHFLLNIYDQLRNKL 420

Query: 421 IESNKLAGVLYESRNVAKRRFEYSKYRPRIPSSEVYSPIEKEAPWRVLMYQYNITSEKEE 480
           IESNKLAGVLYESRNVAKRRFEYSKYRPRIPSSEVYSPIEKEAPWRVLMYQYNITSEKEE
Sbjct: 421 IESNKLAGVLYESRNVAKRRFEYSKYRPRIPSSEVYSPIEKEAPWRVLMYQYNITSEKEE 480

Query: 481 LVKDLYQWRDVIARRDDESPRFVMPNQLLAALVAYTPIDVIGVISLTNGITEHVRQNAKV 540
           LVKDLYQWRDVIARRDDESPRFVMPNQLLAALVAYTPIDVIGVISLTNGITEHVRQNAKV
Sbjct: 481 LVKDLYQWRDVIARRDDESPRFVMPNQLLAALVAYTPIDVIGVISLTNGITEHVRQNAKV 540

Query: 541 LVNLIKNSLRHIKDTYKEDSPVTFSESMTNEVSLEAITIPQIRDIMERFSVLSNSNVSNC 600
           LVNLIKNSLRHIKDTYKEDSPVTFSESMTNEVSLEAITIPQIRDIMERFSVLSNSNVSNC
Sbjct: 541 LVNLIKNSLRHIKDTYKEDSPVTFSESMTNEVSLEAITIPQIRDIMERFSVLSNSNVSNC 600

Query: 601 RAKNGATPSILLGRILPLEENDIAYKNNGLPNRVKFEDIRARAQSFNSALSNLEDCMLEV 660
           RAKNGATPSILLGRILPLEENDIAYKNNGLPNRVKFEDIRARAQSFNSALSNLEDCMLEV
Sbjct: 601 RAKNGATPSILLGRILPLEENDIAYKNNGLPNRVKFEDIRARAQSFNSALSNLEDCMLEV 660

Query: 661 EKPHILPTNVKKIERINTEDVPKHSATIENPDDIVVLKKKNIHRTQSMNAKDTMGEKAID 720
           EKPHILPTNVKKIERINTEDVPKHSATIENPDDIVVLKKKNIHRTQSMNAKDTMGEKAID
Sbjct: 661 EKPHILPTNVKKIERINTEDVPKHSATIENPDDIVVLKKKNIHRTQSMNAKDTMGEKAID 720

Query: 721 YSKIPNVLSSKSDQNRRQQKKRRSDPLFNDSDGPRAAKKKRPATRGRNVSFKR 773
           YSKIPNVLSSKSDQNRRQQKKRRSDPLFNDSDGPRAAKKKRPATRGRNVSFKR
Sbjct: 721 YSKIPNVLSSKSDQNRRQQKKRRSDPLFNDSDGPRAAKKKRPATRGRNVSFKR 773

>YOR001W Chr15 (326832..329033) [2202 bp, 733 aa] {ON}  RRP6Nuclear
           exosome exonuclease component; has 3'-5' exonuclease
           activity; involved in RNA processing, maturation,
           surveillance, degradation, tethering, and export; has
           similarity to E. coli RNase D and to human PM-Sc1 100
           (EXOSC10); mutant displays reduced transcription
           elongation in the G-less-based run-on (GLRO) assay
          Length = 733

 Score = 1188 bits (3074), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 569/733 (77%), Positives = 648/733 (88%)

Query: 41  MASQNPDVLLSKVVNVIRAASSLAGQDVDFYKNLDREFGKVLKSKSDKLADMANEIILSI 100
           M S+NPDVLLS+V+NV+RAASSLA QDVDFYKNLDR F K LKSK+DKLADMANEIILSI
Sbjct: 1   MTSENPDVLLSRVINVVRAASSLASQDVDFYKNLDRGFSKDLKSKADKLADMANEIILSI 60

Query: 101 DEHHESFELKDEDISGLWNDFGNIMDNLLEMSDHSLDKLNRAVTSKPNGADLQYLGDFSE 160
           DEHHESFELK+EDIS LWN+FGNIMDNLLEMSDHSLDKLN A+ SK  G+DLQYLG+FS 
Sbjct: 61  DEHHESFELKEEDISDLWNNFGNIMDNLLEMSDHSLDKLNCAINSKSRGSDLQYLGEFSG 120

Query: 161 KNLSPAKRVEKPQLKFKTPIDNSESHPFIPLLKEKPNALKPLSDSLRLIEEDDNTPSHYP 220
           KN SP KRVEKPQLKFK+PIDNSESHPFIPLLKEKPNALKPLS+SLRL+++D+N PSHYP
Sbjct: 121 KNFSPTKRVEKPQLKFKSPIDNSESHPFIPLLKEKPNALKPLSESLRLVDDDENNPSHYP 180

Query: 221 HPYEYEIDHQEYGSNILQIRKEIPSKSWNDSEPIWIDTMPKLESMLEELKNVQEIAVDLE 280
           HPYEYEIDHQEY   ILQIR+EIPSKSW+DS PIW+DT  +LESMLE+LKN +EIAVDLE
Sbjct: 181 HPYEYEIDHQEYSPEILQIREEIPSKSWDDSVPIWVDTSTELESMLEDLKNTKEIAVDLE 240

Query: 281 HHDYRSYYGIVCLMQISTREKDYLVDTLELRETLHILNEVFTDPSIVKVFHGAFMDIIWL 340
           HHDYRSYYGIVCLMQISTRE+DYLVDTL+LRE LHILNEVFT+PSIVKVFHGAFMDIIWL
Sbjct: 241 HHDYRSYYGIVCLMQISTRERDYLVDTLKLRENLHILNEVFTNPSIVKVFHGAFMDIIWL 300

Query: 341 QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMIA 400
           QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPM A
Sbjct: 301 QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMTA 360

Query: 401 YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPRIPSSEVYSPIE 460
           YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRP  PSSEVYSPIE
Sbjct: 361 YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPLTPSSEVYSPIE 420

Query: 461 KEAPWRVLMYQYNITSEKEELVKDLYQWRDVIARRDDESPRFVMPNQLLAALVAYTPIDV 520
           KE+PW++LMYQYNI  E+E LV++LYQWRD+IARRDDESPRFVMPNQLLAALVAYTP DV
Sbjct: 421 KESPWKILMYQYNIPPEREVLVRELYQWRDLIARRDDESPRFVMPNQLLAALVAYTPTDV 480

Query: 521 IGVISLTNGITEHVRQNAKVLVNLIKNSLRHIKDTYKEDSPVTFSESMTNEVSLEAITIP 580
           IGV+SLTNG+TEHVRQNAK+L NLI+++LR+IK+T +E +P+  SE+  + + LE I++P
Sbjct: 481 IGVVSLTNGVTEHVRQNAKLLANLIRDALRNIKNTNEEATPIPSSETKADGILLETISVP 540

Query: 581 QIRDIMERFSVLSNSNVSNCRAKNGATPSILLGRILPLEENDIAYKNNGLPNRVKFEDIR 640
           QIRD+MERFSVL NSN+S  RAK     SILLG+ILP EE+DIAY  +GLPN+VK EDIR
Sbjct: 541 QIRDVMERFSVLCNSNISKSRAKPVTNSSILLGKILPREEHDIAYSKDGLPNKVKTEDIR 600

Query: 641 ARAQSFNSALSNLEDCMLEVEKPHILPTNVKKIERINTEDVPKHSATIENPDDIVVLKKK 700
            RAQ+F SAL+NLED + E+EKP ++P  +++I+ ++    P HS  I+N DD+VVLKKK
Sbjct: 601 IRAQNFKSALANLEDIIFEIEKPLVVPVKLEEIKTVDPASAPNHSPEIDNLDDLVVLKKK 660

Query: 701 NIHRTQSMNAKDTMGEKAIDYSKIPNVLSSKSDQNRRQQKKRRSDPLFNDSDGPRAAKKK 760
           NI + Q    K    + A+DYSKIPN+LS+K  QN RQQKKRR DP  +DS+GPRAAKK+
Sbjct: 661 NIQKKQPAKEKGVTEKDAVDYSKIPNILSNKPGQNNRQQKKRRFDPSSSDSNGPRAAKKR 720

Query: 761 RPATRGRNVSFKR 773
           RPA +G+N+SFKR
Sbjct: 721 RPAAKGKNLSFKR 733

>Suva_15.176 Chr15 (301216..303453) [2238 bp, 745 aa] {ON} YOR001W
           (REAL)
          Length = 745

 Score = 1158 bits (2996), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 560/749 (74%), Positives = 635/749 (84%), Gaps = 6/749 (0%)

Query: 25  YEERRLNNQKAPTPYVMASQNPDVLLSKVVNVIRAASSLAGQDVDFYKNLDREFGKVLKS 84
           +E++  N+Q     Y MAS+N DVLLSKVVNVIRAASSLA QDVDFY+NLDR+F K+L+S
Sbjct: 3   HEDQTANSQDVSNKYAMASENSDVLLSKVVNVIRAASSLAAQDVDFYRNLDRDFSKILQS 62

Query: 85  KSDKLADMANEIILSIDEHHESFELKDEDISGLWNDFGNIMDNLLEMSDHSLDKLNRAVT 144
           KS KL +M N I+LSIDEHH+S ELK+E+IS LW DFGNIMDNLLE SDHSLD LNR   
Sbjct: 63  KSSKLTEMVNGIVLSIDEHHDSLELKEEEISDLWKDFGNIMDNLLEKSDHSLDNLNRTSN 122

Query: 145 SKPNGADLQYLGDFSEKNLSPAKRVEKPQLKFKTPIDNSESHPFIPLLKEKPNALKPLSD 204
           S  + ADLQYLGDFS K+  P KRVEKPQLKFKTPIDNSESHPFIPLLKEKPNALKPLSD
Sbjct: 123 SNNSAADLQYLGDFSGKDSQPTKRVEKPQLKFKTPIDNSESHPFIPLLKEKPNALKPLSD 182

Query: 205 SLRLIEEDDNTPSHYPHPYEYEIDHQEYGSNILQIRKEIPSKSWNDSEPIWIDTMPKLES 264
           SLR+IE ++N+P HYPHPYEYEIDHQEY  NILQI+ EIPSK W+ SEPIWI++   L+S
Sbjct: 183 SLRMIETEENSPGHYPHPYEYEIDHQEYNPNILQIKPEIPSKPWDASEPIWINSKATLKS 242

Query: 265 MLEELKNVQEIAVDLEHHDYRSYYGIVCLMQISTREKDYLVDTLELRETLHILNEVFTDP 324
           MLE+LKN  EIAVDLEHHDYRSYYG+VCLMQ+STRE+DYLVDTLELRE LHILNEVFT+P
Sbjct: 243 MLEDLKNAHEIAVDLEHHDYRSYYGVVCLMQVSTRERDYLVDTLELREDLHILNEVFTNP 302

Query: 325 SIVKVFHGAFMDIIWLQRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKY 384
           SIVKVFHGAFMDIIWLQRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKY
Sbjct: 303 SIVKVFHGAFMDIIWLQRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKY 362

Query: 385 QLADWRIRPLSKPMIAYARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYS 444
           QLADWRIRPLSKPM AYARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYS
Sbjct: 363 QLADWRIRPLSKPMTAYARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYS 422

Query: 445 KYRPRIPSSEVYSPIEKEAPWRVLMYQYNITSEKEELVKDLYQWRDVIARRDDESPRFVM 504
           KYRP  PSS+VYSP EKE PWRVLMYQYNI  E+EELVKDLY+WRDVIARRDDESPRF+M
Sbjct: 423 KYRPITPSSKVYSPTEKENPWRVLMYQYNIAPEREELVKDLYEWRDVIARRDDESPRFIM 482

Query: 505 PNQLLAALVAYTPIDVIGVISLTNGITEHVRQNAKVLVNLIKNSLRHIKDTYKEDSPVTF 564
           PNQLLAALVAYTPIDVIGV+SL+NG+T+HVRQNAK+L NLIK++LR +KDT+KE + +  
Sbjct: 483 PNQLLAALVAYTPIDVIGVVSLSNGVTDHVRQNAKILANLIKSALRSMKDTHKESAEIVS 542

Query: 565 SESMTNEVSLEAITIPQIRDIMERFSVLSNSNVSNCRAKNGATPSILLGRILPLEENDIA 624
           S+  +   SLEAIT+ QIRDIM+RFSV S+++V+  R+ +    SIL G+ILP EE DI 
Sbjct: 543 SKFKS--ASLEAITVSQIRDIMDRFSVFSSNSVTEDRSMDSTASSILFGKILPYEEGDIV 600

Query: 625 YKNNGLPNRVKFEDIRARAQSFNSALSNLEDCMLEVEKPHILPTNVKKIERINTEDVPKH 684
           Y+++GLP++VK ED+R RAQ FNSAL  LED   EVEK    P NV+K E +  E  P+ 
Sbjct: 601 YEDSGLPHKVKVEDMRDRAQRFNSALVGLEDIKFEVEK----PVNVEKSEMVKIETTPEP 656

Query: 685 SATIENPDDIVVLKKKNIHRTQSMNAKDTMGEKAIDYSKIPNVLSSKSDQNRRQQKKRRS 744
              IE+PD++VVLKKK IH+ Q     D   E+A+DYSKIPNVLSSK  QN +QQ+KRR 
Sbjct: 657 PTKIEDPDEVVVLKKKRIHKKQVAKRSDVAAEEAVDYSKIPNVLSSKPGQNNKQQRKRRF 716

Query: 745 DPLFNDSDGPRAAKKKRPATRGRNVSFKR 773
           DP FNDS+GPRA KKKRP TRG+NVSFKR
Sbjct: 717 DPSFNDSEGPRAPKKKRPTTRGKNVSFKR 745

>Skud_15.162 Chr15 (286822..289026) [2205 bp, 734 aa] {ON} YOR001W
           (REAL)
          Length = 734

 Score = 1157 bits (2993), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 569/734 (77%), Positives = 632/734 (86%), Gaps = 1/734 (0%)

Query: 41  MASQNPDVLLSKVVNVIRAASSLAGQDVDFYKNLDREFGKVLKSKSDKLADMANEIILSI 100
           M S+NPDVL SK+V V+RAASSLA QDVDFYKNL+REF  VLKSKSDKL DM NEIILSI
Sbjct: 1   MPSENPDVLFSKIVKVVRAASSLASQDVDFYKNLEREFSNVLKSKSDKLTDMVNEIILSI 60

Query: 101 DEHHESFELKDEDISGLWNDFGNIMDNLLEMSDHSLDKLNRAVTSKPNGADLQYLGDFSE 160
           DEHHESFELK+++ISGLW DFGNIMDNLLEMSDHSLDKLN    SK +GA+LQYLGDFS 
Sbjct: 61  DEHHESFELKEDEISGLWKDFGNIMDNLLEMSDHSLDKLNHTANSKVSGAELQYLGDFSG 120

Query: 161 KNLSPAKRVEKPQLKFKTPIDNSESHPFIPLLKEKPNALKPLSDSLRLIEEDDNTPSHYP 220
           K+    KR+EKPQLKFK  IDNSESHPFIPLLKEKPNALKPLS+SLRL E ++N PSHY 
Sbjct: 121 KDSLSTKRLEKPQLKFKKSIDNSESHPFIPLLKEKPNALKPLSESLRLAEAEENNPSHYL 180

Query: 221 HPYEYEIDHQEYGSNILQIRKEIPSKSWNDSEPIWIDTMPKLESMLEELKNVQEIAVDLE 280
           HPY YEIDHQEY S++LQI+KEIPSKSW+DSEPIWIDT  KL  MLE+LKN  EIAVDLE
Sbjct: 181 HPYAYEIDHQEYSSDVLQIKKEIPSKSWDDSEPIWIDTKTKLGLMLEDLKNASEIAVDLE 240

Query: 281 HHDYRSYYGIVCLMQISTREKDYLVDTLELRETLHILNEVFTDPSIVKVFHGAFMDIIWL 340
           HHDYRSYYGIVCLMQ+STRE+DYLVDT+ELR+ LHILNEVFTDP IVKVFHGAFMDIIWL
Sbjct: 241 HHDYRSYYGIVCLMQVSTRERDYLVDTIELRDALHILNEVFTDPLIVKVFHGAFMDIIWL 300

Query: 341 QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMIA 400
           QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWR RPLSKPM A
Sbjct: 301 QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRARPLSKPMTA 360

Query: 401 YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPRIPSSEVYSPIE 460
           YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSK+RPR PSSEVYSPIE
Sbjct: 361 YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKHRPRTPSSEVYSPIE 420

Query: 461 KEAPWRVLMYQYNITSEKEELVKDLYQWRDVIARRDDESPRFVMPNQLLAALVAYTPIDV 520
           KE PWRVLMYQYNITSEKEELVKDLY WRD IARRDDESPRFVMPNQLLAALVAY PIDV
Sbjct: 421 KENPWRVLMYQYNITSEKEELVKDLYLWRDFIARRDDESPRFVMPNQLLAALVAYAPIDV 480

Query: 521 IGVISLTNGITEHVRQNAKVLVNLIKNSLRHIKDTYKEDSPVTFSESMTNEVSLEAITIP 580
           IGV+SLTNG+TEHVRQNAKVL NLI+N+L +IKDT K+ + +T SES  + +SLE ITI 
Sbjct: 481 IGVVSLTNGVTEHVRQNAKVLANLIENALGNIKDTNKKTTSITSSESKPDGISLEVITIS 540

Query: 581 QIRDIMERFSVLSNSNVSNCRAKNG-ATPSILLGRILPLEENDIAYKNNGLPNRVKFEDI 639
           QIRDIMERFS+LSNS V N R K G +T SILLG+ LP EE  I+Y   G PN+VK EDI
Sbjct: 541 QIRDIMERFSLLSNSGVINNRTKTGDSTSSILLGKTLPFEECGISYGKKGTPNKVKVEDI 600

Query: 640 RARAQSFNSALSNLEDCMLEVEKPHILPTNVKKIERINTEDVPKHSATIENPDDIVVLKK 699
           +ARAQ FNSAL+ LE+ M E+EKP  +P +V+K E +  E  P+  +  E+ DDI+VLKK
Sbjct: 601 KARAQKFNSALAGLENIMFELEKPVTVPASVEKGEAVEIESAPELPSKAESFDDIIVLKK 660

Query: 700 KNIHRTQSMNAKDTMGEKAIDYSKIPNVLSSKSDQNRRQQKKRRSDPLFNDSDGPRAAKK 759
           K +H+ Q    KD   ++A+DYSK+P+VLSSK  QNR+QQ+KRR DP  NDS+GPRAAKK
Sbjct: 661 KKMHKKQPAKGKDMTVKEAVDYSKMPSVLSSKPGQNRKQQRKRRFDPSSNDSEGPRAAKK 720

Query: 760 KRPATRGRNVSFKR 773
           KRPA RG+N+SFKR
Sbjct: 721 KRPAPRGKNMSFKR 734

>NCAS0H00860 Chr8 complement(156180..158447) [2268 bp, 755 aa] {ON}
           Anc_6.25 YOR001W
          Length = 755

 Score =  771 bits (1991), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/751 (53%), Positives = 527/751 (70%), Gaps = 31/751 (4%)

Query: 48  VLLSKVVNVIRAASSLAGQDVDFYKNLDREFGKVLKSKSDKLADMANEIILSIDEHHESF 107
            LL KVVN +RAAS+LA QDVDFY+++D++    L+  S+++ADM N ++LSIDE+ E  
Sbjct: 11  TLLPKVVNTVRAASALAAQDVDFYRSIDKDIAHSLEQSSNQIADMINSVLLSIDENSEQV 70

Query: 108 ELKDEDISGLWNDFGNIMDNLLEMSDHSLDKLNRAVTSKPNGADLQYLGDFSEKNLSPAK 167
           +   E++  +W DFGN+MDNL E SD S+D + R        + +QY+ +FS ++L+P K
Sbjct: 71  DGTKENLEDIWKDFGNLMDNLFEKSDRSIDIITRGHGGSNGQSGMQYIDEFSGRDLTPGK 130

Query: 168 RVEKPQLKFKTPIDNSESHPFIPLLKEKPNALKPLSDSLRLIEEDDNTPSHYPHPYEYEI 227
           ++ KPQLKF TPIDN+ESHPFIPLLKEKP ALKPL +S+++I ED+ +P HYP PYEYEI
Sbjct: 131 QILKPQLKFTTPIDNTESHPFIPLLKEKPFALKPLEESMQMIPEDETSPMHYPQPYEYEI 190

Query: 228 DHQEYGSNILQIRKEIPSKSWNDSEPIWIDTMPKLESMLEELKNVQEIAVDLEHHDYRSY 287
           DHQEY   ILQ +  IPS SW D+EPIW+DT+ +L+S++ +L+   EIAVDLEHHDYR+Y
Sbjct: 191 DHQEYNDLILQKKDPIPSTSWTDNEPIWVDTVSQLQSIMPDLEASTEIAVDLEHHDYRTY 250

Query: 288 YGIVCLMQISTREKDYLVDTLELRETLHILNEVFTDPSIVKVFHGAFMDIIWLQRDLGLY 347
           YGI CLMQISTR+ DYL+DTL LRE L ILN VF +P I KVFHGAFMDIIWLQRDLGLY
Sbjct: 251 YGITCLMQISTRKNDYLIDTLALREDLQILNNVFANPMITKVFHGAFMDIIWLQRDLGLY 310

Query: 348 VVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMIAYARADTH 407
           VVGLFDT+HAS+A+GLP+HSLAYLLE FA FKTSKKYQLADWRIRPLSK M AYARADTH
Sbjct: 311 VVGLFDTFHASRAMGLPKHSLAYLLEKFAQFKTSKKYQLADWRIRPLSKAMHAYARADTH 370

Query: 408 FLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPRIPSSE--VYSPIEKEAPW 465
           FLLNI+DQ+RN LIE NKLAGVL ESRNVAKRRFEYS +RP++  +   VYSPIEK+ PW
Sbjct: 371 FLLNIFDQMRNSLIEQNKLAGVLKESRNVAKRRFEYSSFRPKVLQTNGLVYSPIEKDDPW 430

Query: 466 RVLMYQYNITSEKEELVKDLYQWRDVIARRDDESPRFVMPNQLLAALVAYTPIDVIGVIS 525
           + +M+QYNI  +KE L+K+LYQWRD IARRDDESPRFVMPNQLL +LVAYTPID  GV+S
Sbjct: 431 KTIMFQYNIPPQKEPLLKELYQWRDKIARRDDESPRFVMPNQLLVSLVAYTPIDAPGVVS 490

Query: 526 LTNGITEHVRQNAKVLVNLIKNSLRHIKDTYKEDSPVTFSESM-----TNEVSLEAITIP 580
           ++N +T++VR N+K+L NLIKN L  +KD    D+ V   E +     T     + +TI 
Sbjct: 491 VSNSVTDYVRSNSKILANLIKNCLAKMKDNKFLDNNVA-EEGISVVPETGHDLSQKLTIH 549

Query: 581 QIRDIMERFSVLSN--SNVSNCRAKNGATPSILLGRILPLEENDIAYKNNGLPNRVKFED 638
           Q++++  +F +LS+  +N    R  N     +  G I   ++  I Y  +G   +   E 
Sbjct: 550 QLQNLKSKFQLLSDKFNNSVKTRLSNHDQLYLFDG-ISFADDVTIKYFADG-KIQTTAEQ 607

Query: 639 IRARAQSFNSALSNLED---CM--LEVEKPHILPTNVKKIERINTEDVPKHSATIENP-- 691
            + R++ F+ A+  LE+   C+  +E  K      N+  I  + T    + +  IE P  
Sbjct: 608 YKERSEQFDDAMKQLEEVEYCIPVIEENKQTQDQDNIPPI-TVATNAEGQVNEMIEKPED 666

Query: 692 -DDIVVLKKKNIHRTQSMNAKDTMGEKA----IDYSKIPNVLS----SKSDQNRRQQKKR 742
            D+++VL+K N  + +S+  K    E+     IDY K   VL+    S+  +N    K++
Sbjct: 667 LDEVIVLRKTN--KNKSIKNKPKNREEPELEIIDYFKTAKVLTNDKNSRGGRNNNGNKRK 724

Query: 743 RSDPLFNDSDGPRAAKKKRPATRGRNVSFKR 773
           R DP    ++GP A KK++  TRG+NVSFKR
Sbjct: 725 RFDPYSAANEGPAAPKKRKNVTRGKNVSFKR 755

>KAFR0G02660 Chr7 (549718..551925) [2208 bp, 735 aa] {ON} Anc_6.25
           YOR001W
          Length = 735

 Score =  770 bits (1988), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/737 (53%), Positives = 513/737 (69%), Gaps = 23/737 (3%)

Query: 49  LLSKVVNVIRAASSLAGQDVDFYKNLDREFGKVLKSKSDKLADMANEIILSIDEHHESFE 108
           LLS VVN +RA+S+LA QDVDFY++LD E    +   +D+L DM N IILSIDE++E+ +
Sbjct: 9   LLSDVVNTVRASSTLAAQDVDFYRSLDSEVSHSINEVTDELNDMVNSIILSIDENYETLD 68

Query: 109 LKDEDISGLWNDFGNIMDNLLEMSDHSLDKLNRAVTSKPNGADLQYLGDFSEKNLSPAKR 168
              E+++  W    NI+DNL E SD SLD L      KP     +Y  + +     P KR
Sbjct: 69  EGKEELTESWKSLSNIVDNLFEKSDRSLDILKTGAKKKPTNPPFEYFENATTTENIPQKR 128

Query: 169 VEKPQLKFKTPIDNSESHPFIPLLKEKPNALKPLSDSLRLIEEDDNTPSHYPHPYEYEID 228
           + KPQLKF  PIDNSESHPFIPLLKEKPNALK + +S +LI  D+N P HY HPYEYEID
Sbjct: 129 INKPQLKFVPPIDNSESHPFIPLLKEKPNALKTIDESTKLINSDENVPEHYAHPYEYEID 188

Query: 229 HQEYGSNILQIRKEIPSKSWNDSEPIWIDTMPKLESMLEELKNVQEIAVDLEHHDYRSYY 288
           +Q Y  +ILQ+R+ IPSKSW+++E +W+D +  L  ML ++K   EIA+DLEHHDYR+YY
Sbjct: 189 NQPYNDSILQVREPIPSKSWSETEGVWVDNVESLNHMLNDIKKYTEIAIDLEHHDYRTYY 248

Query: 289 GIVCLMQISTREKDYLVDTLELRETLHILNEVFTDPSIVKVFHGAFMDIIWLQRDLGLYV 348
           GIVCLMQISTRE DYLVDT+ LR  L +LNEVFTDPS+VKV HGAFMDIIWLQRDLGLY+
Sbjct: 249 GIVCLMQISTRETDYLVDTIALRNDLKVLNEVFTDPSVVKVLHGAFMDIIWLQRDLGLYI 308

Query: 349 VGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMIAYARADTHF 408
           V LFDT+HAS+A+G PRHSLAYLLE FANFKTSKKYQLADWR+RPLSK M AYARADTHF
Sbjct: 309 VSLFDTFHASRALGFPRHSLAYLLEEFANFKTSKKYQLADWRVRPLSKAMTAYARADTHF 368

Query: 409 LLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPRIPSSEVYSPIEKEAPWRVL 468
           LLNIYDQLRN+L+E+NKL GVL ESRNVAKRRFEYSK+RPR+PS  VYS +EKE PWR L
Sbjct: 369 LLNIYDQLRNRLVETNKLVGVLNESRNVAKRRFEYSKFRPRVPSPNVYSALEKEDPWRTL 428

Query: 469 MYQYNITSEKEELVKDLYQWRDVIARRDDESPRFVMPNQLLAALVAYTPIDVIGVISLTN 528
           M+QYNI SE+E+L+K L++WRD+IARRDDESPR++MPNQL+  LVAYTP D  GVIS + 
Sbjct: 429 MFQYNIPSEREDLLKGLFEWRDMIARRDDESPRYIMPNQLMVTLVAYTPTDPAGVISASQ 488

Query: 529 GITEHVRQNAKVLVNLIKNSLRHIKDTYKEDSPVTFSESMTNEVSLEAITIPQIRDIMER 588
            +T++VR N+K++ NLIKN+L   KD  ++   V  + +  +  S + +T+ QI++    
Sbjct: 489 VVTDYVRSNSKIIANLIKNALTRAKDQNRQLQFVADNHTRESYRSTDKMTVSQIKETASV 548

Query: 589 F----SVLSNSNVSNCRAKNGATPSIL--LGRILPLEENDIAYKNNGLPNRVKFEDIRAR 642
           F      L   N    ++K+ A  +    L + L +    I YK NG  + VK + + +R
Sbjct: 549 FIQIAEKLGTCNNDQQQSKSFARSNYFGSLSKKLDI----IEYK-NGEKHSVKQQQLVSR 603

Query: 643 AQSFNSALSNLEDCMLEV----EKPHILPTNVKKIER-INTEDVPKHSATIENPDDIVVL 697
             ++   ++ L +   E+    E P +   +V+++++ I  + +P       + D++VVL
Sbjct: 604 FNTYTKQVNELTNVRYELPVHKEPPQLQKDDVEEVKKTIIADSIPAKPEI--DLDEVVVL 661

Query: 698 KKKNIHRTQSMNAKDTMGEKA--IDYSKIPNVLSSKSDQNRRQQKKRRSDPLFNDSDGPR 755
           KK N    Q    K    EK   IDYSK   +L     + +R+ KKR+ DP    ++GP+
Sbjct: 662 KKVN---RQPNKTKLEENEKIDFIDYSKSEKILKGDKQRKKRESKKRQFDPFAASNEGPK 718

Query: 756 AAKKKRPATRGRNVSFK 772
           AA+K++  TRGRN+S+K
Sbjct: 719 AARKRKSGTRGRNLSYK 735

>SAKL0E01452g Chr5 (108911..111124) [2214 bp, 737 aa] {ON} similar
           to uniprot|Q12149 Saccharomyces cerevisiae YOR001W RRP6
           Exonuclease component of the nuclear exosome contributes
           to the quality-control system that retains and degrades
           aberrant mRNAs in the nucleus
          Length = 737

 Score =  758 bits (1957), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/744 (52%), Positives = 529/744 (71%), Gaps = 20/744 (2%)

Query: 41  MASQNPDVLLSKVVNVIRAASSLAGQDVDFYKNLDREFGKVLKSKSDKLADMANEIILSI 100
           M+S  PD LLS +V  +RAAS+L+ QD+DF+K+LD    K ++  S KL ++ NE++LSI
Sbjct: 1   MSSDKPDKLLSNLVGTVRAASALSAQDLDFFKSLDSGISKSVEGSSSKLLNLINEVLLSI 60

Query: 101 DEHHESFELKDEDISGLWNDFGNIMDNLLEMSDHSLDKLNRAVTSKPNGADLQYLGDFSE 160
           DE++++ E   ++    W D G+IMDNL E SDH+ D L R   ++ N +++QYL D S 
Sbjct: 61  DENNDTIEYGKDNFQESWKDIGDIMDNLFEKSDHAFDALKRNSINQGN-SNVQYLDDSSR 119

Query: 161 KNLSPAKRVEKPQLKFKTPIDNSESHPFIPLLKEKPNALKPLSDSLRLIEEDDNTPSHYP 220
            NL+P+KR+EKPQL FKTPIDN+ESHPF PLL+ KP+AL+PLS+ L+   E +N PSHYP
Sbjct: 120 SNLNPSKRIEKPQLNFKTPIDNTESHPFKPLLENKPHALRPLSEILKQTPETENIPSHYP 179

Query: 221 HPYEYEIDHQEYGSNILQIRKEIPSKSWNDSEPIWIDTMPKLESMLEELKNVQEIAVDLE 280
           HPY YEID QEY  +ILQIR  IPS+ W D++P+W+DT   L+ +L EL++ +EIAVDLE
Sbjct: 180 HPYGYEIDTQEYNESILQIRDPIPSQPWEDTDPVWVDTKESLQKLLNELRSAKEIAVDLE 239

Query: 281 HHDYRSYYGIVCLMQISTREKDYLVDTLELRETLHILNEVFTDPSIVKVFHGAFMDIIWL 340
           HHDYRSYYGIVCLMQISTRE+D+LVDT+ LRE LH+LNE+FTDPS++KVFHGAFMDIIWL
Sbjct: 240 HHDYRSYYGIVCLMQISTRERDWLVDTIALREELHVLNEIFTDPSVLKVFHGAFMDIIWL 299

Query: 341 QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMIA 400
           QRDLG+YVV LFDTYHAS+++GLPRHSLAYLLE FA FKTSKKYQLADWRIRPL+KPM A
Sbjct: 300 QRDLGIYVVSLFDTYHASRSLGLPRHSLAYLLEKFAQFKTSKKYQLADWRIRPLTKPMRA 359

Query: 401 YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPRIPSSEVYSPIE 460
           YARADTHFLLNIYDQLRN LIE NKLA VL++SRNVAKRRFEY+ +RP+I S++V+SPIE
Sbjct: 360 YARADTHFLLNIYDQLRNSLIEQNKLAAVLHDSRNVAKRRFEYTSFRPKIVSADVFSPIE 419

Query: 461 KEAPWRVLMYQYNITSEKEELVKDLYQWRDVIARRDDESPRFVMPNQLLAALVAYTPIDV 520
           K+ PWR LMYQYNI   +E L++ LY+WRD IARRDDESPR+VMPNQLL +LVA  P D 
Sbjct: 420 KDEPWRNLMYQYNIPLSREPLMRKLYEWRDTIARRDDESPRYVMPNQLLVSLVAIAPTDP 479

Query: 521 IGVISLTNGITEHVRQNAKVLVNLIKNSLRHIKDTYKEDSPVTFSESMTNEVSLEAITIP 580
            GV+S++N IT++VR N+K+L NLIK +L  +K+     +    S+    ++S + ++I 
Sbjct: 480 AGVLSVSNFITDYVRSNSKMLSNLIKKTLESLKNGDVSTNNAGSSQLEEKDLS-QVLSIS 538

Query: 581 QIRDIMERFSVLSNSNVSNCRAKNGATPSILLGRILPLEENDIAYKNNGLPNRVKFEDIR 640
           QI+++  +F    NS  S  +  N AT S  + ++  L + D  + N+      K   I 
Sbjct: 539 QIQNMCLQF----NSLASKVKKANSATNS--MPKVSILFDGDHIFSNDRAVLYSKNSKIV 592

Query: 641 ARAQSFNSALSNLEDCMLEVEKPHI-LPTNV--KKIERIN-----TEDVPKHSAT--IE- 689
                       + + + EV++P   L  NV  K+ + ++      +DV + S T  +E 
Sbjct: 593 IDENQLQERKLEVSEKLKEVQEPDFRLHVNVTTKETDEVSKDVSEKDDVNRASETDPLET 652

Query: 690 NPDDIVVLKKKNIHRTQS-MNAKDTMGEKAIDYSKIPNVLSSKSDQNRRQQKKRRSDPLF 748
           N D+I+VLKKK  H  Q      ++   + +DY     +L +    ++++  KRR DP  
Sbjct: 653 NKDEIIVLKKKKRHEPQDRKKVGNSTDVEPMDYKNAEKLLGNSKKSSKQKTTKRRFDPYT 712

Query: 749 NDSDGPRAAKKKRPATRGRNVSFK 772
           +++ GP++AKK++  T G+N+SFK
Sbjct: 713 SENVGPQSAKKRKKPTPGKNMSFK 736

>Kpol_1037.29 s1037 complement(68981..71221) [2241 bp, 746 aa] {ON}
           complement(68981..71221) [2241 nt, 747 aa]
          Length = 746

 Score =  751 bits (1938), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/746 (52%), Positives = 518/746 (69%), Gaps = 29/746 (3%)

Query: 49  LLSKVVNVIRAASSLAGQDVDFYKNLDREFGKVLKSKSDKLADMANEIILSIDEHHESFE 108
           LLS VV+ +RAASSLA QDVDFY+NLD+E    L   S ++ +M N ++LSI+E++E  E
Sbjct: 9   LLSSVVSTVRAASSLAAQDVDFYRNLDKEISTSLNESSKEITNMINTLLLSINENNEELE 68

Query: 109 LKDEDISGLWNDFGNIMDNLLEMSDHSLDKLNRAVTSKPNGADLQYLGDFSEKNLSPAKR 168
              E +   W DF N+MDNL E SD SLD + R+ TS  N ++ QYL D ++ + +P+KR
Sbjct: 69  SGKEGLEQYWKDFSNVMDNLFEKSDRSLDIITRSKTSNDNKSEFQYLSDSAQSDSNPSKR 128

Query: 169 VEKPQLKFKTPIDNSESHPFIPLLKEKPNALKPLSDSLRLIEEDDNTPSHYPHPYEYEID 228
           V KPQL+F  P+DNSES PF+PLL +KP+++K  +DSL +I E +  PSHY HPYE EID
Sbjct: 129 VTKPQLQFSRPVDNSESKPFMPLLNDKPHSIKSFTDSLIIIPESEELPSHYAHPYEVEID 188

Query: 229 HQEYGSNILQIRKEIPSKSWNDSEPIWIDTMPKLESMLEELKNVQEIAVDLEHHDYRSYY 288
            QEY +++LQ+ + + S+ WN SE  W+DT   L+SML++LK   EIAVDLEHHDYRSYY
Sbjct: 189 KQEYNASVLQVAEPLKSQPWN-SESTWVDTSEALQSMLDKLKECTEIAVDLEHHDYRSYY 247

Query: 289 GIVCLMQISTREKDYLVDTLELRETLHILNEVFTDPSIVKVFHGAFMDIIWLQRDLGLYV 348
           GIVCLMQISTR++D+LVDTL LR+ LHILNEVF DP+I+KV HGAFMDIIWLQRDLGLYV
Sbjct: 248 GIVCLMQISTRKEDFLVDTLALRDELHILNEVFADPNILKVLHGAFMDIIWLQRDLGLYV 307

Query: 349 VGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMIAYARADTHF 408
           V LFDTYHAS+A+G PRHSLAYLLE +ANFKTSKKYQLADWR+RPLSKPM AYARADTHF
Sbjct: 308 VSLFDTYHASRALGFPRHSLAYLLEKYANFKTSKKYQLADWRVRPLSKPMHAYARADTHF 367

Query: 409 LLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPRIPSSEVYSPIEKEAPWRVL 468
           LLNIYDQ+RN+LI  NKLA VL+ESRNVAKRRFEYS++RP++PS  V++PIEKE PWR L
Sbjct: 368 LLNIYDQIRNQLIRENKLAEVLFESRNVAKRRFEYSRFRPKVPSPAVFTPIEKEEPWRTL 427

Query: 469 MYQYNITSEKEELVKDLYQWRDVIARRDDESPRFVMPNQLLAALVAYTPIDVIGVISLTN 528
           +YQYN+ S K EL+K +++WRD+IARRDDESPR++MPNQL+ +LV YTPID  GVIS++N
Sbjct: 428 VYQYNVPSTKIELLKRIWEWRDMIARRDDESPRYIMPNQLMISLVEYTPIDPAGVISVSN 487

Query: 529 GITEHVRQNAKVLVNLIKNSLRHIKDTYKEDSPVTFSE---SMTNEVSLEAITIPQIRDI 585
            +T+HVR N+KV+ NLIK SL  +K +    +   F      +  + + + +TI QI+++
Sbjct: 488 VMTDHVRSNSKVIANLIKKSLEDMK-SVPAGALTAFQNIDYKIGQKFASDKLTISQIQNM 546

Query: 586 MERF-SVLSNSNVSNCRAKNGATPSILLGRILPLEENDIAYKNNGLPNRVKFEDIRARAQ 644
              F  + SN ++          P IL   I  L +N+I   ++   + V  E +  RA+
Sbjct: 547 TALFKEIASNPSIIEKDVSKKIDP-ILFSNIF-LSKNEIVLYDHDKRHVVTNEQLAGRAE 604

Query: 645 SF--------NSALS-NLEDCM-LEVEKPHILPTNVKKIERINTEDVPKHSAT--IENPD 692
                     N+ L+ N+E    + VE+P     N      I+  +    S T   E+ +
Sbjct: 605 EVEGFMNEANNTTLAINIESSAEMHVEEPEAKEKNALFSPPISNVENASSSNTDGFEDMN 664

Query: 693 DIVVLKKKNIHRTQSMNAKDTMG---EKAIDYSKIPNVLSSKSDQNRRQQKKRRSDPLF- 748
           DI+VLK     RT   + K   G   ++ IDYSK+  +LS    + R   KKR+ DP   
Sbjct: 665 DIIVLKDVK-KRTNIKDHKKKQGMPNKEVIDYSKLDTILSK---EKRENSKKRKGDPFGE 720

Query: 749 -NDSDGPRAAKKKRPATRGRNVSFKR 773
            N  +GP+AAKK++   RG+NVSFKR
Sbjct: 721 ENGLEGPKAAKKRKQINRGKNVSFKR 746

>KNAG0M01230 Chr13 complement(223471..225687) [2217 bp, 738 aa] {ON}
           Anc_6.25 YOR001W
          Length = 738

 Score =  732 bits (1889), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/746 (50%), Positives = 506/746 (67%), Gaps = 21/746 (2%)

Query: 41  MASQNPDVLLSKVVNVIRAASSLAGQDVDFYKNLDREFGKVLKSKSDKLADMANEIILSI 100
           M S+    LLSK V  +RA+SSL GQDV F+ NLD      +K   +++ +M N+I+ SI
Sbjct: 1   MDSEEQKKLLSKAVGTVRASSSLVGQDVQFFSNLDANVASSVKELGNEVLEMINDILFSI 60

Query: 101 DEHHESFELKDEDISGLWNDFGNIMDNLLEMSDHSLDKLNRAVTSKPN-GADLQYLGDFS 159
           DE+ + F    E +   W DF N+ DNL E SD S+D + +        G+++QYL D  
Sbjct: 61  DENSKPFAESAEQVGESWRDFTNLTDNLFEKSDRSMDIIAQGTRKNGQAGSEVQYLDDLV 120

Query: 160 EKNLSPAKRVEKPQLKFKTPIDNSESHPFIPLLKEKPNALKPLSDSLRLIEEDDNTPSHY 219
             + S  KR+ KPQL F  P+DNSES PF PLL EKPNALKPL +SL+++   +N PSHY
Sbjct: 121 GNDSSSGKRITKPQLHFSRPVDNSESQPFKPLLTEKPNALKPLKESLQMVPATENIPSHY 180

Query: 220 PHPYEYEIDHQEYGSNILQIRKEIPSKSWNDSEPIWIDTMPKLESMLEELKNVQEIAVDL 279
           P+PY+YEI +QEY ++IL+ R  IPS  W++SEP+W+D+   L+S+L++LK  +E+A+DL
Sbjct: 181 PNPYDYEISNQEYNNDILETRAPIPSTPWHESEPVWVDSTEGLQSLLKDLKKYKELAIDL 240

Query: 280 EHHDYRSYYGIVCLMQISTREKDYLVDTLELRETLHILNEVFTDPSIVKVFHGAFMDIIW 339
           EHHDYRSYYGIVCLMQISTR+ DYLVDT+ LR+ LHILN+VFTDP + KVFHGAFMDIIW
Sbjct: 241 EHHDYRSYYGIVCLMQISTRDTDYLVDTIALRDELHILNQVFTDPMVTKVFHGAFMDIIW 300

Query: 340 LQRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMI 399
           LQRDLGLY+V LFDT+HASKA+G P+HSLAYLLE  ANFKTSKKYQLADWRIRPLSKPM 
Sbjct: 301 LQRDLGLYIVSLFDTFHASKALGFPKHSLAYLLETLANFKTSKKYQLADWRIRPLSKPMS 360

Query: 400 AYARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPRIPSSEVYSPI 459
            YARADTHFLLNI+DQ+RN+LI+ NKLAGVL ESR VAKRRFEYSK+RP++   +V++PI
Sbjct: 361 VYARADTHFLLNIFDQMRNQLIKDNKLAGVLGESRKVAKRRFEYSKFRPKLAQPDVFTPI 420

Query: 460 EKEAPWRVLMYQYNITSEKEELVKDLYQWRDVIARRDDESPRFVMPNQLLAALVAYTPID 519
           EKE+PWR LM+QYN+T EKEELVK LY+WRD IARRDDESPR++MPNQLL +L AYTP D
Sbjct: 421 EKESPWRTLMFQYNVTPEKEELVKALYEWRDTIARRDDESPRYIMPNQLLISLSAYTPTD 480

Query: 520 VIGVISLTNGITEHVRQNAKVLVNLIKNSLRHIKDTYKEDSPVTFSESMTNEVSLEAITI 579
            + ++S+ + +T+ VR N+KVL NLIK+ +    ++ K     +++ +  N  +   +T+
Sbjct: 481 PVSLVSVNSYVTDCVRSNSKVLANLIKSFV----ESSKLGPQSSYTPNTENTSTPFVLTL 536

Query: 580 PQIRDIMERFSVLS-NSNVSNCRAKNGATPSILLGRILPLEENDIAYKNNGLPNRVKFED 638
            QI+DI  RF+ L+ N   S+C+  +    S   G  L   +  ++Y N+     V    
Sbjct: 537 SQIKDIGMRFTKLTENFQSSSCQKISPLQRSSFFGD-LSKGKVTVSY-NDAKTTPVSQSV 594

Query: 639 IRARAQSFNSALSNLEDCMLEVEKPHI--------LPTNVKKIERINTEDVPKHSATI-E 689
           + +R++ FN  +    D  +E + P I        +P+     E  +++ V K    I E
Sbjct: 595 LESRSKQFNEYMKAFGD--IEYKIPSIVEPVMDLPIPSGTTSTESADSKTVEKPPKNIKE 652

Query: 690 NPDDIVVLKKKNIHRTQSMNAKDTMGEKAIDYSKIPNVLSSKS--DQNRRQQKKRRSDPL 747
           + D+IVVLKK      +     +    + +DYSK   VL  +    + +    K+R DP 
Sbjct: 653 DMDEIVVLKKVKRELPKPKGNDEDAEREIVDYSKEDKVLVQRQFDKKKKNNNNKKRFDPF 712

Query: 748 FNDSDGPRAAKKKRPATRGRNVSFKR 773
              S+GP+A KK++  T+G+N SFKR
Sbjct: 713 SAISEGPKAPKKRKAVTKGKNASFKR 738

>CAGL0E02585g Chr5 (246427..248640) [2214 bp, 737 aa] {ON} similar
           to uniprot|Q12149 Saccharomyces cerevisiae YOR001w RRP6
          Length = 737

 Score =  712 bits (1839), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/750 (49%), Positives = 518/750 (69%), Gaps = 30/750 (4%)

Query: 41  MASQNPDVLLSKVVNVIRAASSLAGQDVDFYKNLDREFGKVLKSKSDKLADMANEIILSI 100
           M+S + D +L KV+  +RA+++LA QDV+F+K++D      L+     +A + N I+LSI
Sbjct: 1   MSSDSGDNVLKKVMETVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSI 60

Query: 101 DEHHESFELKDEDISGLWNDFGNIMDNLLEMSDHSLDKLNRAVTSKPNGADLQYLGDFSE 160
           D ++E  +  +E++  +  +F N+MD L E +D SLD LNR  ++  N  ++Q+L D + 
Sbjct: 61  DNNNEKLDGTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNV 120

Query: 161 KNLSPAKRVEKPQLKFKTPIDNSESHPFIPLLKEKPNALKPLSDSLRLIEEDDNTPSHYP 220
               P++R+ KPQL FKTP+DNSESHPF PLL EKPNALK + +S +L+   ++ P H+ 
Sbjct: 121 AENDPSRRISKPQLNFKTPVDNSESHPFKPLLIEKPNALKSIEESTQLVLATEDIPEHFQ 180

Query: 221 HPYEYEIDHQEYGSNILQIRKEIPSKSWNDSEPIWIDTMPKLESMLEELKNVQEIAVDLE 280
            PYEYEI +QEY ++IL+ ++ IPS SW D+  IW+D +  L+ M++ELK   EIAVDLE
Sbjct: 181 QPYEYEILNQEYNNDILEKKEPIPSTSWVDTNAIWVDNINSLQDMMQELKKSSEIAVDLE 240

Query: 281 HHDYRSYYGIVCLMQISTREKDYLVDTLELRETLHILNEVFTDPSIVKVFHGAFMDIIWL 340
           HHD+RSYYG+VCLMQISTR +DY+VDT+ LR+ L +LNEVFT+P I KVFHGAFMDIIWL
Sbjct: 241 HHDFRSYYGLVCLMQISTRTQDYIVDTIALRDDLKMLNEVFTNPLITKVFHGAFMDIIWL 300

Query: 341 QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMIA 400
           QRDLGLY+V LFDT+HASKA+GLP+HSLAYLLE +ANFKTSKKYQLADWR RPLSK M+A
Sbjct: 301 QRDLGLYIVSLFDTFHASKALGLPKHSLAYLLEKYANFKTSKKYQLADWRRRPLSKAMMA 360

Query: 401 YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPRIPSSEVYSPIE 460
           YARADTHFLLNI+DQ+RN LI S KLAGVL ESRNVA RRFEYSKY+P+IP + +++P+E
Sbjct: 361 YARADTHFLLNIFDQMRNGLISSGKLAGVLRESRNVALRRFEYSKYKPKIPVANIFTPVE 420

Query: 461 KEAPWRVLMYQYNITSEKEELVKDLYQWRDVIARRDDESPRFVMPNQLLAALVAYTPIDV 520
           KE+PWR LMYQYNI  +KE L+++LY+WRD++ARRDDESPR+VMPNQLL +LVAY P+D 
Sbjct: 421 KESPWRTLMYQYNIPVDKEPLIRELYEWRDMMARRDDESPRYVMPNQLLVSLVAYGPVDP 480

Query: 521 IGVISLTNGITEHVRQNAKVLVNLIKNSLRHIKDTYKEDSPVTFSESM-TNEVSLEAITI 579
           I V+S+++ +T+HVR+N+K L NLIK  L  IK    +        S+  ++  L+ +  
Sbjct: 481 ISVVSVSSVVTDHVRRNSKTLANLIKKKLEEIKLGEVKSINNRLPSSLDVSQDELQFLPS 540

Query: 580 PQIRDIMERFSVLSNSNVSNCRAKNGATPSILLGRILPLEENDIAYKNNGLPNRVKFEDI 639
            +I  +   F  + N      ++K   T S++L  IL   E+ + Y +NG    V+  ++
Sbjct: 541 HKIELMTGAFKEIENQLTQATKSKQAMTSSVVLSEILLHPEHAVKY-HNGSACSVEESEL 599

Query: 640 RARAQSFNSAL-------------SNLEDCMLEVEKPHILPTNVKKIERINTEDVPKHSA 686
           + R  S+  A              ++  +  LE E+ H      KK ++I    +P+   
Sbjct: 600 KDRYLSYIKATLLAASKNINMVLETSNSNAPLETEETH-----NKKSDQIQV--IPEKQ- 651

Query: 687 TIENPDDIVVLKKKNIHRTQSMNAKDTMG---EKAIDYSKIPNVLSSKSDQNRRQQKKRR 743
             E+ D+IVVLKKK IH +    AK   G   E+ +DYSK  N+L+S + + +++ KKR 
Sbjct: 652 --EDMDEIVVLKKKKIH-SNDQKAKHDDGDIVEEPVDYSK-ANILASDNREVKKKDKKRV 707

Query: 744 SDPLFNDSDGPRAAKKKRPATRGRNVSFKR 773
            DP  +  +GP+AAKK+R  T+G+ +SFK+
Sbjct: 708 FDPYSSTGEGPKAAKKRRLVTKGKKISFKK 737

>TPHA0J00370 Chr10 complement(81371..83602) [2232 bp, 743 aa] {ON}
           Anc_6.25 YOR001W
          Length = 743

 Score =  710 bits (1832), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/750 (48%), Positives = 499/750 (66%), Gaps = 29/750 (3%)

Query: 45  NPDVLLSKVVNVIRAASSLAGQDVDFYKNLDREFGKVLKSKSDKLADMANEIILSIDEHH 104
           N D LL  VV+ +RAAS+LA QDVDFY++LD+E    L + S K+ DM N II S+DE+ 
Sbjct: 2   NADELLPLVVSSVRAASALAAQDVDFYRSLDKEIASSLTNTSQKVTDMINSIISSVDENS 61

Query: 105 ESFELKDEDISGLWNDFGNIMDNLLEMSDHSLDKLNRAVTSKPNGADLQYLGD---FSEK 161
           E      E++   W D GN++D+L E++DHS+D L++A     N   ++YL D   F   
Sbjct: 62  EGLVEGKENLDESWKDIGNLLDSLFELADHSIDALSKASQKSSNDPKMKYLNDSLNFESD 121

Query: 162 NLSPAKRVEKPQLKFKTPIDNSESHPFIPLLKEKPNALKPLSDSLRLIEEDDNTPSHYPH 221
           N++   R+ KPQL F  P+DNSE+HPF PLL +KPNA+ PL + L++++  ++TP HYP 
Sbjct: 122 NVT---RLSKPQLNFSVPVDNSETHPFRPLLTDKPNAVVPLDEVLKIVDGTEDTPQHYPQ 178

Query: 222 PYEYEIDHQEYGSNILQIRKEIPSKSWNDSEPIWIDTMPKLESMLEELKNVQEIAVDLEH 281
           PYE EID QEY   +LQ    IPSK W ++E IW+D    L +ML ELK   E+AVDLEH
Sbjct: 179 PYETEIDKQEYNEQVLQFSDPIPSKVWEETEAIWVDNEESLAAMLNELKTATELAVDLEH 238

Query: 282 HDYRSYYGIVCLMQISTREKDYLVDTLELRETLHILNEVFTDPSIVKVFHGAFMDIIWLQ 341
           HD+RSYYGI CLMQISTR  DYLVDT+ LR+ L +LN VFTDP I K+ HGAFMDIIWLQ
Sbjct: 239 HDFRSYYGITCLMQISTRNTDYLVDTIALRDKLQVLNVVFTDPKITKILHGAFMDIIWLQ 298

Query: 342 RDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMIAY 401
           RDLGLY+V LFDTYHAS+A+G PRHSLAYLLE FA+FKTSK+YQLADWR RPLSK M AY
Sbjct: 299 RDLGLYIVSLFDTYHASRALGFPRHSLAYLLERFAHFKTSKQYQLADWRTRPLSKAMNAY 358

Query: 402 ARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPRIPSSEVYSPIEK 461
           ARADTHFLLNI+DQLRN LI+ +KLA +L+ESR VAKRRFEYSKY+P +PSS V+SP E 
Sbjct: 359 ARADTHFLLNIFDQLRNMLIQEDKLASMLHESRKVAKRRFEYSKYKPTLPSSAVFSPTES 418

Query: 462 EAPWRVLMYQYNITSEKEELVKDLYQWRDVIARRDDESPRFVMPNQLLAALVAYTPIDVI 521
           + PWR ++YQYNI S+K ELVK L++WRD IARRDDESPR++MPNQL+A+LV Y P +  
Sbjct: 419 DMPWRSMIYQYNIPSQKVELVKRLWEWRDTIARRDDESPRYIMPNQLIASLVEYVPTNPA 478

Query: 522 GVISLTNGITEHVRQNAKVLVNLIKNSLRHIKDTYKEDSPVTFS----ESMTNEVSLEAI 577
           GVIS+   +T+ VR NAK + NLIK++L  +K+     + V+ +    E+ +N++S   I
Sbjct: 479 GVISVNRMMTDPVRSNAKAIANLIKSTLEDMKNNNISTTVVSTTAKDKETSSNDLSTSQI 538

Query: 578 --TIPQIRDIMERFSVLSNSNVSNCRAKNGATPSILLGRILPLEENDIAYKNNGLPNRVK 635
              + Q  +I+E++S  +NSN+++  +K G   S++  +I    ++ I Y + G  + + 
Sbjct: 539 KFIVSQFENILEKYSS-NNSNLNDVTSKEGKD-SLVFSKIFNSRDDIITY-DKGTKHLIT 595

Query: 636 FEDIRARAQSFNSALSNLEDCMLEVEKPHILPTNVKKI-----ERINTEDVP--KHSATI 688
            + +  R +  ++A+   E+    +E       ++K+      E I+   +P  +     
Sbjct: 596 EQQLSDRQKEVDAAMKQAEEIAFSMEVQDTHKESMKQPFPEPEEVISQSHLPAFEDKEEQ 655

Query: 689 ENPDDIVVLKKKNIHRTQSMNAKDTMGEK---AIDYSKIPNVLSSKSDQNRRQQKKRRSD 745
           E+ D+I+VLK     R +    +    +     IDYSK   +LS   D  RR   KR+ D
Sbjct: 656 EDLDEIIVLKDTKDRRNRQHRGRGRSADSDHTVIDYSKGDKILS--QDNRRRTPNKRKYD 713

Query: 746 PLF--NDSDGPRAAKKKRPATRGRNVSFKR 773
           P    N+ +  + AK++RP  + RNVSFKR
Sbjct: 714 PFSADNNENALQGAKRRRPTAKNRNVSFKR 743

>NDAI0D00850 Chr4 complement(190801..193173) [2373 bp, 790 aa] {ON}
           Anc_6.25 YOR001W
          Length = 790

 Score =  709 bits (1831), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/773 (50%), Positives = 522/773 (67%), Gaps = 47/773 (6%)

Query: 44  QNP-DVLLSKVVNVIRAASSLAGQDVDFYKNLDREFGKVLKSKSDKLADMANEIILSIDE 102
           Q+P D LL +VV  +RA+ +LA QDVDFY+++D+   K LK  + +LADM N ++L++DE
Sbjct: 22  QSPKDQLLPQVVQTVRASVALAAQDVDFYRSMDKTTAKTLKETTSQLADMINSVLLAVDE 81

Query: 103 HHESFELKDEDISGLWNDFGNIMDNLLEMSDHSLDKLNRAVTSKPNGADLQYLGDFSEKN 162
           + E+ +   E++   W DF N+MDNLLE SD S+D L R+  +  N +++QYL ++S ++
Sbjct: 82  NSETLDGTKENLEDNWKDFSNLMDNLLEKSDRSMDMLLRSKNTNTNNSNMQYLDEYSGRD 141

Query: 163 LSPAKR--VEKPQLKFKTPIDNSESHPFIPLLKEKPNALKPLSDSLRLIEEDDNTPSHYP 220
            + +KR  + KPQL+F  P+DN+E+HPFIPLLK KPNALK L +S++L+  D+N P HY 
Sbjct: 142 DTSSKRRAIGKPQLEFDVPVDNTETHPFIPLLKSKPNALKSLDESIQLLPVDENVPEHYA 201

Query: 221 HPYEYEIDHQEYGSNILQIRKEIPSKSWNDSEPIWIDTMPKLESMLEELKNVQEIAVDLE 280
            PYEYEID+Q Y   ILQ+   IPS+ W ++  IW+DT   L+SM+++L N  E AVDLE
Sbjct: 202 QPYEYEIDNQPYNDKILQLSDPIPSQPWMETTAIWVDTPESLQSMIKDLNNCTEFAVDLE 261

Query: 281 HHDYRSYYGIVCLMQISTREKDYLVDTLELRETLHILNEVFTDPSIVKVFHGAFMDIIWL 340
           HHDYR+YYGIVCLMQISTR +DY+VDTL+LR  L  LNE FT+P I KV HGAFMDIIWL
Sbjct: 262 HHDYRTYYGIVCLMQISTRTQDYIVDTLKLRSHLQPLNEPFTNPQITKVLHGAFMDIIWL 321

Query: 341 QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMIA 400
           QRDLGLY+V LFDT+HAS+A+G P++SLAYLLE F+NFKTSKKYQ+ADWRIRPLSK M +
Sbjct: 322 QRDLGLYIVSLFDTFHASRALGFPKNSLAYLLEKFSNFKTSKKYQMADWRIRPLSKAMNS 381

Query: 401 YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPRIPSSEVYSPIE 460
           YAR+DTHFLLNI+DQ+RNKL++  KLAGVL ESRNVAKRRFEY KYRP I SS VYSPIE
Sbjct: 382 YARSDTHFLLNIFDQMRNKLVQDGKLAGVLKESRNVAKRRFEYVKYRPLITSSAVYSPIE 441

Query: 461 KEAPWRVLMYQYNITSEKEELVKDLYQWRDVIARRDDESPRFVMPNQLLAALVAYTPIDV 520
           K  PW+ LMYQYNI   KE L+K+LYQWRD IARRDDESPR++MPNQLL +LVAY P++ 
Sbjct: 442 KIDPWKTLMYQYNIPLAKELLLKELYQWRDKIARRDDESPRYIMPNQLLVSLVAYAPVEP 501

Query: 521 IGVISLTNGITEHVRQNAKVLVNLIKNSLRHIKDTYKEDSPVTFSE-------SMTNEVS 573
            GV+S++N +T+HVR N+K+L NLIKN L  IKDT   DS +   E       + T  V 
Sbjct: 502 AGVVSVSNMVTDHVRSNSKILANLIKNCLTKIKDTTDADSLILQQEQNQPGTSTTTTNVD 561

Query: 574 L-EAITIPQIRDIMERF-SVLSNSN-----VSNCRAKNGATPSILLGRILPLEEND---- 622
           L E ++I Q+  +  +F S+ S  N      +N R        +L    +   + D    
Sbjct: 562 LSEQLSIHQLNTLKSQFLSLYSKVNHIEGVTNNARNAEKKNSFLLCTDHMSFNDEDGKNF 621

Query: 623 IAYK-NNGLPNRVKFEDIRARAQSFNSALSNLEDCMLEVEKPHILPTN-VKKIERINTE- 679
           I Y  +    +++  E++  R + F+ A+  L+    +VE    +P N +  +E    E 
Sbjct: 622 IKYSVSPDKKDKITTEELLKREEMFDQAMEQLQ----QVEYSIPIPENEIVVVESEQQEP 677

Query: 680 DVPKHSATI---------ENPDDIVVLKKKNIHRTQSMNAK----DTMGE-KAIDYSKIP 725
            +P  +A I         E+ D+I+VLKK N ++ +    K    D  GE + IDYSK+ 
Sbjct: 678 SIPAANAEITTAVASRKKEDLDEIIVLKKTNRNKGKKRERKHSDDDDEGEIEVIDYSKME 737

Query: 726 NVLSSKSDQNRRQQKKRRS-----DPLFNDSDGPRAAKKKRPATRGRNVSFKR 773
            VL + + +  + +    +     DP   +++GPRA KK++  TRG+NVSFKR
Sbjct: 738 KVLDNSNTKRNQNKNNNGNKRKRFDPYNVNNEGPRAPKKRKAMTRGKNVSFKR 790

>ZYRO0C07678g Chr3 (582236..584461) [2226 bp, 741 aa] {ON} similar
           to uniprot|Q12149 Saccharomyces cerevisiae YOR001W RRP6
           Exonuclease component of the nuclear exosome contributes
           to the quality-control system that retains and degrades
           aberrant mRNAs in the nucleus
          Length = 741

 Score =  701 bits (1809), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/744 (51%), Positives = 496/744 (66%), Gaps = 14/744 (1%)

Query: 41  MASQNPDVLLSKVVNVIRAASSLAGQDVDFYKNLDREFGKVLKSKSDKLADMANEIILSI 100
           MA ++ + LL KVV  +RAA++LA QDVDFY++LD+   K L   S++L  M N  +L I
Sbjct: 1   MAEESNEQLLPKVVGTVRAAAALAAQDVDFYRSLDKGVAKSLDKTSNELVSMINSTLLCI 60

Query: 101 DEHHESFELKDEDISGLWNDFGNIMDNLLEMSDHSLDKLNRAVTSKPNGADLQYLGDFSE 160
           D++    E   E +     DF N+MDNL E SD SLD L R       GA L YL D + 
Sbjct: 61  DQNSRLLEGGKEKLEDSRKDFSNLMDNLFEKSDRSLDIL-RGRAPDRKGAALMYLDDAAR 119

Query: 161 KNLSPAKRVEKPQLKFKTPIDNSESHPFIPLLKEKPNALKPLSDSLRLIEEDDNTPSHYP 220
            ++ PAKR+ KPQ++F+ PIDN+E+HPF PLL+ KP+AL+PLSD +RL++ D++ P HYP
Sbjct: 120 SDMIPAKRILKPQVRFQRPIDNTETHPFKPLLENKPHALRPLSDCVRLVQADEDIPEHYP 179

Query: 221 HPYEYEIDHQEYGSNILQIRKEIPSKSWNDSEPIWIDTMPKLESMLEELKNVQEIAVDLE 280
            PYEYEI++QEY  +IL+I + IPSK W+ SEP+W+D    L+SML++LK   EIAVDLE
Sbjct: 180 QPYEYEIENQEYNESILKIAEPIPSKPWDGSEPVWVDNKESLDSMLQDLKKSTEIAVDLE 239

Query: 281 HHDYRSYYGIVCLMQISTREKDYLVDTLELRETLHILNEVFTDPSIVKVFHGAFMDIIWL 340
           HHDYRSYYGIVCLMQ+STR+ DYLVDTL LR+ L +LNEVF +P IVKVFHGAFMDIIWL
Sbjct: 240 HHDYRSYYGIVCLMQVSTRQTDYLVDTLALRDDLVVLNEVFANPLIVKVFHGAFMDIIWL 299

Query: 341 QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMIA 400
           QRDLGLY+V LFDTYHAS+A+G PRHSLAYLLE FA+FKTSKKYQLADWR+RPLSK M A
Sbjct: 300 QRDLGLYIVSLFDTYHASRALGFPRHSLAYLLETFASFKTSKKYQLADWRVRPLSKAMSA 359

Query: 401 YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPRIPSSEVYSPIE 460
           YARADTHFLLNIYDQLRNKLI  NKLAGVL ESRNVAKR F+YSKYRP++P+S VYSP++
Sbjct: 360 YARADTHFLLNIYDQLRNKLIIENKLAGVLAESRNVAKRSFQYSKYRPKVPNSSVYSPVD 419

Query: 461 KEAPWRVLMYQYNITSEKEELVKDLYQWRDVIARRDDESPRFVMPNQLLAALVAYTPIDV 520
           +   W+VLM QYNI  EKE LVK+LY+WRD IARRDDESPR+VMPNQLLA LV YTP+D 
Sbjct: 420 RADGWKVLMNQYNIPLEKEILVKNLYEWRDTIARRDDESPRYVMPNQLLAYLVDYTPLDP 479

Query: 521 IGVISLTNGITEHVRQNAKVLVNLIKNSLRHIKDTYKEDSPVTFSESMTNEVSLEAITIP 580
            GVIS++  +T+HVR NAK L NLI  SL+ I D   +    +      +++S + +T+ 
Sbjct: 480 TGVISVSPTVTDHVRTNAKALANLIVKSLQQIADAGSDIKVESVQHKDQHDLS-QVLTVG 538

Query: 581 QIRDIMERFSVLSNS--NVSNCRAKNGATPSILLGRILPLEENDIAYKNNGLPNRVKFED 638
           QI   + +F  LS +   +S     + ++ SI+ G IL      + Y    L   V  + 
Sbjct: 539 QIESQVSQFHDLSKAFKGLSQGTNSSNSSSSIIFGNILHAPCGFVGY-GRSLKKPVTDKQ 597

Query: 639 IRARAQSFNSALSNLE----DCMLEVEKPHIL---PTNVKKIERINTEDVPKHSATIENP 691
           I  R    + AL  ++      + E ++   L   P + KK+   +     +   T    
Sbjct: 598 IEKRKLELSEALEFIDAETATTIQEEDRGSELTHEPADDKKVSENDESKKEEAKETEPEE 657

Query: 692 D--DIVVLKKKNIHRTQSMNAKDTMGEKAIDYSKIPNVLSSKSDQNRRQQKKRRSDPLFN 749
           D  +I+ LKK      +S  + ++  E+ IDY K   +L ++      +++        N
Sbjct: 658 DKNEIITLKKVKDRGKKSKRSNESEPEEPIDYKKSKKILETEKKSKSTKKRAFDPYAASN 717

Query: 750 DSDGPRAAKKKRPATRGRNVSFKR 773
           D+      KKKR   RG++ SFKR
Sbjct: 718 DAGNAPKPKKKRRMARGKSASFKR 741

>TBLA0A07170 Chr1 (1784984..1787299) [2316 bp, 771 aa] {ON} Anc_6.25
           YOR001W
          Length = 771

 Score =  698 bits (1801), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/757 (50%), Positives = 492/757 (64%), Gaps = 29/757 (3%)

Query: 38  PYVMASQNPDVLLSKVVNVIRAASSLAGQDVDFYKNLDREFGKVLKSKSDKLADMANEII 97
           P  M+  N + LL  +V V+RA+++LA QDVDFYK+LD++    L   ++   D+AN ++
Sbjct: 23  PNFMSEDNCEELLENIVGVVRASTALAAQDVDFYKSLDKKVSDSLNKTANDTLDIANSLL 82

Query: 98  LSIDEHHESFELKDEDISGLWNDFGNIMDNLLEMSDHSLDKLNRAVTSKPNGADLQY--- 154
           LSIDE+    E   + I   WN F NIMDNL+E SDH +D L     SKPN  + +Y   
Sbjct: 83  LSIDENCSPLEEGKDRIPDFWNGFSNIMDNLIEKSDHFIDAL-----SKPNNFNGKYNET 137

Query: 155 --LGDFSEKNLSPAKRVEKPQLKFKTPIDNSESHPFIPLLKEKPNALKPLSDSLRLIEED 212
             L + S  N +P+KR+EKPQL F  P+DN++S PF PLL EKPNALKPL DSL L+ E 
Sbjct: 138 TFLDNNSRTNSNPSKRIEKPQLLFSKPVDNTDSRPFKPLLVEKPNALKPLKDSLVLVPES 197

Query: 213 DNTPSHYPHPYEYEIDHQEYGSNILQIRKEIPSKSWNDSEPIWIDTMPKLESMLEELKNV 272
              P+HY  PYEYEID+QEY   +++IR   P K W  +  IWIDT   L  +L +L+  
Sbjct: 198 GIVPTHYLQPYEYEIDNQEYNEEVVEIRDPTPYKPWETTSAIWIDTKESLADLLMDLRKQ 257

Query: 273 QEIAVDLEHHDYRSYYGIVCLMQISTREKDYLVDTLELRETLHILNEVFTDPSIVKVFHG 332
            EIAVDLEHHD RSYYGI CLMQISTRE+DY+VDT+ LR+ L +LNE+FT+P+I KVFHG
Sbjct: 258 SEIAVDLEHHDLRSYYGITCLMQISTREQDYIVDTISLRDDLIVLNEIFTNPNITKVFHG 317

Query: 333 AFMDIIWLQRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIR 392
           A MDIIWLQRDLGLY+V LFDT+HASKA+GL RHSLAYLLEN+A+FKTSKKYQLADWR R
Sbjct: 318 ASMDIIWLQRDLGLYIVSLFDTFHASKALGLARHSLAYLLENYASFKTSKKYQLADWRRR 377

Query: 393 PLSKPMIAYARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPRIPS 452
           PL+  M+AYAR+DTHFLLNI+DQLRN LI+ NKLAGVL+ESRNVAKRRFEY K+RP +P 
Sbjct: 378 PLTNNMLAYARSDTHFLLNIFDQLRNTLIKQNKLAGVLHESRNVAKRRFEYLKFRPTVPL 437

Query: 453 SEVYSPIEKEAPWRVLMYQYNITSEKEELVKDLYQWRDVIARRDDESPRFVMPNQLLAAL 512
             +Y+ IEKEAPW+ L+ QYNI  EKE LV+ L++WRD+IARRDDESPR++MP Q+L +L
Sbjct: 438 PNLYTLIEKEAPWKSLLIQYNIQDEKEILVQKLWEWRDMIARRDDESPRYIMPTQVLISL 497

Query: 513 VAYTPIDVIGVISLTNGITEHVRQNAKVLVNLIKNSLRHIKDT-YKEDSPVTFSESMTNE 571
           ++YTP D  GVIS++N +TEHVR N+  L NLIK +L   K      DS  TF+ S T+ 
Sbjct: 498 ISYTPTDSSGVISVSNMVTEHVRSNSTTLANLIKKALESTKSIPNSSDSSSTFNMSRTDT 557

Query: 572 VSLEAITIPQIRDIMERFSVLS-NSNVSNCRAKNGATPSILLGRILPLEENDIAYKNNGL 630
                I+I +I +I  +F+ LS + N S          S+L   I+        Y  +  
Sbjct: 558 NVASLISITEINNICLKFNSLSKHYNTSKFLTSGIEVSSLLFSNIMTSSPKISDYSKDKT 617

Query: 631 PNRVKFEDIRARAQSFNSALSNLEDCMLEVEKPHILPTNVKKIERINTEDVP-------- 682
            +  K ED+ AR    +  L  L      + +P +   ++K IE      +P        
Sbjct: 618 TS-FKSEDMIARHIRLSEGLKGLSANNSFIYQPPV--EDIKSIEITTENPIPTLEPKSTQ 674

Query: 683 -KHSATI-ENPDDIVVLKKKNIHRTQSMNAKDTMGEKAIDYSKIPNVLSSKSDQNRRQQK 740
            K +  I E+ ++I+VLKK N    +     D      +DYSK   +   K +      K
Sbjct: 675 KKTTKEINEDNEEIIVLKKVNRKYQKGKKDADKDSTVVVDYSKAKKIFQKKDETINGNSK 734

Query: 741 KRRS-DPLFNDSDG---PRAAKKKRPATRGRNVSFKR 773
           KR+S DP  ND D    PRA KK++  TRG+N+S+KR
Sbjct: 735 KRKSFDPYNNDGDTDKVPRALKKRQTNTRGKNISYKR 771

>KLLA0D01309g Chr4 (114713..116947) [2235 bp, 744 aa] {ON} similar
           to uniprot|Q12149 Saccharomyces cerevisiae YOR001W RRP6
           Exonuclease component of the nuclear exosome contributes
           to the quality-control system that retains and degrades
           aberrant mRNAs in the nucleus
          Length = 744

 Score =  697 bits (1798), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/749 (48%), Positives = 498/749 (66%), Gaps = 21/749 (2%)

Query: 41  MASQNPDVLLSKVVNVIRAASSLAGQDVDFYKNLDREFGKVLKSKSDKLADMANEIILSI 100
           M+S++ D LLS +V  +R++S+LA QD+DFYK+LD      L+  S  +  + N+++LSI
Sbjct: 1   MSSEDKDTLLSSLVQTVRSSSALAAQDIDFYKSLDSNINASLEDTSTNILSLINDLLLSI 60

Query: 101 DEHHESFELKDEDISGLWNDFGNIMDNLLEMSDHSLDKLNRAVTSKPNGADLQYLGDFSE 160
           D +++  +   +     W    NIMDNL E SDH+LD +         G  L+YL D   
Sbjct: 61  DPNNDVIQQGKDSFVDSWKSISNIMDNLFEKSDHALDNIRAGNGGNAGGPSLKYLNDDDR 120

Query: 161 KNLSPAKRVEKPQLKFKTPIDNSESHPFIPLLKEKPNALKPLSDSLRLIEEDDNTPSHYP 220
            N  P+KR+EKPQL FKTP+DN+E HPF PLL+ KP++L+P   SL+++ E+++ PSHYP
Sbjct: 121 SNNKPSKRIEKPQLSFKTPVDNTELHPFKPLLEYKPHSLQPFEISLKMVPEEESIPSHYP 180

Query: 221 HPYEYEIDHQEYGSNILQIRKEIPSKSWNDSEPIWIDTMPKLESMLEELKNVQEIAVDLE 280
           HPYEYEIDHQ+Y  +IL   + IPSK W+++E IW+DT+  L  M +EL    E+A+DLE
Sbjct: 181 HPYEYEIDHQKYNDSILVATEPIPSKDWDETEAIWVDTVEGLNKMKDELSKATELAIDLE 240

Query: 281 HHDYRSYYGIVCLMQISTREKDYLVDTLELRETLHILNEVFTDPSIVKVFHGAFMDIIWL 340
           HHDYRSYYGIVCLMQIS RE D++VDT+ LRE L+ILN++FTDP++ KV HGAFMDIIWL
Sbjct: 241 HHDYRSYYGIVCLMQISDREHDWIVDTIALREELYILNDIFTDPNVTKVLHGAFMDIIWL 300

Query: 341 QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMIA 400
           QRDLGLY+VGLFDTYHAS+ +G P+HSLAYLLE FANFKTSKKYQLADWRIRPL+KPM+A
Sbjct: 301 QRDLGLYIVGLFDTYHASRMLGFPKHSLAYLLERFANFKTSKKYQLADWRIRPLTKPMLA 360

Query: 401 YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPRIPSSEVYSPIE 460
           YARADTHFLLNI+D+LRN L+E NK++ VL+ESR VAKRRFEYS +RP++PSS V+SPIE
Sbjct: 361 YARADTHFLLNIFDKLRNSLLEQNKMSDVLHESRKVAKRRFEYSSFRPKVPSSAVFSPIE 420

Query: 461 KEAPWRVLMYQYNITSEKEELVKDLYQWRDVIARRDDESPRFVMPNQLLAALVAYTPIDV 520
           K+ PW+ +M+QYNI + KE L++ LY+WRD IARRDDESPR+VMPNQLL +LVA  P + 
Sbjct: 421 KDEPWKNIMFQYNIPASKELLLRRLYEWRDTIARRDDESPRYVMPNQLLVSLVAGAPTEP 480

Query: 521 IGVISLTNGITEHVRQNAKVLVNLIKNSLRHIKDTYKEDSPVTFSESMTNEVSL-EAITI 579
           I V+S+++ ++EH+R N+KV+ NLIK +L  +K      +      + +N   L   IT 
Sbjct: 481 INVLSVSSYVSEHLRTNSKVIANLIKRTLEDLKGNSNSSAIPLLESAESNGTDLANIITT 540

Query: 580 PQIRDIMERF-SVLSNSNVSNCRAKNGATPSILLGRILPLEENDIAYKNNGLPNRVKFED 638
            QI+ I   F S+ S  N      +  +  S+L   I  L+ N            +   +
Sbjct: 541 SQIKSIQNIFHSLASEINSQKLNNEQNSEKSVLFNGISNLDVNTAVRYTPKTRTLIPQHE 600

Query: 639 IRARAQSFNSALS------NLEDCML---EVEKPHILPTNVKKIERINTEDVPKHSATIE 689
           +  R       L         +  +L   E E P  +  +  + E I ++  P      E
Sbjct: 601 LLKRQHEITRTLEQEYTDRQAQSIVLPSNEDEAPTQVSNDENRNEVITSD--PSQEEIEE 658

Query: 690 NPDDIVVLKKKNIHRTQSMNAKDTMGEKA----IDYSKIPNVL-SSKSDQNRRQQKKRRS 744
           N D+++ L+K+   ++QS N + T+   A    +DY+   ++L S+K++ N ++ KKRR 
Sbjct: 659 NKDEVITLRKR---QSQSNNKRKTISPPASHEIMDYAAGSDLLNSTKNNTNSQKHKKRRF 715

Query: 745 DPLFNDSDGPRAAKKKRPATRGRNVSFKR 773
           DP   +  GP+  KKK    +G+NVSFKR
Sbjct: 716 DPYSVEHVGPQPIKKKSKPAKGKNVSFKR 744

>TDEL0G04440 Chr7 (805881..808088) [2208 bp, 735 aa] {ON} Anc_6.25
           YOR001W
          Length = 735

 Score =  696 bits (1796), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/743 (51%), Positives = 501/743 (67%), Gaps = 18/743 (2%)

Query: 41  MASQNPDVLLSKVVNVIRAASSLAGQDVDFYKNLDREFGKVLKSKSDKLADMANEIILSI 100
           M     D LL KVV+ IRA+S+LA QDVDF+++L R  GK L   S ++  + N ++ SI
Sbjct: 1   MPPAEEDQLLRKVVDTIRASSALAAQDVDFHRSLSRPIGKSLDETSTRMVSLINSLLSSI 60

Query: 101 DEHHESFELKDEDISGLWNDFGNIMDNLLEMSDHSLDKLNRAVTSKPNGADLQYLGDFSE 160
           D++ E      E ++  W DF N+MDNL E+SD S D L RA  S+ +G  L++L + S 
Sbjct: 61  DQNSEPLVEGKETLNEYWKDFSNMMDNLFELSDCSADILTRAPGSRKDGEKLKFLDNSSS 120

Query: 161 KNLSPAKRVEKPQLKFKTPIDNSESHPFIPLLKEKPNALKPL-SDSLRLIEEDDNTPSHY 219
            +  P+KR+ KPQL FK P++N+E  PF+PLLKEKP AL+PL SD   ++  +D  P HY
Sbjct: 121 NDSIPSKRISKPQLNFKNPVNNTEIQPFVPLLKEKPFALRPLISD---IVPGNDAVPEHY 177

Query: 220 PHPYEYEIDHQEYGSNILQIRKEIPSKSWNDSEPIWIDTMPKLESMLEELKNVQEIAVDL 279
             PYEYEI+HQEYG +++   + IPSK W  +E +W+D +  L++M+ +LK+V EIAVDL
Sbjct: 178 AQPYEYEIEHQEYGESVIVKSEPIPSKPWETTEALWVDNIEVLKTMISDLKSVTEIAVDL 237

Query: 280 EHHDYRSYYGIVCLMQISTREKDYLVDTLELRETLHILNEVFTDPSIVKVFHGAFMDIIW 339
           EHHDYRSYYGIVCLMQISTRE+DYL+DT+ LR+ L ILNEVF +P I+KVFHGAFMDIIW
Sbjct: 238 EHHDYRSYYGIVCLMQISTRERDYLIDTIALRDDLQILNEVFANPKILKVFHGAFMDIIW 297

Query: 340 LQRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMI 399
           LQRDLGLYVV LFDT+HAS+AIGLPRHSLAYLLE FANFKTSKKYQLADWR+RPLSK M 
Sbjct: 298 LQRDLGLYVVSLFDTFHASRAIGLPRHSLAYLLEKFANFKTSKKYQLADWRLRPLSKAMN 357

Query: 400 AYARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPRIPSSEVYSPI 459
           AYARADTHFLLNIYDQLRN LIE NKLAGVL ESRNVAKRRFEYSK+RP  PS  VY PI
Sbjct: 358 AYARADTHFLLNIYDQLRNTLIEQNKLAGVLAESRNVAKRRFEYSKFRPIAPSPTVYCPI 417

Query: 460 EKEAPWRVLMYQYNITSEKEELVKDLYQWRDVIARRDDESPRFVMPNQLLAALVAYTPID 519
           +K  PW+VLM+QY+I+  +EELVK LY WRD IARRDDESPR+VMPNQLL  L    P +
Sbjct: 418 DKPDPWKVLMFQYSISPNREELVKKLYDWRDTIARRDDESPRYVMPNQLLVELARQAPTE 477

Query: 520 VIGVISLTNGITEHVRQNAKVLVNLIKNSLRHIKDTYKEDSPVTFSESMTNEVSLEAITI 579
            I VIS+ + +T+HVR N+ VL +LIKN+L     + KE    TF     +  +   +T+
Sbjct: 478 PINVISVNSIVTDHVRSNSLVLAHLIKNTL---ASSDKESDKGTFEADNNSTDAASLLTV 534

Query: 580 PQIRDIMERFSVLSNS-NVSNCRAKNGATPSILLGRILPLEENDIAYKNNGLPNRVKFED 638
           PQI+ +   F+ +S +  +     K+G + SI    IL  E++ + Y  N + +  K E 
Sbjct: 535 PQIQKLAACFAGVSRAFTILQNEYKDGRSSSIFTD-ILTSEDDAVNYVGNNMDHITKKEL 593

Query: 639 IRARAQSFNSALSNLEDCMLEVEKPHIL--PTNVKKIERINTEDVPKH-SATIENPDDIV 695
            +  A++  S     E     +  P I      +++I     E+V +  S   E+ D+I+
Sbjct: 594 GKRAAKALQSMEQFDEATSYYMPIPEIAKESNTMEEIRPPAPEEVKESPSPPKEDMDEII 653

Query: 696 VLKKKNIHRTQSMNAKDTMGEK---AIDYSKIPNVLSSKSDQNRRQQKKRRSDPLFND-- 750
            LKK    +      +  + E+   A+DY+K   VL++  D+N+ ++K++      ++  
Sbjct: 654 TLKKIK-KQKSQSPKELGISEREIPAVDYTKTKKVLATNQDKNKDKKKRKFDPYAASNHS 712

Query: 751 SDGPRAAKKKRPATRGRNVSFKR 773
           SD PRA KK++P  R RNVSFKR
Sbjct: 713 SDAPRAPKKRKPVNRERNVSFKR 735

>ACL001C Chr3 complement(354804..357041) [2238 bp, 745 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR001W
           (RRP6)
          Length = 745

 Score =  681 bits (1757), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/748 (46%), Positives = 496/748 (66%), Gaps = 19/748 (2%)

Query: 41  MASQNPDVLLSKVVNVIRAASSLAGQDVDFYKNLDREFGKVLKSKSDKLADMANEIILSI 100
           MAS + D L  ++V+ IRAA++L+ QD+DFY++L    G+ L   S  +  + NE++LS+
Sbjct: 1   MASTDEDPLFKRIVSTIRAAAALSAQDIDFYRSLHPSVGQELDDTSATVVSLINELLLSV 60

Query: 101 DEHHESFELKDEDISGLWNDFGNIMDNLLEMSDHSLDKLNRAVTSKPNGADLQYLGDFSE 160
           DE++   +   ++    W +  N+MDN+ E SDH+ D +    +S+  G ++QYL D S 
Sbjct: 61  DENNNELKPGRDNFEDSWKELSNVMDNIFEKSDHAFDSIKHGSSSRNEGVNMQYLADSSH 120

Query: 161 KNLSPAKRVEKPQLKFKTPIDNSESHPFIPLLKEKPNALKPLSDSLRLIEEDDNTPSHYP 220
            + +P+KR+EKPQL FKTP+DN+E HPF PLLKEKP+ALKPL +SL L  E++N P+HYP
Sbjct: 121 DDSTPSKRIEKPQLLFKTPVDNTELHPFKPLLKEKPHALKPLEESLMLAPEEENVPAHYP 180

Query: 221 HPYEYEIDHQEYGSNILQIRKEIPSKSWNDSEPIWIDTMPKLESMLEELKNVQEIAVDLE 280
           HPYEYEID Q Y  ++L++R+ I  + W  +EPIW+D +  L  ML+ELK V+E+AVDLE
Sbjct: 181 HPYEYEIDKQPYNDSVLEVRERIDPQPWEATEPIWVDNVESLSQMLDELKEVKELAVDLE 240

Query: 281 HHDYRSYYGIVCLMQISTREKDYLVDTLELRETLHILNEVFTDPSIVKVFHGAFMDIIWL 340
           HHDYRSYYGIVCLMQIS+R KD+LVDT+ LR+ LH+LN +  DP++VKVFHGAFMD+IWL
Sbjct: 241 HHDYRSYYGIVCLMQISSRSKDWLVDTIALRDDLHVLNVILPDPTVVKVFHGAFMDMIWL 300

Query: 341 QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMIA 400
           QRDLGLYVV LFDTYHAS+A+G P+HSLAYLLE FA FKTSKKYQLADWR+RPL KP+  
Sbjct: 301 QRDLGLYVVSLFDTYHASRALGFPKHSLAYLLETFAKFKTSKKYQLADWRVRPLPKPLRD 360

Query: 401 YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPRIPSSEVYSPIE 460
           YAR+DTHFLL+IYD LRN L+++ KLA VL  SRNVAKRRFEY+ +RPRIP S VYSPIE
Sbjct: 361 YARSDTHFLLSIYDDLRNALVKAGKLAEVLNASRNVAKRRFEYTSFRPRIPDSNVYSPIE 420

Query: 461 KEAPWRVLMYQYNITSEKEELVKDLYQWRDVIARRDDESPRFVMPNQLLAALVAYTPIDV 520
              PWR LMYQYN+   KE L+K LY+WRD +ARRDDES R+VMPNQLL +LV+ +P + 
Sbjct: 421 STEPWRKLMYQYNLPPSKEPLLKKLYEWRDTVARRDDESVRYVMPNQLLVSLVSLSPSET 480

Query: 521 IGVISLTNGITEHVRQNAKVLVNLIKNSLRHIKDTYKEDSPVTFSE-SMTNEVSLEAITI 579
            GV+S++  +T++VR NA+ L NLIK +L  IK      +  + SE +++N  +   +++
Sbjct: 481 AGVLSVSTYVTDYVRSNARTLANLIKRTLETIKAGTASVAEFSSSERALSNPAA--TLSL 538

Query: 580 PQIRDIMERF-SVLSNSNVSNCRAKNGATPSILLGRILPLEENDIAYKNNGLPNRVKFED 638
             I+++ + F S+L  +   +    +  + S+L    L    + + Y  NG  + +    
Sbjct: 539 HMIQNLDDHFRSLLMEAQKQSGSICSQHSSSLLFNSDLATGPSAVEY-TNGQKHVIGDNV 597

Query: 639 IRARAQS-FNSALSNLEDCMLEVEKP-HILPTNVKKIERINTEDVPKHS---ATIENPD- 692
           ++ R  +      S   + + ++E P H   +   ++    +   P+ S      + PD 
Sbjct: 598 LQTRKHALLQKFTSQPVEPVTDIEAPSHQSSSENPQVSEDISPSEPQESQNEVQKDEPDF 657

Query: 693 ---DIVVLKKKNIHRTQSMNAKDTMGEKAIDYSKIPNVL-----SSKSDQNRRQQKKRRS 744
              +IVVL+KK     Q      +   + +DYS    VL     S+    ++ + +KR+ 
Sbjct: 658 EKSEIVVLRKKKKAHAQKPKGTSSSPTETVDYSNAKEVLGKGTSSTAKRGDKDRPRKRKF 717

Query: 745 DPLFNDSDGPRAAKKKRPATRGRNVSFK 772
           DP   D++ P   KKK   ++G+++SFK
Sbjct: 718 DPYGQDNNAPSGVKKKNKPSKGKSISFK 745

>Ecym_3030 Chr3 (58929..61172) [2244 bp, 747 aa] {ON} similar to
           Ashbya gossypii ACL001C
          Length = 747

 Score =  670 bits (1728), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/755 (47%), Positives = 497/755 (65%), Gaps = 30/755 (3%)

Query: 41  MASQNPDVLLSKVVNVIRAASSLAGQDVDFYKNLDREFGKVLKSKSDKLADMANEIILSI 100
           M+S N D LL+K++  +RAASSLA QD+DF ++LD   G++L   S  +  + NE+ILS 
Sbjct: 1   MSSDNKDALLTKILGTVRAASSLAAQDIDFCRHLDASVGELLDETSQYIVSLLNEVILST 60

Query: 101 DEHHESFELKDEDISGLWNDFGNIMDNLLEMSDHSLDKLNRAVTSKPNGAD--LQYLGDF 158
            + +   E+  +++   W D  NI+DNL E SDHSLD L + ++S  +  D  +QYL   
Sbjct: 61  SKANNDLEVGKDNLEAAWKDLSNIIDNLFEKSDHSLDVLQKLLSSSSSQLDTNMQYLNVD 120

Query: 159 SEKNLSPAKRVEKPQLKFKTPIDNSESHPFIPLLKEKPNALKPLSDSLRLIEEDDNTPSH 218
           S+++   ++R+ KPQL+FK P+DNSE HPF PLLK KP+ALKPL +   L  E +  P+H
Sbjct: 121 SQRDGKLSQRIVKPQLQFKIPVDNSECHPFKPLLKVKPHALKPLEEVSSLTVETECVPAH 180

Query: 219 YPHPYEYEIDHQEYGSNILQIRKEIPSKSWNDSEPIWIDTMPKLESMLEELKNVQEIAVD 278
           YPHPYEYEID+Q Y  ++L I++ I   +W+++EPIW+D +  L  ML  LKNV+EIAVD
Sbjct: 181 YPHPYEYEIDNQPYDDSVLTIKEPIEPSNWDENEPIWVDNITALNDMLNGLKNVKEIAVD 240

Query: 279 LEHHDYRSYYGIVCLMQISTREKDYLVDTLELRETLHILNEVFTDPSIVKVFHGAFMDII 338
           LEHHDYRSYYG+VCLMQISTRE D+LVDT+ LR+ L +LNE+FTDPSI+KVFHGAFMDII
Sbjct: 241 LEHHDYRSYYGLVCLMQISTRESDWLVDTIALRQDLQVLNEIFTDPSILKVFHGAFMDII 300

Query: 339 WLQRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPM 398
           WLQRDLGLYVV LFDTYHAS+A+G P+HSLAYLLE FANFKTSKKYQLADWRIRPLSKPM
Sbjct: 301 WLQRDLGLYVVSLFDTYHASRALGFPKHSLAYLLETFANFKTSKKYQLADWRIRPLSKPM 360

Query: 399 IAYARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPRIPSSEVYSP 458
             YARADTHFLLNIYD+LRN LI+ +KL+GVL+ SRNVAKRRFEY+ +RP++ S  V+SP
Sbjct: 361 KTYARADTHFLLNIYDKLRNSLIKEDKLSGVLHASRNVAKRRFEYTSFRPKVLSPTVFSP 420

Query: 459 IEKEAPWRVLMYQYNITSEKEELVKDLYQWRDVIARRDDESPRFVMPNQLLAALVAYTPI 518
           IEK+ PWR LM QYN+   KE L++ LY+WRD++AR+DDES R+VMPNQLL +LV   P 
Sbjct: 421 IEKDDPWRTLMSQYNVPDIKEPLMRKLYKWRDMVARKDDESVRYVMPNQLLVSLVTLAPS 480

Query: 519 DVIGVISLTNGITEHVRQNAKVLVNLIKNSLRHIKDTYKEDSPVTFSESMTNEVSLEAIT 578
           D  G++++ + I +HVR NA+VL N+I  ++  IK    E   +    +         ++
Sbjct: 481 DPSGLLTVKSYIPDHVRANARVLCNIINKTMEEIKSGSHEGQSIENVTTTYVSAQDPEMS 540

Query: 579 IPQIRDIMERFSVLSNSNVSNCRAKNGATP-SILLGRILPLEENDIAYKNNG--LPNRVK 635
           +  I+ +   F  L +   S+    +     S+L    L  +   +AY + G  L N  +
Sbjct: 541 VSLIKTMDRHFKFLLDEVQSHAVEPSSVCEDSLLFKGFLFDKPKAVAYNSVGKRLVNDRE 600

Query: 636 FEDIRAR-AQSFNSAL--------SNLEDCMLEVEKPHILPTNV----KKIERINTEDVP 682
             D ++  +Q F+           S++E      E P    +NV    K+  + N++D+ 
Sbjct: 601 LLDRKSDLSQKFSKVFKAAGIAIGSHIEKLSSNSELPADTTSNVESPSKEESKNNSDDLK 660

Query: 683 KHSATIENPDDIVVLKKKNIHRTQSMNAKDTMGEKAIDYSKIPNVLSSKSDQNR----RQ 738
                 E+  +I+VLK+K  + + + +      ++ +DY+ + ++L + S Q++    R 
Sbjct: 661 ------EDKHEIIVLKRKRDYGSNTKSTSKQPKKEHVDYNNVNSILDNTSQQDKPNSGRH 714

Query: 739 QKKRRSDPLFNDSDGPRAAKKKRPATRGRNVSFKR 773
             KR+       S G  AA  K+P ++G+ VS+K+
Sbjct: 715 VDKRKFHSDLQGSIG--AAAIKKPRSKGKTVSYKK 747

>Kwal_56.22447 s56 (133578..135785) [2208 bp, 735 aa] {ON} YOR001W
           (RRP6) - involved in 5.8S rRNA processing [contig 185]
           FULL
          Length = 735

 Score =  644 bits (1662), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/743 (45%), Positives = 475/743 (63%), Gaps = 38/743 (5%)

Query: 49  LLSKVVNVIRAASSLAGQDVDFYKNLDREFGKVLKSKSDKLADMANEIILSIDEHHESFE 108
           +L++VV  IRA+S+++ QDVDFYK+LD    + L   S KL  + N++++SID++++  E
Sbjct: 12  ILTQVVGTIRASSAISAQDVDFYKSLDSTISESLDETSAKLLSLINDVVISIDDNNDLIE 71

Query: 109 LKDEDISGLWNDFGNIMDNLLEMSDHSLDKLNRAVTSKPNGADLQYLGDFSEKNLSPAKR 168
                +   WN+ G +MD L E S+H+L  + +   S   G +LQYL D      +   +
Sbjct: 72  PGRAGLENSWNNIGEVMDLLFEKSEHALAAMKKK-GSNIIGNNLQYLDDSQPLTDTTLTK 130

Query: 169 VEKPQLKFKTPIDNSESHPFIPLLKEKPNALKPLSDSLRLIEEDDNTPSHYPHPYEYEID 228
           + KPQ  F  P+DN+ESHPF PLL +KPNAL+PL D L+L  E++  P+HYPHPYEYEID
Sbjct: 131 ITKPQASFSRPVDNTESHPFKPLLVQKPNALRPLDDVLQLTVEEEGIPAHYPHPYEYEID 190

Query: 229 HQEYGSNILQIRKEIPSKSWNDSEPIWIDTMPKLESMLEELKNVQEIAVDLEHHDYRSYY 288
           HQEY  ++L+IR  IPSK W +++  W+D +  L  M+ EL   +E+A+DLEHHDYR+YY
Sbjct: 191 HQEYDESVLEIRPPIPSKPWEETDATWVDNLGTLNDMIRELSKAKELAIDLEHHDYRTYY 250

Query: 289 GIVCLMQISTREKDYLVDTLELRETLHILNEVFTDPSIVKVFHGAFMDIIWLQRDLGLYV 348
           GI CLMQISTRE D+LVDT+ LR+ L +LNE+FT+P ++KVFHGAFMD+IWLQRDLGLY+
Sbjct: 251 GITCLMQISTRENDWLVDTIALRDHLWVLNEIFTNPKVIKVFHGAFMDVIWLQRDLGLYL 310

Query: 349 VGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMIAYARADTHF 408
           V LFDT+HAS+ +G P+HSLAYLLE +A+FKTSKKYQLADWRIRPLSKP+ AYARADTHF
Sbjct: 311 VSLFDTFHASRLLGFPKHSLAYLLERYAHFKTSKKYQLADWRIRPLSKPLKAYARADTHF 370

Query: 409 LLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPRIPSSEVYSPIEKEAPWRVL 468
           LLNIYDQ+RN LIE  KLA  L+ SR VAKRRFEY+K+RP + +SEVYSP+E+E PWR L
Sbjct: 371 LLNIYDQMRNSLIEQGKLAQSLHNSRGVAKRRFEYTKFRPTVMTSEVYSPVEREDPWRSL 430

Query: 469 MYQYNITSEKEELVKDLYQWRDVIARRDDESPRFVMPNQLLAALVAYTPIDVIGVISLTN 528
           ++ YNI   K  L+K LY+WRD IARRDDESPR+VMPNQLL ALV   P D  G++S+T+
Sbjct: 431 IFHYNIPQSKSFLLKRLYEWRDTIARRDDESPRYVMPNQLLVALVMNAPTDTYGLLSVTS 490

Query: 529 GITEHVRQNAKVLVNLIKNSLRHIKDTYKE------------DSPVTFSESMTNEVSLEA 576
            +TEHVR NAK L  LIK +L   +D + +            DS ++  +   N  + + 
Sbjct: 491 FVTEHVRSNAKSLSQLIKKTLASPQDLFTDQINHMDSNKSMVDSKLSPGDVKANHQNFDQ 550

Query: 577 ITIPQIRDIMERFSVLSNSNVSNCRAKNGATPSILLGRILPLEENDIAYKNNGLPN--RV 634
            T      ++   +V     V  C        S+  G+ LP  E  ++Y+   + +    
Sbjct: 551 YTRKSRELVIHGPTV-----VRGC--------SLFPGKPLP-NEAYVSYQGTQVHHIEPT 596

Query: 635 KFEDIRAR-AQSFNSALSNLEDCMLEVEKPHILPTNVKKIERINTEDVPKHSATI--ENP 691
             +D R   AQ+  +  +  E   + VEK    P    +++    +++   + +   E+ 
Sbjct: 597 VLDDRRELVAQNITTTANVTEKLQVAVEKTPA-PEVSDELDEGEAKELSDDTVSQLKEDK 655

Query: 692 DDIVVLKKKNIHRTQSMNAKDTMG--EKAIDYSKIPNVLSSKSDQNRRQQKKRRSDPLFN 749
           D+IVVLK++      S   K+  G  ++ +D+     ++++ +   R+  K  R DP   
Sbjct: 656 DEIVVLKRRKALPQSSSPPKNAEGNPKEILDFKNNKKIMTATASVPRKSTK--RFDPYAI 713

Query: 750 DSDGPRAAKKKRPATRGRNVSFK 772
            + GP    K+R  TRG   SFK
Sbjct: 714 QASGPDGV-KRRKKTRGIQKSFK 735

>KLTH0C11066g Chr3 complement(910359..912566) [2208 bp, 735 aa] {ON}
           similar to uniprot|Q12149 Saccharomyces cerevisiae
           YOR001W RRP6 Exonuclease component of the nuclear
           exosome contributes to the quality-control system that
           retains and degrades aberrant mRNAs in the nucleus
          Length = 735

 Score =  620 bits (1600), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/747 (46%), Positives = 472/747 (63%), Gaps = 47/747 (6%)

Query: 49  LLSKVVNVIRAASSLAGQDVDFYKNLDREFGKVLKSKSDKLADMANEIILSIDEHHESFE 108
           +L++V+  IRA+S++  QDV FYKNLD      + + S +L  + N+I+LS+DE+++  E
Sbjct: 12  VLNQVIATIRASSAVTAQDVSFYKNLDPSIATSVNNISARLLGLINDILLSVDENNDIIE 71

Query: 109 LKDEDISGLWNDFGNIMDNLLEMSDHSLDKLNRAVTSKPNG---ADLQYLGDFSEKNLSP 165
              E +   W++ G +MD L E S+H+L     A   + NG     +QYL D    +   
Sbjct: 72  QGSEGLESAWSNVGEVMDLLFEKSEHAL----AAGEKRDNGELSKTVQYLDDSPSLHDGA 127

Query: 166 AKRVEKPQLKFKTPIDNSESHPFIPLLKEKPNALKPLSDSLRLIEEDDNTPSHYPHPYEY 225
            K++ KPQL FK PIDNSESHPF PLLK+KP+AL+ L +SLRL  E ++ P+HYP PYEY
Sbjct: 128 PKKILKPQLLFKRPIDNSESHPFKPLLKKKPHALRSLDESLRLTAEQEDVPAHYPQPYEY 187

Query: 226 EIDHQEYGSNILQIRKEIPSKSWNDSEPIWIDTMPKLESMLEELKNVQEIAVDLEHHDYR 285
           EIDHQEY  ++LQI + +PS  W+++E  W+D    L+ ML EL    EIA+DLEHHDYR
Sbjct: 188 EIDHQEYNESVLQISEPVPSLPWDETEAEWVDNTDALKLMLNELLLANEIAIDLEHHDYR 247

Query: 286 SYYGIVCLMQISTREKDYLVDTLELRETLHILNEVFTDPSIVKVFHGAFMDIIWLQRDLG 345
           +YYGI CLMQISTREKD+L+DT+ LR+ L ILNEVFTDP I KV HGAFMDIIWLQRDLG
Sbjct: 248 TYYGITCLMQISTREKDWLIDTIALRDDLWILNEVFTDPKITKVLHGAFMDIIWLQRDLG 307

Query: 346 LYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMIAYARAD 405
           LY+V LFDTYHAS+ +G P+HSLAYLLE +A+FKTSKKYQL+DWR+RPL K + AYARAD
Sbjct: 308 LYIVSLFDTYHASRLLGSPKHSLAYLLERYAHFKTSKKYQLSDWRVRPLPKALKAYARAD 367

Query: 406 THFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPRIPSSEVYSPIEKEAPW 465
           THFLLNIYD +RN LIE NKL+ VL++SRNVAKRRFE++ +RP+I +S V+SPIE+E PW
Sbjct: 368 THFLLNIYDNMRNSLIEQNKLSQVLHDSRNVAKRRFEFTTFRPKIVTSHVFSPIEREDPW 427

Query: 466 RVLMYQYNITSEKEELVKDLYQWRDVIARRDDESPRFVMPNQLLAALVAYTPIDVIGVIS 525
           R LM+QYNI   K  LV+ LY+WRD++ARRDDESPR+V+PNQLL +L    P     +++
Sbjct: 428 RTLMFQYNIPQSKSLLVRRLYEWRDMVARRDDESPRYVIPNQLLVSLAVNAPTTPALIMA 487

Query: 526 LTNGITEHVRQNAKVLVNLIKNSLRHIKDTYKE--DSPVTFSESMTNEVSLEAITIPQIR 583
            +  +TEH+RQNAK L  LIK SL    + + +  +S  T   S   ++S E   I +  
Sbjct: 488 TSTFVTEHIRQNAKSLALLIKKSLESSSNEFGQLLNSANTVQNSSPTKMSSE--DIEKNS 545

Query: 584 DIMERF-SVLSNSNVSNCRAKNGATPSILLGRILPLEENDIAYK--------NNGLPNR- 633
            + E+F    S    ++C    G+  S+   + +P EE  ++Y+        +N L NR 
Sbjct: 546 RMFEKFLEDFSYEKAADCGISLGS--SLFQKKFVPCEEY-VSYQESRASLVDHNSLENRR 602

Query: 634 ----VKFEDIR--ARAQSFNSALSNLEDCMLEVEKPHILPTNVKKIERINTEDVPKHSAT 687
                K+E  R  AR Q    A S+   C  E                 N     ++ A 
Sbjct: 603 HQVSKKYEAERDIARPQVHIRAASSHAVCDKEAGAED------------NESAEEENKAR 650

Query: 688 IENPDDIVVLKKKNIHRTQSMNAKD--TMGEKAIDYSKIPNVLSSKSDQNRRQQKKRRSD 745
            E  D+++VLK++     +   A D  T   + +D      +L + S+  RR   K+R D
Sbjct: 651 KEEMDEVIVLKQRKTLADKEQRAVDKATPSIEPLDLQSARKILEAPSNNVRR--PKKRFD 708

Query: 746 PLFNDSDGPRAAKKKRPATRGRNVSFK 772
           P    + GP +  KKR  T+G   SF+
Sbjct: 709 PYATLAAGPPSV-KKRKKTKGLQKSFR 734

>NDAI0A01130 Chr1 complement(240944..242380) [1437 bp, 478 aa] {ON}
           Anc_8.379 YDR179W-A
          Length = 478

 Score = 41.6 bits (96), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 56/109 (51%), Gaps = 3/109 (2%)

Query: 24  RYEERRLNNQKAPTPYVMASQNPDVLLSKVVNVIRAASSLAGQDVDFYKNLDREFGKVLK 83
           +Y  R++ +       ++A   P V+LS+ +  IR +     +++D    L +E+ K++ 
Sbjct: 136 QYVTRQIRDDSIDFEALLADDIP-VILSRHIEAIRKSQLKTTENIDDSSTLYKEYRKIVL 194

Query: 84  SKSDKLADMANEIILSIDEHHESFELKDEDISGLWND--FGNIMDNLLE 130
           S SDK  +     I S+ E  +S  L+   +  L+N+  FG I+D+L E
Sbjct: 195 SDSDKYPEQITNFIKSLIEGSDSSTLQSSFLDSLFNELLFGRILDSLTE 243

>SAKL0D00902g Chr4 complement(70897..72222) [1326 bp, 441 aa] {ON}
           similar to uniprot|P29704 Saccharomyces cerevisiae
           YHR190W ERG9 Farnesyl-diphosphate farnesyl transferase
           (squalene synthase) joins two farnesyl pyrophosphate
           moieties to form squalene in the sterol biosynthesis
           pathway
          Length = 441

 Score = 40.4 bits (93), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 63/146 (43%), Gaps = 12/146 (8%)

Query: 532 EHVRQNAKVLVNLIKNSLRHIKDTYKEDSPVTFSESMTNEVSLEAITIPQIRDIMERFSV 591
           EH  +    + +L+ N+L H++D       +T+  S+  + S +   IPQ+  I     V
Sbjct: 258 EHTLEGVHCINHLVLNALGHVQDV------LTYLSSIHEQSSFQFCAIPQVMAIATLALV 311

Query: 592 LSNSNV--SNCRAKNGATPSILL-GRILPLEENDIAYKNNGLPNRVKFEDIRARAQSFNS 648
             N NV   N + + G T  ++L  R L        Y    +  R+  +D        N 
Sbjct: 312 FGNENVLHENVKIRKGTTCYLILKSRTLRGCVEIFQYYLRDIKKRLLVDD--PNYLKLNI 369

Query: 649 ALSNLEDCMLEVEKPHILPTNVKKIE 674
            ++ LE  + E+ +   LPT VK +E
Sbjct: 370 QIAKLEQYIEEMYQEQ-LPTGVKPVE 394

>Smik_13.389 Chr13 (612617..613213) [597 bp, 198 aa] {ON} YMR184W
           (REAL)
          Length = 198

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 31/52 (59%), Gaps = 1/52 (1%)

Query: 39  YVMASQNPDVLLSKVVNVIRAASSLAGQDVDFY-KNLDREFGKVLKSKSDKL 89
           Y + S N D LL+K+ N+    S L+ +++DFY K LD    K+L+S   K+
Sbjct: 102 YNIISYNEDELLTKINNLSEPGSKLSSKELDFYKKKLDSNIAKILQSDHTKI 153

>KLTH0F06886g Chr6 complement(604652..605977) [1326 bp, 441 aa] {ON}
           highly similar to uniprot|P29704 Saccharomyces
           cerevisiae YHR190W ERG9 Farnesyl-diphosphate farnesyl
           transferase (squalene synthase) joins two farnesyl
           pyrophosphate moieties to form squalene in the sterol
           biosynthesis pathway
          Length = 441

 Score = 36.6 bits (83), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 38/83 (45%), Gaps = 8/83 (9%)

Query: 532 EHVRQNAKVLVNLIKNSLRHIKDTYKEDSPVTFSESMTNEVSLEAITIPQIRDIMERFSV 591
           EH +     + +L+ N+L H++D       +TF  S+  + S +   IPQ+  I     V
Sbjct: 258 EHTQDGLHCISHLVLNALSHVEDV------LTFLSSVHEQSSFQFCAIPQVMAIATLALV 311

Query: 592 LSNSNV--SNCRAKNGATPSILL 612
             N  V   N + + G T  ++L
Sbjct: 312 FGNPEVLHKNVKIRKGTTCFLIL 334

>KLTH0D11616g Chr4 complement(951182..952090) [909 bp, 302 aa] {ON}
           similar to uniprot|Q08686 Saccharomyces cerevisiae
           YOR251C catalyzes transfer of the sulfane atom of
           thiosulfate to cyanide to form sulfite and thiocyanate
          Length = 302

 Score = 34.7 bits (78), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 56/112 (50%), Gaps = 7/112 (6%)

Query: 349 VGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMIAYARADTHF 408
           VG F     +  + +  H L YLL NF  +K ++ + L        S+   +  ++D  F
Sbjct: 99  VGNFSAPRCAWTLAVFGHELVYLLNNFPAYK-AEGFPLDTTPRTSFSELEPSDYKSDADF 157

Query: 409 L---LNIYDQLRNKLIESNKLAGV--LYESRNVAKRRFEYSKYRPRIPSSEV 455
               +  Y+++ +KL+E  KLA V  ++++R + +   E S+ RP IPS  +
Sbjct: 158 TKQEVVSYEEI-HKLVEDGKLAEVYNVFDARALPRFTGESSEPRPEIPSGHI 208

>KLLA0D12936g Chr4 complement(1106301..1107070,1107164..1107245)
           [852 bp, 283 aa] {ON} weakly similar to uniprot|P46670
           Saccharomyces cerevisiae YPL241C CIN2 Tubulin folding
           factor C (putative) involved in beta-tubulin (Tub2p)
           folding isolated as mutant with increased chromosome
           loss and sensitivity to benomyl
          Length = 283

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 31/131 (23%), Positives = 52/131 (39%), Gaps = 22/131 (16%)

Query: 560 SPVTFSESMTNEVSLEAITIPQIRDIMERFSVLSNS--NVSNCRAK-NGATP-------- 608
           S      S+ N   L+A+T PQ++D    + +  NS  N++NC  K  G  P        
Sbjct: 107 SAAVMDSSLENSKKLDAVTSPQLKDTTIYYDISENSYRNLTNCTLKYTGTEPLQEFATLS 166

Query: 609 ------SILLGRILPLEENDIAYKNNGLPNRVKFEDIRARAQSFNSALSNLEDCMLEVEK 662
                 SI+   ILP  +  +  +  G     K   I  +  +    L  + +C L + +
Sbjct: 167 IQDVHKSIVYFNILPFNQGSLLLERFG---HCKIVIITPKNSNLQLRLHEMHNCQLYIRE 223

Query: 663 PHILPTNVKKI 673
            H  P  ++ I
Sbjct: 224 QH--PGQIQDI 232

>TBLA0D02610 Chr4 (641823..642734) [912 bp, 303 aa] {ON} Anc_8.63
           YPL018W
          Length = 303

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 36/66 (54%), Gaps = 2/66 (3%)

Query: 552 IKDTYKEDSPVTFSESMTNEVSLEAITIPQI--RDIMERFSVLSNSNVSNCRAKNGATPS 609
           I DT   DS + F  S  N+ +  ++    I  ++ +  F V+++ N S+C  KN ++P+
Sbjct: 117 ILDTSINDSKLQFEISFKNKHTNNSVQFEMISEQNKITSFKVINSDNFSSCNLKNISSPN 176

Query: 610 ILLGRI 615
           ILL  I
Sbjct: 177 ILLNLI 182

>Kwal_33.14284 s33 complement(600693..602018) [1326 bp, 441 aa] {ON}
           YHR190W (ERG9) - squalene synthetase [contig 104] FULL
          Length = 441

 Score = 34.3 bits (77), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 38/83 (45%), Gaps = 8/83 (9%)

Query: 532 EHVRQNAKVLVNLIKNSLRHIKDTYKEDSPVTFSESMTNEVSLEAITIPQIRDIMERFSV 591
           EH +   + + +L+ N+L H+ D       + +  S+  + S +   IPQ+  I     V
Sbjct: 258 EHTQAGLQCISHLVLNALSHVSDV------LMYLSSVHEQSSFQFCAIPQVMAIATLALV 311

Query: 592 LSNSNV--SNCRAKNGATPSILL 612
             N +V   N + + G T  ++L
Sbjct: 312 FGNPSVLHENVKIRKGTTCYLIL 334

>Kwal_23.3481 s23 (310853..313579) [2727 bp, 908 aa] {ON} YGL141W
           (HUL5) - ubiquitin-protein ligase (E3) [contig 252] FULL
          Length = 908

 Score = 33.9 bits (76), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 34/107 (31%), Positives = 49/107 (45%), Gaps = 8/107 (7%)

Query: 47  DVLLSKVVNVIRAASS---LAGQDVDFYKNLDREFGKVLKSKSDKLADMANEIILSIDEH 103
           D  L K++N   + SS   LA  D D Y NL     K+L   SD+L  +     ++ ++ 
Sbjct: 667 DFFLKKLLNFNNSNSSFDDLASLDPDLYSNL----AKLLVMNSDELQALGLLFEITDEDT 722

Query: 104 HESFELKDEDISGLWNDFGNIMDNLLEMSDHSLDKLNRAVTSKPNGA 150
           H + EL     S L  D  N++  LL +SD  L+K  R  T    G 
Sbjct: 723 HRTVELVPNG-SSLRVDKSNVLHFLLAVSDFKLNKKLRVGTRAFTGG 768

>Smik_21.8 Chr21 (8409..10076) [1668 bp, 555 aa] {ON} YBR158W (REAL)
          Length = 555

 Score = 32.7 bits (73), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 36/81 (44%), Gaps = 7/81 (8%)

Query: 509 LAALVAYTPIDVIGVISL---TNGITEHVRQNAKVLVNLIKNSLRHIKDTYKEDSPVTFS 565
           LAAL  YT ++ IG         GI E  R N K +  L  NS R + D      P+ F+
Sbjct: 410 LAALAKYTQVETIGFAGCDIDDAGIWEFARLNGKNVERLSLNSCRLLTD---HSLPILFA 466

Query: 566 -ESMTNEVSLEAITIPQIRDI 585
             S  N   LE   + +I D+
Sbjct: 467 LNSFPNLAVLEIRNLDRITDV 487

>YDR402C Chr4 complement(1272234..1273703) [1470 bp, 489 aa] {ON}
           DIT2N-formyltyrosine oxidase, sporulation-specific
           microsomal enzyme involved in the production of
           N,N-bisformyl dityrosine required for spore wall
           maturation, homologous to cytochrome P-450s
          Length = 489

 Score = 32.3 bits (72), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 41/89 (46%), Gaps = 13/89 (14%)

Query: 471 QYNITSEKEELVKDLYQWRDVIARRDDESPRFVMPNQLLAALVAYTPIDVIGVI------ 524
           ++NI   + E +  +++  D  A+  ++     +P   LAA      I   G +      
Sbjct: 76  RWNILVSRSEYLAQIFKDEDTFAKSGNQKK---IPYSALAAYTGDNVISAYGAVWRNYRN 132

Query: 525 SLTNGITEH----VRQNAKVLVNLIKNSL 549
           ++TNG+       + +NAK+L  LIKN L
Sbjct: 133 AVTNGLQHFDDAPIFKNAKILCTLIKNRL 161

>TBLA0B00630 Chr2 (130354..131904) [1551 bp, 516 aa] {ON} Anc_2.57
           YNL193W
          Length = 516

 Score = 32.0 bits (71), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 37/76 (48%), Gaps = 13/76 (17%)

Query: 76  REFGKVLKSKSDKLADMANEIILSIDEHHESFELKDEDISGLWNDFGNIMDNLLEMSDHS 135
           ++F  +L +K D +        +S  E ++SFEL+       WN   NIM+NLL  S   
Sbjct: 354 QQFVDLLMNKIDVI-----NFAISCSEDNQSFELQ-------WN-LCNIMNNLLNSSKSH 400

Query: 136 LDKLNRAVTSKPNGAD 151
           L  L  A++  P  AD
Sbjct: 401 LTALKDAISKSPLLAD 416

>YOR251C Chr15 complement(802550..803464) [915 bp, 304 aa] {ON}
           TUM1Rhodanese domain sulfur transferase, accepts
           persulfite from Nfs1p and transfers it to Uba4p in the
           pathway for 2-thiolation of the wobble uridine base of
           tRNAs; also stimulates sulfur transfer by Nfs1p; may be
           mitochondrially localized
          Length = 304

 Score = 31.6 bits (70), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 73/151 (48%), Gaps = 15/151 (9%)

Query: 328 KVFHGAFMDIIWLQRDLGLYV---VGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKY 384
           KVF  A M  + +Q+D  L V   VG F +   +  +G+  H   YLL NF  ++   KY
Sbjct: 76  KVFDDA-MSNLGVQKDDILVVYDRVGNFSSPRCAWTLGVMGHPKVYLLNNFNQYREF-KY 133

Query: 385 QLADWRIRPLSK-PMIAYARADTHFLLNIYD-QLRNKLIESNKLAGVL--YESRNVAKRR 440
            L   ++   S  P   Y  +++     I D +   +L++S +LA     +++R++   R
Sbjct: 134 PLDSSKVAAFSPYPKSHYESSESFQDKEIVDYEEMFQLVKSGELAKKFNAFDARSLG--R 191

Query: 441 FEYSKYRPR--IPSSEVYSPIEKEAPWRVLM 469
           FE ++  PR  IPS  +  P  +  P+  L+
Sbjct: 192 FEGTEPEPRSDIPSGHI--PGTQPLPYGSLL 220

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.133    0.381 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 88,858,287
Number of extensions: 4335137
Number of successful extensions: 16417
Number of sequences better than 10.0: 109
Number of HSP's gapped: 17051
Number of HSP's successfully gapped: 112
Length of query: 773
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 656
Effective length of database: 40,065,477
Effective search space: 26282952912
Effective search space used: 26282952912
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 70 (31.6 bits)