Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_15.1696.26ON29129115480.0
Skud_15.1616.26ON29329313590.0
YOL001W (PHO80)6.26ON29329313070.0
Suva_15.1746.26ON29529512511e-175
Kpol_1037.306.26ON3672917576e-99
TDEL0G044306.26ON3472427522e-98
TPHA0J003806.26ON3562557192e-93
ZYRO0C07634g6.26ON3822547213e-93
Kwal_56.224436.26ON2802436976e-91
ACR001C6.26ON3462767011e-90
KLTH0C11110g6.26ON2802446932e-90
CAGL0E02541g6.26ON3422356966e-90
SAKL0E01408g6.26ON3072446901e-89
KNAG0I017506.26ON3242656809e-88
Ecym_30296.26ON3512306645e-85
TBLA0A071606.26ON2682606444e-83
KLLA0D01287g6.26ON3452226392e-81
NCAS0D021506.26ON3692516082e-76
NDAI0C026406.26ON4272315428e-66
Smik_9.1407.240ON2852051891e-15
Suva_9.1497.240ON2862101862e-15
Skud_9.1197.240ON2851761828e-15
YIL050W (PCL7)7.240ON2851841811e-14
KAFR0I018407.240ON3251191643e-12
Ecym_43367.240ON3851101618e-12
Kwal_23.58077.240ON4651261556e-11
KNAG0D016307.240ON4381321556e-11
SAKL0F08602g7.240ON4741151557e-11
KLTH0A04268g7.240ON5801261558e-11
ADL075W7.240ON2071101481e-10
NCAS0A134807.240ON4481201494e-10
KAFR0L008807.240ON3131531465e-10
CAGL0M12342g7.240ON4571191451e-09
KLLA0C08305g7.240ON4091331432e-09
NCAS0E032207.240ON3411281413e-09
KNAG0L014707.240ON3541371405e-09
TPHA0C010907.240ON3851571388e-09
NDAI0A025607.240ON5031131361e-08
TDEL0H020207.240ON3631361333e-08
TBLA0D040707.240ON661601318e-08
Kpol_1033.137.240ON250761252e-07
ZYRO0C08118g7.240ON405601263e-07
YER059W (PCL6)7.240ON420651211e-06
Smik_5.1897.240ON415601211e-06
Suva_5.1677.240ON424601211e-06
NDAI0E047707.240ON303761182e-06
Skud_5.1737.240ON420601192e-06
YDL179W (PCL9)7.289ON3041381164e-06
Kpol_2000.147.289ON3101091147e-06
TBLA0C048507.289ON3681551131e-05
Suva_4.687.289ON3051351076e-05
NCAS0A137707.289ON3121271041e-04
TDEL0H015507.289ON3091331022e-04
TPHA0P008107.289ON24798994e-04
Smik_4.607.289ON305145995e-04
SAKL0C12100g3.70ON314122995e-04
Suva_14.503.70ON27996986e-04
Kwal_23.60067.289ON304141987e-04
TBLA0J006507.289ON363101987e-04
ZYRO0C09284g7.289ON311146978e-04
Smik_4.1107.289ON308145970.001
NDAI0A022707.289ON330160960.001
SAKL0F09856g7.289ON335150960.001
CAGL0E02233g3.70ON26698950.001
YDL127W (PCL2)7.289ON308145960.001
Kpol_1020.163.70ON282170950.001
Smik_14.423.70ON279106940.002
Kpol_1020.87.289ON296124940.002
AFR159C7.289ON308109930.003
TBLA0A078903.70ON361112930.003
Skud_14.483.70ON279106930.003
Suva_4.1187.289ON309135930.003
YNL289W (PCL1)3.70ON279106920.003
Ecym_80387.289ON314111930.003
KLTH0A05346g7.289ON301145920.004
KNAG0A014903.70ON262139910.005
KNAG0B029307.289ON312123900.007
Ecym_35353.70ON370105900.007
Skud_4.797.289ON309136900.008
CAGL0J09328g7.289ON297136890.009
Skud_4.1287.289ON308135870.017
KLLA0E13223g3.70ON282104860.023
TPHA0A005803.70ON289115850.025
Suva_16.876.236ON501174860.029
ZYRO0C02068g3.70ON330103850.030
YPL219W (PCL8)6.236ON492157820.084
TDEL0E007903.70ON254102790.14
ZYRO0B14410g4.333ON57469800.16
NDAI0A060503.70ON28696790.18
NCAS0A098703.70ON29487780.19
AEL195W3.70ON237117770.23
NCAS0D040706.236ON473117780.29
TBLA0B084403.70ON268106760.32
Smik_6.4246.236ON492127760.47
KLTH0H03674g6.236ON484103750.58
KLLA0F05654g7.289ON311149740.63
Kwal_56.241516.236ON480137750.65
Kwal_23.52313.70ON25687730.78
TPHA0A032507.289ON28955730.92
KAFR0A082803.70ON241159711.3
KAFR0C015603.70ON26787701.9
NDAI0C019805.347ON226104701.9
NCAS0B037008.287ON87074712.1
KLTH0A01584g3.70ON28187692.8
Skud_7.1396.236ON434138693.6
Suva_7.1306.236ON442112675.1
NDAI0C043005.347ON240107665.6
YDR515W (SLF1)1.36ON44759675.8
KNAG0F018706.236ON483109676.1
ZYRO0C10054g2.58ON104191677.1
NCAS0D016405.117ON68658667.7
CAGL0J10846g5.347ON229100658.2
Smik_7.1386.236ON437106659.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_15.169
         (291 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_15.169 Chr15 (292553..293428) [876 bp, 291 aa] {ON} YOL001W...   600   0.0  
Skud_15.161 Chr15 (284851..285732) [882 bp, 293 aa] {ON} YOL001W...   528   0.0  
YOL001W Chr15 (325249..326130) [882 bp, 293 aa] {ON}  PHO80Cycli...   508   0.0  
Suva_15.174 Chr15 (299761..300648) [888 bp, 295 aa] {ON} YOL001W...   486   e-175
Kpol_1037.30 s1037 complement(72024..73127) [1104 bp, 367 aa] {O...   296   6e-99
TDEL0G04430 Chr7 (804428..805471) [1044 bp, 347 aa] {ON} Anc_6.2...   294   2e-98
TPHA0J00380 Chr10 complement(84485..85555) [1071 bp, 356 aa] {ON...   281   2e-93
ZYRO0C07634g Chr3 (580486..581634) [1149 bp, 382 aa] {ON} simila...   282   3e-93
Kwal_56.22443 s56 (131419..132261) [843 bp, 280 aa] {ON} YOL001W...   273   6e-91
ACR001C Chr3 complement(357962..359002) [1041 bp, 346 aa] {ON} S...   274   1e-90
KLTH0C11110g Chr3 complement(914257..915099) [843 bp, 280 aa] {O...   271   2e-90
CAGL0E02541g Chr5 (244814..245842) [1029 bp, 342 aa] {ON} simila...   272   6e-90
SAKL0E01408g Chr5 (106229..107152) [924 bp, 307 aa] {ON} similar...   270   1e-89
KNAG0I01750 Chr9 (344381..345355) [975 bp, 324 aa] {ON} Anc_6.26...   266   9e-88
Ecym_3029 Chr3 (56667..57722) [1056 bp, 351 aa] {ON} similar to ...   260   5e-85
TBLA0A07160 Chr1 (1782941..1783747) [807 bp, 268 aa] {ON} Anc_6....   252   4e-83
KLLA0D01287g Chr4 (112866..113903) [1038 bp, 345 aa] {ON} simila...   250   2e-81
NCAS0D02150 Chr4 (400750..401859) [1110 bp, 369 aa] {ON} Anc_6.26     238   2e-76
NDAI0C02640 Chr3 complement(611899..613182) [1284 bp, 427 aa] {O...   213   8e-66
Smik_9.140 Chr9 (233007..233864) [858 bp, 285 aa] {ON} YIL050W (...    77   1e-15
Suva_9.149 Chr9 (247583..248443) [861 bp, 286 aa] {ON} YIL050W (...    76   2e-15
Skud_9.119 Chr9 (227792..228649) [858 bp, 285 aa] {ON} YIL050W (...    75   8e-15
YIL050W Chr9 (258913..259770) [858 bp, 285 aa] {ON}  PCL7Pho85p ...    74   1e-14
KAFR0I01840 Chr9 (376802..377779) [978 bp, 325 aa] {ON} Anc_7.24...    68   3e-12
Ecym_4336 Chr4 complement(720123..721280) [1158 bp, 385 aa] {ON}...    67   8e-12
Kwal_23.5807 s23 (1326104..1327501) [1398 bp, 465 aa] {ON} YIL05...    64   6e-11
KNAG0D01630 Chr4 (274260..275576) [1317 bp, 438 aa] {ON} Anc_7.2...    64   6e-11
SAKL0F08602g Chr6 (657898..659322) [1425 bp, 474 aa] {ON} simila...    64   7e-11
KLTH0A04268g Chr1 (358035..359777) [1743 bp, 580 aa] {ON} simila...    64   8e-11
ADL075W Chr4 (550941..551564) [624 bp, 207 aa] {ON} Syntenic hom...    62   1e-10
NCAS0A13480 Chr1 complement(2653843..2655189) [1347 bp, 448 aa] ...    62   4e-10
KAFR0L00880 Chr12 (163476..164417) [942 bp, 313 aa] {ON} Anc_7.2...    61   5e-10
CAGL0M12342g Chr13 complement(1234192..1235565) [1374 bp, 457 aa...    60   1e-09
KLLA0C08305g Chr3 complement(728996..730225) [1230 bp, 409 aa] {...    60   2e-09
NCAS0E03220 Chr5 complement(639650..640675) [1026 bp, 341 aa] {O...    59   3e-09
KNAG0L01470 Chr12 (259883..260947) [1065 bp, 354 aa] {ON} Anc_7....    59   5e-09
TPHA0C01090 Chr3 complement(247987..249144) [1158 bp, 385 aa] {O...    58   8e-09
NDAI0A02560 Chr1 (571529..573040) [1512 bp, 503 aa] {ON} Anc_7.2...    57   1e-08
TDEL0H02020 Chr8 complement(346307..347398) [1092 bp, 363 aa] {O...    56   3e-08
TBLA0D04070 Chr4 complement(1012284..1014269) [1986 bp, 661 aa] ...    55   8e-08
Kpol_1033.13 s1033 (30454..31206) [753 bp, 250 aa] {ON} (30454.....    53   2e-07
ZYRO0C08118g Chr3 (621320..622537) [1218 bp, 405 aa] {ON} simila...    53   3e-07
YER059W Chr5 (272624..273886) [1263 bp, 420 aa] {ON}  PCL6Pho85p...    51   1e-06
Smik_5.189 Chr5 (276775..278022) [1248 bp, 415 aa] {ON} YER059W ...    51   1e-06
Suva_5.167 Chr5 (248778..250052) [1275 bp, 424 aa] {ON} YER059W ...    51   1e-06
NDAI0E04770 Chr5 (1073112..1074023) [912 bp, 303 aa] {ON} Anc_7....    50   2e-06
Skud_5.173 Chr5 (268792..270054) [1263 bp, 420 aa] {ON} YER059W ...    50   2e-06
YDL179W Chr4 (138291..139205) [915 bp, 304 aa] {ON}  PCL9Cyclin,...    49   4e-06
Kpol_2000.14 s2000 (24019..24951) [933 bp, 310 aa] {ON} (24019.....    49   7e-06
TBLA0C04850 Chr3 complement(1175677..1176783) [1107 bp, 368 aa] ...    48   1e-05
Suva_4.68 Chr4 (125518..126435) [918 bp, 305 aa] {ON} YDL179W (R...    46   6e-05
NCAS0A13770 Chr1 complement(2704299..2705237) [939 bp, 312 aa] {...    45   1e-04
TDEL0H01550 Chr8 (266510..267439) [930 bp, 309 aa] {ON} Anc_7.28...    44   2e-04
TPHA0P00810 Chr16 complement(165632..166375) [744 bp, 247 aa] {O...    43   4e-04
Smik_4.60 Chr4 (115068..115985) [918 bp, 305 aa] {ON} YDL179W (R...    43   5e-04
SAKL0C12100g Chr3 complement(1083684..1084628) [945 bp, 314 aa] ...    43   5e-04
Suva_14.50 Chr14 (84601..85440) [840 bp, 279 aa] {ON} YNL289W (R...    42   6e-04
Kwal_23.6006 s23 complement(1411337..1412251) [915 bp, 304 aa] {...    42   7e-04
TBLA0J00650 Chr10 complement(152884..153975) [1092 bp, 363 aa] {...    42   7e-04
ZYRO0C09284g Chr3 complement(706160..707095) [936 bp, 311 aa] {O...    42   8e-04
Smik_4.110 Chr4 (211556..212482) [927 bp, 308 aa] {ON} YDL127W (...    42   0.001
NDAI0A02270 Chr1 (511135..512127) [993 bp, 330 aa] {ON} Anc_7.289      42   0.001
SAKL0F09856g Chr6 complement(756909..757916) [1008 bp, 335 aa] {...    42   0.001
CAGL0E02233g Chr5 (215934..216734) [801 bp, 266 aa] {ON} similar...    41   0.001
YDL127W Chr4 (234927..235853) [927 bp, 308 aa] {ON}  PCL2Cyclin,...    42   0.001
Kpol_1020.16 s1020 complement(33477..34325) [849 bp, 282 aa] {ON...    41   0.001
Smik_14.42 Chr14 (72224..73063) [840 bp, 279 aa] {ON} YNL289W (R...    41   0.002
Kpol_1020.8 s1020 (18215..19105) [891 bp, 296 aa] {ON} (18215..1...    41   0.002
AFR159C Chr6 complement(723082..724008) [927 bp, 308 aa] {ON} Sy...    40   0.003
TBLA0A07890 Chr1 (1943543..1944628) [1086 bp, 361 aa] {ON} Anc_3...    40   0.003
Skud_14.48 Chr14 (81435..82274) [840 bp, 279 aa] {ON} YNL289W (R...    40   0.003
Suva_4.118 Chr4 (223497..224426) [930 bp, 309 aa] {ON} YDL127W (...    40   0.003
YNL289W Chr14 (87897..88736) [840 bp, 279 aa] {ON}  PCL1Cyclin, ...    40   0.003
Ecym_8038 Chr8 complement(87401..88345) [945 bp, 314 aa] {ON} si...    40   0.003
KLTH0A05346g Chr1 complement(445174..446079) [906 bp, 301 aa] {O...    40   0.004
KNAG0A01490 Chr1 (62182..62970) [789 bp, 262 aa] {ON} Anc_3.70 Y...    40   0.005
KNAG0B02930 Chr2 (563319..564257) [939 bp, 312 aa] {ON} Anc_7.28...    39   0.007
Ecym_3535 Chr3 (1015509..1016621) [1113 bp, 370 aa] {ON} similar...    39   0.007
Skud_4.79 Chr4 (134241..135170) [930 bp, 309 aa] {ON} YDL179W (R...    39   0.008
CAGL0J09328g Chr10 (920703..921596) [894 bp, 297 aa] {ON} simila...    39   0.009
Skud_4.128 Chr4 (230632..231558) [927 bp, 308 aa] {ON} YDL127W (...    38   0.017
KLLA0E13223g Chr5 (1170139..1170987) [849 bp, 282 aa] {ON} simil...    38   0.023
TPHA0A00580 Chr1 (101866..102735) [870 bp, 289 aa] {ON} Anc_3.70...    37   0.025
Suva_16.87 Chr16 (146154..147659) [1506 bp, 501 aa] {ON} YPL219W...    38   0.029
ZYRO0C02068g Chr3 complement(163475..164467) [993 bp, 330 aa] {O...    37   0.030
YPL219W Chr16 (136750..138228) [1479 bp, 492 aa] {ON}  PCL8Cycli...    36   0.084
TDEL0E00790 Chr5 (163333..164097) [765 bp, 254 aa] {ON} Anc_3.70...    35   0.14 
ZYRO0B14410g Chr2 complement(1170689..1172413) [1725 bp, 574 aa]...    35   0.16 
NDAI0A06050 Chr1 complement(1372672..1373532) [861 bp, 286 aa] {...    35   0.18 
NCAS0A09870 Chr1 complement(1974028..1974912) [885 bp, 294 aa] {...    35   0.19 
AEL195W Chr5 (266347..267060) [714 bp, 237 aa] {ON} Syntenic hom...    34   0.23 
NCAS0D04070 Chr4 (764711..766132) [1422 bp, 473 aa] {ON} Anc_6.236     35   0.29 
TBLA0B08440 Chr2 complement(2023101..2023907) [807 bp, 268 aa] {...    34   0.32 
Smik_6.424 Chr6 complement(686097..687575) [1479 bp, 492 aa] {ON...    34   0.47 
KLTH0H03674g Chr8 (333755..335209) [1455 bp, 484 aa] {ON} weakly...    33   0.58 
KLLA0F05654g Chr6 (552056..552991) [936 bp, 311 aa] {ON} weakly ...    33   0.63 
Kwal_56.24151 s56 complement(874353..875795) [1443 bp, 480 aa] {...    33   0.65 
Kwal_23.5231 s23 complement(1069167..1069937) [771 bp, 256 aa] {...    33   0.78 
TPHA0A03250 Chr1 (717085..717954) [870 bp, 289 aa] {ON} Anc_7.28...    33   0.92 
KAFR0A08280 Chr1 complement(1661106..1661831) [726 bp, 241 aa] {...    32   1.3  
KAFR0C01560 Chr3 complement(320148..320951) [804 bp, 267 aa] {ON...    32   1.9  
NDAI0C01980 Chr3 complement(445212..445892) [681 bp, 226 aa] {ON...    32   1.9  
NCAS0B03700 Chr2 complement(661199..663811) [2613 bp, 870 aa] {O...    32   2.1  
KLTH0A01584g Chr1 (141289..142134) [846 bp, 281 aa] {ON} similar...    31   2.8  
Skud_7.139 Chr7 (260060..261364) [1305 bp, 434 aa] {ON} YGL134W ...    31   3.6  
Suva_7.130 Chr7 (251870..253198) [1329 bp, 442 aa] {ON} YGL134W ...    30   5.1  
NDAI0C04300 Chr3 (981107..981829) [723 bp, 240 aa] {ON}                30   5.6  
YDR515W Chr4 (1473429..1474772) [1344 bp, 447 aa] {ON}  SLF1RNA ...    30   5.8  
KNAG0F01870 Chr6 (356849..358300) [1452 bp, 483 aa] {ON} Anc_6.2...    30   6.1  
ZYRO0C10054g Chr3 complement(760918..764043) [3126 bp, 1041 aa] ...    30   7.1  
NCAS0D01640 Chr4 (309081..311141) [2061 bp, 686 aa] {ON} Anc_5.1...    30   7.7  
CAGL0J10846g Chr10 complement(1058824..1059513) [690 bp, 229 aa]...    30   8.2  
Smik_7.138 Chr7 (249640..250953) [1314 bp, 437 aa] {ON} YGL134W ...    30   9.5  

>Smik_15.169 Chr15 (292553..293428) [876 bp, 291 aa] {ON} YOL001W
           (REAL)
          Length = 291

 Score =  600 bits (1548), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/291 (100%), Positives = 291/291 (100%)

Query: 1   MESTVGDLSENMHEDQGIQKVILPTDFNKCSRTDLVVLISRMLVSLIAINENSVSKIPEN 60
           MESTVGDLSENMHEDQGIQKVILPTDFNKCSRTDLVVLISRMLVSLIAINENSVSKIPEN
Sbjct: 1   MESTVGDLSENMHEDQGIQKVILPTDFNKCSRTDLVVLISRMLVSLIAINENSVSKIPEN 60

Query: 61  QITLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTAH 120
           QITLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTAH
Sbjct: 61  QITLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTAH 120

Query: 121 RFLLTATTIATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNIMLC 180
           RFLLTATTIATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNIMLC
Sbjct: 121 RFLLTATTIATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNIMLC 180

Query: 181 SIEQKQKKFVIDKNALGSFDLDSYSYTDRPKSGYNVLDKYYRRIVQLVGSFNASPDKSKK 240
           SIEQKQKKFVIDKNALGSFDLDSYSYTDRPKSGYNVLDKYYRRIVQLVGSFNASPDKSKK
Sbjct: 181 SIEQKQKKFVIDKNALGSFDLDSYSYTDRPKSGYNVLDKYYRRIVQLVGSFNASPDKSKK 240

Query: 241 IDYVLPSNIDKDNESGPQINEQRGSLPNHYSQKRNSEAKDANTYHKRSKPD 291
           IDYVLPSNIDKDNESGPQINEQRGSLPNHYSQKRNSEAKDANTYHKRSKPD
Sbjct: 241 IDYVLPSNIDKDNESGPQINEQRGSLPNHYSQKRNSEAKDANTYHKRSKPD 291

>Skud_15.161 Chr15 (284851..285732) [882 bp, 293 aa] {ON} YOL001W
           (REAL)
          Length = 293

 Score =  528 bits (1359), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 257/293 (87%), Positives = 271/293 (92%), Gaps = 2/293 (0%)

Query: 1   MESTVGDLSENMHEDQGIQKVILPTDFNKCSRTDLVVLISRMLVSLIAINENSVSKIPEN 60
           ME++V + SE +HE QGI KVILP +F KCSRTDLVVLISRMLVSLIAINENS +K P++
Sbjct: 1   METSVREHSEGIHEHQGIPKVILPAEFYKCSRTDLVVLISRMLVSLIAINENSTTKKPDD 60

Query: 61  QITLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTAH 120
           QITLTRYHSK+PPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTAH
Sbjct: 61  QITLTRYHSKVPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTAH 120

Query: 121 RFLLTATTIATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNIMLC 180
           RFLLTATT+A KGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNI LC
Sbjct: 121 RFLLTATTVAAKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLC 180

Query: 181 SIEQKQKKFVIDKNALGSFDLDSYSYTDRPKSGYNVLDKYYRRIVQLVGSFNASPDKSKK 240
           SIEQKQKKFV DKNA GSFDLDSYSY  RPKSGYNVLDKYYRRIVQLVGSFNASPDKSKK
Sbjct: 181 SIEQKQKKFVADKNAPGSFDLDSYSYVSRPKSGYNVLDKYYRRIVQLVGSFNASPDKSKK 240

Query: 241 IDYVLPSNIDKDNESGPQINEQRGSL-PN-HYSQKRNSEAKDANTYHKRSKPD 291
           +DYVLPSNIDKD ESGPQI +Q+G+L PN HYSQKRNSEAKD N Y KRSKPD
Sbjct: 241 VDYVLPSNIDKDTESGPQIQQQKGTLSPNSHYSQKRNSEAKDTNIYRKRSKPD 293

>YOL001W Chr15 (325249..326130) [882 bp, 293 aa] {ON}  PHO80Cyclin,
           interacts with cyclin-dependent kinase Pho85p; regulates
           the response to nutrient levels and environmental
           conditions, including the response to phosphate
           limitation and stress-dependent calcium signaling
          Length = 293

 Score =  508 bits (1307), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/293 (86%), Positives = 268/293 (91%), Gaps = 2/293 (0%)

Query: 1   MESTVGDLSENMHEDQGIQKVILPTDFNKCSRTDLVVLISRMLVSLIAINENSVSKIPEN 60
           MEST G+ SEN+HEDQGI KVILP DFNKCSRTDLVVLISRMLVSLIAINENS +K  ++
Sbjct: 1   MESTSGERSENIHEDQGIPKVILPADFNKCSRTDLVVLISRMLVSLIAINENSATKKSDD 60

Query: 61  QITLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTAH 120
           QITLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQT YPDFTLNSLTAH
Sbjct: 61  QITLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYPDFTLNSLTAH 120

Query: 121 RFLLTATTIATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNIMLC 180
           RFLLTATT+ATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNI LC
Sbjct: 121 RFLLTATTVATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLC 180

Query: 181 SIEQKQKKFVIDKNALGSFDLDSYSYTDRPKSGYNVLDKYYRRIVQLVGSFNASPDKSKK 240
           SIEQKQKKFVIDKNALGS DLDSYSY +RPKSGYNVLDKYYRRIVQLVGSFNASPDKS+K
Sbjct: 181 SIEQKQKKFVIDKNALGSLDLDSYSYVNRPKSGYNVLDKYYRRIVQLVGSFNASPDKSRK 240

Query: 241 IDYVLPSNIDKDNESGPQINEQRG--SLPNHYSQKRNSEAKDANTYHKRSKPD 291
           +DYVLP NID  +ESG Q  + +G  S  +H SQKR SEAKDA+ Y+KRSKPD
Sbjct: 241 VDYVLPPNIDIVSESGSQTTQLKGSSSPNSHSSQKRYSEAKDAHIYNKRSKPD 293

>Suva_15.174 Chr15 (299761..300648) [888 bp, 295 aa] {ON} YOL001W
           (REAL)
          Length = 295

 Score =  486 bits (1251), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 235/295 (79%), Positives = 260/295 (88%), Gaps = 4/295 (1%)

Query: 1   MESTVGDLSENMHEDQGIQKVILPTDFNKCSRTDLVVLISRMLVSLIAINENSVSKIPEN 60
           MES   + SE+  EDQ I K+ILP++F KCSRTDLVVLISRMLVSLIAINENS +K P++
Sbjct: 1   MESPAREHSEDTQEDQSIPKIILPSEFKKCSRTDLVVLISRMLVSLIAINENSSTKRPDD 60

Query: 61  QITLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTAH 120
           QITLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVL+TSLYYIDLLQTAYPDFTLNSLTAH
Sbjct: 61  QITLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLITSLYYIDLLQTAYPDFTLNSLTAH 120

Query: 121 RFLLTATTIATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNIMLC 180
           RFLLTATT+A KGLCDSFSTNAHY+KVGGVRCHELNILENDFLKRVNYRI+PRDHNI LC
Sbjct: 121 RFLLTATTVAAKGLCDSFSTNAHYSKVGGVRCHELNILENDFLKRVNYRILPRDHNITLC 180

Query: 181 SIEQKQKKFVIDKNALGSFDLDSYSYTDRPKSGYNVLDKYYRRIVQLVGSFNASPDKSKK 240
           SIEQKQK FVIDKNALGS DL SYSY +R KSGYNVLDKYY+RIVQLVGSF+ASPDKS++
Sbjct: 181 SIEQKQKTFVIDKNALGSVDLGSYSYANRSKSGYNVLDKYYQRIVQLVGSFDASPDKSRR 240

Query: 241 IDYVLPSNIDKDNESGPQINEQRG----SLPNHYSQKRNSEAKDANTYHKRSKPD 291
           ++Y LPSN D+DNE   ++ + +     S  +HYSQKR SEAKD N YHKRSKPD
Sbjct: 241 VNYALPSNFDEDNEGSARLQQPKAATEVSPKSHYSQKRISEAKDTNKYHKRSKPD 295

>Kpol_1037.30 s1037 complement(72024..73127) [1104 bp, 367 aa] {ON}
           complement(72024..73127) [1104 nt, 368 aa]
          Length = 367

 Score =  296 bits (757), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 155/291 (53%), Positives = 202/291 (69%), Gaps = 24/291 (8%)

Query: 10  ENMHEDQGIQKVILPTDFNKCSRTDLVVLISRMLVSLIAINENS------VSKIPENQ-- 61
           EN  E + I+ + LP  F  CSR+DLV LI+RML  LI +N+N       +++ P N+  
Sbjct: 35  ENKIEIENIETITLPPKFIDCSRSDLVALIARMLSFLIEMNDNDPANTNYLNEEPNNRSV 94

Query: 62  ITLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTAHR 121
           + LTR+HS++PPNIS++NY IRLTK+SSLEHCVL++++YYIDLL + YP+F +NSLT HR
Sbjct: 95  MNLTRFHSRVPPNISVYNYLIRLTKYSSLEHCVLLSTVYYIDLLSSVYPEFKINSLTVHR 154

Query: 122 FLLTATTIATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNIMLCS 181
           FLLTATTIA+KGLCDSF TN+HY+KVGGV C ELNILE +FL+RVNYRIIPRD NI LC 
Sbjct: 155 FLLTATTIASKGLCDSFCTNSHYSKVGGVHCSELNILETEFLRRVNYRIIPRDDNIKLCK 214

Query: 182 IEQKQKKFVIDKNALGSFDLDSYSYTDRPKSGYNVLDKYYRRIVQLVGSFNASPDKSKKI 241
           IE +Q KF +D + L    +   S  +   SG+N+LD YY +IVQLVGSF+AS DKS+K 
Sbjct: 215 IEHQQNKFTMDFSDLSMVGMTVQS--NHQNSGFNILDIYYHKIVQLVGSFSASSDKSRKA 272

Query: 242 DYVL----------PSNIDKDNESGPQINEQRGSLPNHYSQ----KRNSEA 278
           +Y L           SN  K+N +G  I E   ++ +  S+    KRN E 
Sbjct: 273 NYTLLLSGNNMEKEVSNNIKENSNGQNIGESEQAISSKLSRDPPPKRNFET 323

>TDEL0G04430 Chr7 (804428..805471) [1044 bp, 347 aa] {ON} Anc_6.26
           YOL001W
          Length = 347

 Score =  294 bits (752), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 147/242 (60%), Positives = 179/242 (73%), Gaps = 13/242 (5%)

Query: 18  IQKVILPTDFNKCSRTDLVVLISRMLVSLIAINENSVSKIPENQITLTRYHSKIPPNISI 77
           I  + LP  F+KCSRTDL VLISRML  LI IN++     PEN   LTR+HS++PP IS+
Sbjct: 30  ISTIYLPRKFSKCSRTDLAVLISRMLTFLIQINDSLALSKPENARGLTRFHSRVPPGISV 89

Query: 78  FNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTAHRFLLTATTIATKGLCDS 137
           +NY IRLTK+SSLEHCVL+T++YYIDLL + YP FTL+SLT HRFLLTATT+A+KGLCDS
Sbjct: 90  YNYLIRLTKYSSLEHCVLLTAVYYIDLLSSVYPVFTLSSLTVHRFLLTATTVASKGLCDS 149

Query: 138 FSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNIMLCSIEQKQKKFVIDKNALG 197
           F TN HYAKVGGV   ELNILE +FLKRVNYRI+PRD NI  C +E K +KF +      
Sbjct: 150 FCTNTHYAKVGGVHSSELNILECEFLKRVNYRILPRDDNIDWCKLETKLQKFTL------ 203

Query: 198 SFDLDSYSYTDRPK-----SGYNVLDKYYRRIVQLVGSFNASPDKSKKIDYVL-PSNIDK 251
            ++        RP+     SGYNVLD Y+R+IVQLVGS+ +SPDKSK ++YVL PS+  K
Sbjct: 204 -YEEPEMGQNSRPQNSLKNSGYNVLDAYFRKIVQLVGSYASSPDKSKVVNYVLRPSSPIK 262

Query: 252 DN 253
           D 
Sbjct: 263 DG 264

>TPHA0J00380 Chr10 complement(84485..85555) [1071 bp, 356 aa] {ON}
           Anc_6.26 YOL001W
          Length = 356

 Score =  281 bits (719), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 144/255 (56%), Positives = 183/255 (71%), Gaps = 19/255 (7%)

Query: 18  IQKVILPTDFNKCSRTDLVVLISRMLVSLIAIN-------ENSVSKIPEN---------- 60
           I+ ++LPT F KCSR+DLVVLISRML  LI IN       EN+ + IP            
Sbjct: 32  IETIMLPTSFLKCSRSDLVVLISRMLTFLIQINDRNEILTENNSAMIPTQTDVNNKNNNN 91

Query: 61  QITLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTAH 120
            I LTR+HS++PPNIS+ NY IRLTK++SLEH VL++SLYYIDLL + YP+F +NSLT H
Sbjct: 92  MINLTRFHSRVPPNISVNNYLIRLTKYASLEHSVLLSSLYYIDLLSSVYPEFKINSLTVH 151

Query: 121 RFLLTATTIATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNIMLC 180
           RFLL ATT+A+KGL DSF TN+HYAKVGGVRC ELNILE DFL+R+NYRIIPRD NI LC
Sbjct: 152 RFLLAATTVASKGLSDSFCTNSHYAKVGGVRCSELNILETDFLRRINYRIIPRDDNIKLC 211

Query: 181 SIEQKQKKFVIDKNALGSFDLDSYSYTDRPKSGYNVLDKYYRRIVQLVGSFNASPDKSKK 240
            +E+K  +F +D   L + ++        P SGYNVL+ YYR++VQ+VG    S DKSKK
Sbjct: 212 KLEKKSSQFTLDLGDLLAANIQ--PELTHPNSGYNVLNIYYRKMVQIVGLLKNSTDKSKK 269

Query: 241 IDYVLPSNIDKDNES 255
           ++Y++ +N +  N S
Sbjct: 270 VNYIIQTNYNDTNIS 284

>ZYRO0C07634g Chr3 (580486..581634) [1149 bp, 382 aa] {ON} similar
           to uniprot|P20052 Saccharomyces cerevisiae YOL001W PHO80
           Cyclin negatively regulates phosphate metabolism
           Pho80p-Pho85p (cyclin-CDK complex) phosphorylates Pho4p
           and Swi5p deletion of PHO80 leads to aminoglycoside
           supersensitivity truncated form of PHO80 affects vacuole
           inheritance
          Length = 382

 Score =  282 bits (721), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 139/254 (54%), Positives = 182/254 (71%), Gaps = 18/254 (7%)

Query: 18  IQKVILPTDFNKCSRTDLVVLISRMLVSLIAINENSVSKIPENQITLTRYHSKIPPNISI 77
           +  VILP  F++CSRTDLV+LISRML  LI +N++S +   ++   LT++HSK+PP IS+
Sbjct: 42  VPTVILPKRFSECSRTDLVILISRMLTFLIQMNDSSSTSALDSVTNLTKFHSKVPPGISV 101

Query: 78  FNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTAHRFLLTATTIATKGLCDS 137
           +NY +RLTK+SSL+HCVLM ++YYIDL+ + YP FTLNSLT HRFLLTATT+A+KGLCDS
Sbjct: 102 YNYLMRLTKYSSLDHCVLMAAVYYIDLVSSVYPTFTLNSLTVHRFLLTATTVASKGLCDS 161

Query: 138 FSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNIMLCSIEQKQKKFVIDKNALG 197
           F TN HYAKVGGV C ELN+LE + L+R+NYRIIPRD NI  C++E + + FV+D     
Sbjct: 162 FCTNTHYAKVGGVHCSELNVLECELLRRINYRIIPRDDNIAWCNLESQHRHFVLDTQ--- 218

Query: 198 SFDLDSYS------YTDRPKSGYNVLDKYYRRIVQLVGSFNASPDKSKKIDYVL-----P 246
             D D ++        +R  SGYNVLD YY +IVQLVGS  ++ DKSK ++Y       P
Sbjct: 219 --DGDDWTPILSNLSGNRNNSGYNVLDTYYNKIVQLVGSLKSTQDKSKLVNYTFANTLKP 276

Query: 247 SNIDKDNESGPQIN 260
           +NI   N  G  +N
Sbjct: 277 TNI--HNNEGLNLN 288

>Kwal_56.22443 s56 (131419..132261) [843 bp, 280 aa] {ON} YOL001W
           (PHO80) - The Pho80p Cyclin [contig 185] FULL
          Length = 280

 Score =  273 bits (697), Expect = 6e-91,   Method: Compositional matrix adjust.
 Identities = 138/243 (56%), Positives = 183/243 (75%), Gaps = 15/243 (6%)

Query: 14  EDQGIQKVILPTDFNKCSRTDLVVLISRMLVSLIAINENSVSKIPENQITLTRYHSKIPP 73
           E+  + +V LP DF++CSRTDLV+LISRML  L  IN+ SV K  ++   LTR+HS++PP
Sbjct: 25  EEAPVPEVALPEDFSQCSRTDLVILISRMLSFLTRIND-SVPK--DDAKELTRFHSRVPP 81

Query: 74  NISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTAHRFLLTATTIATKG 133
            IS+++Y +RLT++SSLE  VL+ S+YYIDLL   YP F+LNSLT HRFLLTATT+A+KG
Sbjct: 82  QISVYDYMMRLTRYSSLEPAVLVASVYYIDLLSAMYPSFSLNSLTVHRFLLTATTVASKG 141

Query: 134 LCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNIMLCSIEQKQKKFVIDK 193
           LCDSF TN+HYAKVGGV+C EL++LE++FLK+VNYRI+PRD NI  C  E+K   FV   
Sbjct: 142 LCDSFCTNSHYAKVGGVQCSELHVLESEFLKKVNYRILPRDDNISNCKAEKKAGLFVT-- 199

Query: 194 NALGSFDLDSYSYTDR-PKSGYNVLDKYYRRIVQLVGSFNASPDKSKKIDYVL-PSNIDK 251
                    +YS + R P +G+NVLD YYR+I+++VGSF++SPDK+K+  YV+  SN  K
Sbjct: 200 --------PTYSKSCRGPNNGFNVLDTYYRKIIEIVGSFDSSPDKTKRAHYVMINSNTRK 251

Query: 252 DNE 254
           D E
Sbjct: 252 DVE 254

>ACR001C Chr3 complement(357962..359002) [1041 bp, 346 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL001W
           (PHO80)
          Length = 346

 Score =  274 bits (701), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 140/276 (50%), Positives = 181/276 (65%), Gaps = 30/276 (10%)

Query: 13  HE-DQGIQKVILPTDFNKCSRTDLVVLISRMLVSLIAINENSVSKIPENQITLTRYHSKI 71
           HE  + + ++ LP  F  CSRT LVVLISRML SLI +N+    K     I LTR+HS++
Sbjct: 7   HETSESVTEMELPRQFLSCSRTYLVVLISRMLTSLIGMNDAQGDK--SKPIKLTRFHSRV 64

Query: 72  PPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTAHRFLLTATTIAT 131
           PP IS++NY IRLTK+SSLEHCVL+ S+YYIDLL   YP+F L+SLT HRFLLTATT+A+
Sbjct: 65  PPAISVYNYLIRLTKYSSLEHCVLLASVYYIDLLTNVYPEFRLDSLTVHRFLLTATTVAS 124

Query: 132 KGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNIMLCSIEQKQKKFVI 191
           KGLCDSF TN HYAKVGGV+C ELN+LEN+FL+RVNYRI+PRD NI  CS+E++++ F  
Sbjct: 125 KGLCDSFCTNTHYAKVGGVQCSELNVLENEFLERVNYRILPRDDNIRRCSLERQERIF-- 182

Query: 192 DKNALGSFDLDSYSYTDRPKSGYNVLDKYYRRIVQLVGSFNASPDKSKKIDYVL------ 245
              +  +  +D         +G+ VL+KYY R++ L+G FN SPDKS  + + L      
Sbjct: 183 ---SYSNIPMDKDCALQDRNNGFGVLEKYYHRMIHLIGDFNMSPDKSCNLSFTLAESPTN 239

Query: 246 ----------------PSNIDKDNESGPQINEQRGS 265
                           P NID  ++S P I    GS
Sbjct: 240 SIQKTLPGGNDFQTAYPGNIDDGSKSCPNITSNNGS 275

>KLTH0C11110g Chr3 complement(914257..915099) [843 bp, 280 aa] {ON}
           similar to uniprot|P20052 Saccharomyces cerevisiae
           YOL001W PHO80 Cyclin negatively regulates phosphate
           metabolism Pho80p-Pho85p (cyclin-CDK complex)
           phosphorylates Pho4p and Swi5p deletion of PHO80 leads
           to aminoglycoside supersensitivity truncated form of
           PHO80 affects vacuole inheritance
          Length = 280

 Score =  271 bits (693), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 132/244 (54%), Positives = 183/244 (75%), Gaps = 19/244 (7%)

Query: 7   DLSENMHEDQG---IQKVILPTDFNKCSRTDLVVLISRMLVSLIAINENSVSKIP-ENQI 62
           DL+E+   D G   + +V LP DF++C RTDLV+LISRML  LI IN++    IP +N  
Sbjct: 15  DLTEDTKPDTGEDPVPEVALPNDFSQCPRTDLVILISRMLSFLIRINDS----IPKDNSS 70

Query: 63  TLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTAHRF 122
            LTR+HS++PP IS+++Y +RLT++SSLE  VL+ S+YYIDLL   Y  F+LNSLT HRF
Sbjct: 71  ELTRFHSRVPPQISVYDYLMRLTRYSSLEPAVLIASVYYIDLLSAMYTAFSLNSLTVHRF 130

Query: 123 LLTATTIATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNIMLCSI 182
           LLTATT+ +KGLCDSF TN+HYAKVGGV+C EL++LE++FLKRVNYRI+PRD NI+ C  
Sbjct: 131 LLTATTVGSKGLCDSFCTNSHYAKVGGVQCSELHVLESEFLKRVNYRILPRDDNILNCKA 190

Query: 183 EQKQKKFVIDKNALGSFDLDSYSYTDR-PKSGYNVLDKYYRRIVQLVGSFNASPDKSKKI 241
           E+++  FV            +Y+  +R P +G+NVLD YY++I+++VGS+++SPDK+K+ 
Sbjct: 191 ERREGLFVT----------ATYAKENRGPNNGFNVLDTYYQKIIEIVGSYDSSPDKTKRA 240

Query: 242 DYVL 245
            YV+
Sbjct: 241 HYVM 244

>CAGL0E02541g Chr5 (244814..245842) [1029 bp, 342 aa] {ON} similar
           to uniprot|P20052 Saccharomyces cerevisiae YOL001w PHO80
           cyclin
          Length = 342

 Score =  272 bits (696), Expect = 6e-90,   Method: Compositional matrix adjust.
 Identities = 135/235 (57%), Positives = 180/235 (76%), Gaps = 6/235 (2%)

Query: 12  MHEDQGIQKVILPTDFNKCSRTDLVVLISRMLVSLIAINENSVSKIPENQITLTRYHSKI 71
           ++ D+ I  + LP DF KC + DLV+LI+RML  +I IN++++ K  E +  LTR+HSKI
Sbjct: 8   INTDEEIPTIKLPRDFLKCPKGDLVILIARMLQFIIQINDSNI-KENERKYGLTRFHSKI 66

Query: 72  PPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTAHRFLLTATTIAT 131
            PNIS+FNYF RLTK+S LEH VL++++YYIDLL   YP F LNSLTAHRFLLTATTIA+
Sbjct: 67  APNISVFNYFTRLTKYSLLEHSVLLSAVYYIDLLSNVYPAFNLNSLTAHRFLLTATTIAS 126

Query: 132 KGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNIMLCSIEQKQKKFVI 191
           KGLCDSF TN HY+KVGGV+C+ELN+LEN+FL++VNYRIIPRD+NI  C +E  QK F I
Sbjct: 127 KGLCDSFCTNTHYSKVGGVQCNELNVLENEFLRKVNYRIIPRDNNITFCKMEV-QKNFFI 185

Query: 192 DKNALGSFDLDS---YSYTDRPKSGYNVLDKYYRRIVQLVGSFNASPDKSKKIDY 243
              ++ S DL       Y+    +GYNVL +YY +I+++VG +++SPDK+KK++Y
Sbjct: 186 LPESIES-DLAPSLRQGYSSISNAGYNVLTRYYYKIIEVVGKYSSSPDKTKKVNY 239

>SAKL0E01408g Chr5 (106229..107152) [924 bp, 307 aa] {ON} similar to
           uniprot|P20052 Saccharomyces cerevisiae YOL001W PHO80
           Cyclin negatively regulates phosphate metabolism
           Pho80p-Pho85p (cyclin-CDK complex) phosphorylates Pho4p
           and Swi5p deletion of PHO80 leads to aminoglycoside
           supersensitivity truncated form of PHO80 affects vacuole
           inheritance
          Length = 307

 Score =  270 bits (690), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 132/244 (54%), Positives = 176/244 (72%), Gaps = 18/244 (7%)

Query: 15  DQGIQKVILPTDFNKCSRTDLVVLISRMLVSLIAINENSVSKIPENQITLTRYHSKIPPN 74
           +Q   +++LP +F KCSRT LVVLISRML SLI +N+   S   +  + LTR+HS++PP 
Sbjct: 41  EQTSSQIMLPDEFLKCSRTALVVLISRMLSSLIQMND---SMCKDKNLKLTRFHSRVPPG 97

Query: 75  ISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTAHRFLLTATTIATKGL 134
           IS++NY IRL K+SSLE  VL+ ++YYIDLL + YP FTLNSLT HRFLLTATT+A+KGL
Sbjct: 98  ISVYNYLIRLAKYSSLEPAVLIAAVYYIDLLSSVYPSFTLNSLTVHRFLLTATTVASKGL 157

Query: 135 CDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNIMLCSIEQKQKKFVIDKN 194
            DSF TN HYAKVGGV+C ELN+LE +FLKRVNYRIIPRD NI  C  E +Q  F+    
Sbjct: 158 SDSFCTNVHYAKVGGVQCSELNVLETEFLKRVNYRIIPRDDNIFNCKEEYQQGVFI---- 213

Query: 195 ALGSFDLDSYSYTDR---PKSGYNVLDKYYRRIVQLVGSFNASPDKSKKIDYVLPSNIDK 251
                   ++   D+   P +G+NVLD YY++++QLVG  N+SPDK+ K+ YVL  +  +
Sbjct: 214 --------TFPLADKIKGPNNGFNVLDTYYKKMIQLVGPSNSSPDKTSKVSYVLEPSEQQ 265

Query: 252 DNES 255
           ++++
Sbjct: 266 ESQT 269

>KNAG0I01750 Chr9 (344381..345355) [975 bp, 324 aa] {ON} Anc_6.26
           YOL001W
          Length = 324

 Score =  266 bits (680), Expect = 9e-88,   Method: Compositional matrix adjust.
 Identities = 140/265 (52%), Positives = 181/265 (68%), Gaps = 24/265 (9%)

Query: 2   ESTVGDLSENMHEDQG--IQKVILPTDFNKCSRTDLVVLISRMLVSLIAINENSVSKIP- 58
           E  V   +    E  G  IQ V LP++F+ CSR DL+ LISRMLV LI IN+++  K   
Sbjct: 3   EGGVAKQANRNEETTGCEIQTVSLPSNFSLCSRYDLIALISRMLVFLIQINDDAAQKKTG 62

Query: 59  -----------------ENQITLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYY 101
                             ++  LTR+HS +PP IS++NY IRLTK+S+LE  VL+TS+YY
Sbjct: 63  LADSGKGEATDAADTDGSSETKLTRFHSSVPPPISVYNYLIRLTKYSALEPSVLLTSIYY 122

Query: 102 IDLLQTAYPDFTLNSLTAHRFLLTATTIATKGLCDSFSTNAHYAKVGGVRCHELNILEND 161
           IDLL + YP FT+NSLT HRFLLTATT+A+KGLCDSF TNAHYAKVGGV+  ELNILE++
Sbjct: 123 IDLLSSVYPAFTINSLTVHRFLLTATTVASKGLCDSFCTNAHYAKVGGVQGSELNILESE 182

Query: 162 FLKRVNYRIIPRDHNIMLCSIEQKQKKFVI-DKNALGSFDLDSYSYTDRPKSGYNVLDKY 220
           FLK++NYR++PRD NI  C  E +  +F I +K AL   ++   ++T R  SGYNVL  Y
Sbjct: 183 FLKKINYRVLPRDDNITWCKYEHRAHEFTIYNKAALT--NVSKPTHTQR-NSGYNVLQMY 239

Query: 221 YRRIVQLVGSFNASPDKSKKIDYVL 245
           Y +I+QLVG F++S DKSKK +YV 
Sbjct: 240 YHKIIQLVGKFSSSLDKSKKANYVF 264

>Ecym_3029 Chr3 (56667..57722) [1056 bp, 351 aa] {ON} similar to
           Ashbya gossypii ACR001C
          Length = 351

 Score =  260 bits (664), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 127/230 (55%), Positives = 169/230 (73%), Gaps = 8/230 (3%)

Query: 16  QGIQKVILPTDFNKCSRTDLVVLISRMLVSLIAINENSVSKIPENQITLTRYHSKIPPNI 75
           Q + +  LP  F  CSRT LVVLISRML SLI +N+   +    N + LTR+HS++PP+I
Sbjct: 18  QPVPEFRLPRKFLDCSRTHLVVLISRMLSSLIRLND---AYTESNTLQLTRFHSRVPPSI 74

Query: 76  SIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTAHRFLLTATTIATKGLC 135
           S+++Y IRLTK+SSLEHCVL+ S+YYIDLL + +P+F L+SLT HRFLLTATT+A+KGLC
Sbjct: 75  SVYDYLIRLTKYSSLEHCVLLASVYYIDLLSSVFPEFRLDSLTVHRFLLTATTVASKGLC 134

Query: 136 DSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNIMLCSIEQKQKKFVIDKNA 195
           DSF TN HYAKVGGV+C+ELN+LEN+FL RVNYRI+PRD NI  CS E ++  F    N 
Sbjct: 135 DSFCTNTHYAKVGGVQCNELNVLENEFLTRVNYRILPRDENIKRCSREHQEGTFSF-ANI 193

Query: 196 LGSFDLDSYSYTDRPKSGYNVLDKYYRRIVQLVGSFNASPDKSKKIDYVL 245
               + D  S  +R    ++VL+ YY R++ L+G+ +ASPDKS  +++ L
Sbjct: 194 PADAEQDQKSEENR----FDVLENYYHRMIHLIGNLDASPDKSYDLNFTL 239

>TBLA0A07160 Chr1 (1782941..1783747) [807 bp, 268 aa] {ON} Anc_6.26
           YOL001W
          Length = 268

 Score =  252 bits (644), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 131/260 (50%), Positives = 179/260 (68%), Gaps = 12/260 (4%)

Query: 19  QKVILPTDFNKCSRTDLVVLISRMLVSLIAINE--NSVSKIPENQIT---LTRYHSKIPP 73
           Q V+L  +F KCS+ DL+ LISRML   I IN+  N    +  N+++   LTR+HSK+PP
Sbjct: 10  QLVVLDQNFMKCSKIDLITLISRMLSFFIDINDSHNIHGNVTNNRLSPLFLTRFHSKVPP 69

Query: 74  NISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTAHRFLLTATTIATKG 133
           NISIF+Y IRLTK+SSLE  VL+TS+YYIDLL   YP+F+LNSLT HR+LLTATTIA+KG
Sbjct: 70  NISIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYPEFSLNSLTVHRYLLTATTIASKG 129

Query: 134 LCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNIMLCSIEQKQKKFVIDK 193
           LCDSF TN+HYAKVGG+RC+ELN+LE +FL+RV YR+IPRD+ I LC +E K        
Sbjct: 130 LCDSFCTNSHYAKVGGIRCNELNVLETEFLERVRYRVIPRDNTIKLCKLEYKY------- 182

Query: 194 NALGSFDLDSYSYTDRPKSGYNVLDKYYRRIVQLVGSFNASPDKSKKIDYVLPSNIDKDN 253
           + +   + D +   +   SGYNVL  YY ++VQLVG+  +S +  + ++Y+   N D+  
Sbjct: 183 SPIEDINNDIHIPDELQNSGYNVLSTYYNKMVQLVGNCKSSKNSFRNVNYIFSINQDEIY 242

Query: 254 ESGPQINEQRGSLPNHYSQK 273
            S P++ +    +P   + K
Sbjct: 243 NSMPELEKPNHIIPTQQANK 262

>KLLA0D01287g Chr4 (112866..113903) [1038 bp, 345 aa] {ON} similar
           to uniprot|P20052 Saccharomyces cerevisiae YOL001W PHO80
           Cyclin negatively regulates phosphate metabolism
           Pho80p-Pho85p (cyclin-CDK complex) phosphorylates Pho4p
           and Swi5p deletion of PHO80 leads to aminoglycoside
           supersensitivity truncated form of PHO80 affects vacuole
           inheritance
          Length = 345

 Score =  250 bits (639), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 130/222 (58%), Positives = 160/222 (72%), Gaps = 14/222 (6%)

Query: 19  QKVILPTDFNKCSRTDLVVLISRMLVSLIAINENSVSKIPENQITLTRYHSKIPPNISIF 78
           Q + LP ++ +CSRT LVV+ISRML  LI IN+   +      + LTR+HSK  P+I+++
Sbjct: 17  QIIPLPEEYLRCSRTHLVVIISRMLSFLIQIND--ANNAGNQTMELTRFHSKAAPSITVY 74

Query: 79  NYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTAHRFLLTATTIATKGLCDSF 138
            Y IRLTK+SSLEH VL++++YYIDLL   YP+FTLNSLT HRFLLTATTIA+KGLCDSF
Sbjct: 75  QYLIRLTKYSSLEHSVLLSAVYYIDLLSAVYPEFTLNSLTVHRFLLTATTIASKGLCDSF 134

Query: 139 STNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNIMLCSIEQKQKKFVIDKNALGS 198
            TN HY+KVGGV+C ELNILEN+FL+RV YRIIPRD NI  C IEQK          LGS
Sbjct: 135 CTNTHYSKVGGVQCSELNILENEFLERVRYRIIPRDDNIENCKIEQK----------LGS 184

Query: 199 FDLDSYSYTDR--PKSGYNVLDKYYRRIVQLVGSFNASPDKS 238
             L       +  P +G+NVL  YYR+IVQLVG+   SPDK+
Sbjct: 185 NMLIPMKNASQRGPDNGFNVLQNYYRKIVQLVGNPLNSPDKT 226

>NCAS0D02150 Chr4 (400750..401859) [1110 bp, 369 aa] {ON} Anc_6.26
          Length = 369

 Score =  238 bits (608), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 129/251 (51%), Positives = 169/251 (67%), Gaps = 8/251 (3%)

Query: 18  IQKVILPTDFNKCSRTDLVVLISRMLVSLIAINE---NSVSKIPENQITLTRYHSKIPPN 74
           IQ + +P ++ KCSR+DLVVL+SRMLV LI  N+   N+ +   ++ + LTR+HS+IPPN
Sbjct: 26  IQVIEVPYEYIKCSRSDLVVLVSRMLVLLIQSNDMTSNTSNSSSDSNMHLTRFHSRIPPN 85

Query: 75  ISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTAHRFLLTATTIATKGL 134
           ISIFNY  RLTK+  +EHCVL++ +YYIDL   AYP FT NSLTAHRFLLTA T+A KGL
Sbjct: 86  ISIFNYLFRLTKYCYVEHCVLLSIIYYIDLFTAAYPTFTFNSLTAHRFLLTAITVAGKGL 145

Query: 135 CDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNIMLCSIEQKQKKFVIDKN 194
           CDSF T A YAK+GGV+  ELNILE  FL+ VNYRIIPR  N+ L  +E+  + F +D  
Sbjct: 146 CDSFCTTAQYAKIGGVQNEELNILETYFLRIVNYRIIPRSSNVTLIKLERGNQVFTLDHL 205

Query: 195 ALGSFDLDSYSYTDRPKSGYNVLDKYYRRIVQLVGSFNASPDKSKKIDYVLPSN---IDK 251
            +    L   SY   P +GY+VL+ YY+ IV++ G+  +S    K++ Y  P+N     K
Sbjct: 206 DMKDPKLSFLSYDYLPDNGYSVLNIYYQNIVRITGA--SSDLLFKRVIYTFPNNSALTQK 263

Query: 252 DNESGPQINEQ 262
            N   PQI  Q
Sbjct: 264 LNNLPPQIRAQ 274

>NDAI0C02640 Chr3 complement(611899..613182) [1284 bp, 427 aa] {ON}
           Anc_6.26 YOL001W
          Length = 427

 Score =  213 bits (542), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 114/231 (49%), Positives = 151/231 (65%), Gaps = 9/231 (3%)

Query: 20  KVILPTDFNKCSRTDLVVLISRMLVSLIAINENSVS--KIPENQITLTRYHSKIPPNISI 77
           K+ LP  F +C R DLVVLISRMLV+LI IN+   +   +P N  T  R+HS++ P ISI
Sbjct: 56  KITLPIKFMECPRRDLVVLISRMLVTLIKINDTKANDNNLPSNYAT--RFHSRVIPGISI 113

Query: 78  FNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTAHRFLLTATTIATKGLCDS 137
            NY +RLTKF  L+  VL+T++YYIDLL   +P F+ NSLTAHRF+LTA  +A+K LCDS
Sbjct: 114 GNYLLRLTKFCILQPSVLLTAVYYIDLLSAVFPSFSFNSLTAHRFILTAVIVASKSLCDS 173

Query: 138 FSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNIMLCSIEQKQKKFVIDKNALG 197
             +  HYAK GGV+ +EL +LE  FLK + YR++PRD N  LCS+E     F ++   + 
Sbjct: 174 CLSITHYAKYGGVQPNELLMLEAYFLKLIKYRVLPRDKNTDLCSMEYHFDTFALNDGQIK 233

Query: 198 SFDLDSYSYTDRPKSGYNVLDKYYRRIVQLVG---SFNASPDKSKKIDYVL 245
                S+SY   P SGYNVL  YYRRI+ ++G     + SPD +  +DY L
Sbjct: 234 ESG-TSFSYRQLPHSGYNVLHMYYRRIIDIIGVQRPISPSPD-AVTVDYFL 282

>Smik_9.140 Chr9 (233007..233864) [858 bp, 285 aa] {ON} YIL050W
           (REAL)
          Length = 285

 Score = 77.4 bits (189), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 60/205 (29%), Positives = 101/205 (49%), Gaps = 39/205 (19%)

Query: 2   ESTVGDLSENMHEDQGIQKVILPTDFNKCSRTDLVVLISRMLVSLIAINENSV---SKIP 58
           + T G+ SEN+     +  V  PTD       +L++++S +L  +I +N+ +     ++P
Sbjct: 89  DETNGESSENV-----LNIVDFPTD-------ELIIMVSALLNKIITVNDATTDISQQVP 136

Query: 59  ----ENQIT-LTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAY---P 110
               E  +T +  ++ K  P I +  Y  R+ K+    + + ++ L Y D +   Y   P
Sbjct: 137 GDTEEKFLTPILAFYGKNVPEIDVVQYLERIQKYCPTTNDIFLSLLVYFDRISKNYGHSP 196

Query: 111 D--------FTLNSLTAHRFLLTATTIATKGLCDSFSTNAHYAKVGGVRCHELNILENDF 162
           +        F ++S   HR L+T  TI TK L D F +N+ YAKVGG+   ELN LE  F
Sbjct: 197 EENGHSKQLFVMDSGNIHRLLITGITICTKFLSDFFYSNSRYAKVGGISLQELNHLELQF 256

Query: 163 LKRVNYRIIPRDHNIMLCSIEQKQK 187
           L   +++        +L S+E+ QK
Sbjct: 257 LVLCDFK--------LLVSVEEMQK 273

>Suva_9.149 Chr9 (247583..248443) [861 bp, 286 aa] {ON} YIL050W
           (REAL)
          Length = 286

 Score = 76.3 bits (186), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 58/210 (27%), Positives = 97/210 (46%), Gaps = 41/210 (19%)

Query: 2   ESTVGDLSENMHEDQG---IQKVILPTDFNKCSRTDLVVLISRMLVSLIAINENSVSKIP 58
           +S V D+ E    + G   +  V  PTD       +L++++S +L  ++  N+ +    P
Sbjct: 82  QSDVHDMEEETSREDGESVLNIVDFPTD-------ELILMVSALLNKIVKANDETTD--P 132

Query: 59  ENQIT----------LTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTA 108
             Q+           +  ++ K  P I++  Y  R+ K+    + + ++ L Y D +   
Sbjct: 133 SQQVVEDGEDELLAPVLAFYGKNVPEIAVVQYLERIQKYCPTTNDIFLSLLVYFDRISKN 192

Query: 109 Y---PD--------FTLNSLTAHRFLLTATTIATKGLCDSFSTNAHYAKVGGVRCHELNI 157
           Y   PD        F ++S   HR L+T  TI TK + D F +N+ YAKVGG+   ELN 
Sbjct: 193 YGSSPDRNGHVRQIFVMDSGNIHRLLITGITICTKFMSDFFYSNSRYAKVGGISLQELNH 252

Query: 158 LENDFLKRVNYRIIPRDHNIMLCSIEQKQK 187
           LE  FL   +++        +L S E+ QK
Sbjct: 253 LELQFLVLCDFK--------LLVSREEMQK 274

>Skud_9.119 Chr9 (227792..228649) [858 bp, 285 aa] {ON} YIL050W
           (REAL)
          Length = 285

 Score = 74.7 bits (182), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 52/176 (29%), Positives = 87/176 (49%), Gaps = 27/176 (15%)

Query: 31  SRTDLVVLISRMLVSLIAINE------NSVSKIPENQI--TLTRYHSKIPPNISIFNYFI 82
           S  +L+ +IS +L  ++  N+        VSK  ++++   +  ++ K  P IS+  Y  
Sbjct: 106 STDELIQMISALLNRIVTANDEYAEISQQVSKDNQDELLAPILAFYGKSVPEISVVQYLE 165

Query: 83  RLTKFSSLEHCVLMTSLYYIDLLQTAYPDFT-----------LNSLTAHRFLLTATTIAT 131
           R+ K+    + + ++ L Y D +   Y  F+           ++S   HR L+T  TI T
Sbjct: 166 RIQKYCPTTNDIFLSLLVYFDRISKKYGHFSDRNAHTKQMFGMDSGNIHRLLITGITICT 225

Query: 132 KGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNIMLCSIEQKQK 187
           K L D F +N+ YAKVGG+   ELN LE  FL   +++        +L S+E+ QK
Sbjct: 226 KFLSDFFYSNSRYAKVGGISLQELNHLELQFLVLCDFK--------LLVSVEEMQK 273

>YIL050W Chr9 (258913..259770) [858 bp, 285 aa] {ON}  PCL7Pho85p
           cyclin of the Pho80p subfamily, forms a functional
           kinase complex with Pho85p which phosphorylates Mmr1p
           and is regulated by Pho81p; involved in glycogen
           metabolism, expression is cell-cycle regulated
          Length = 285

 Score = 74.3 bits (181), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 54/184 (29%), Positives = 89/184 (48%), Gaps = 34/184 (18%)

Query: 23  LPTDFNKCSRTDLVVLISRMLVSLIAINENS------VSKIPENQIT--LTRYHSKIPPN 74
            PTD       +L+++IS +L  +I  N+ +      VS   E+++   +  ++ K  P 
Sbjct: 105 FPTD-------ELILMISALLNRIITANDETTDVSQQVSDETEDELLTPILAFYGKNVPE 157

Query: 75  ISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPD-----------FTLNSLTAHRFL 123
           I++  Y  R+ K+    + + ++ L Y D +   Y             F ++S   HR L
Sbjct: 158 IAVVQYLERIQKYCPTTNDIFLSLLVYFDRISKNYGHSSERNGCAKQLFVMDSGNIHRLL 217

Query: 124 LTATTIATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNIMLCSIE 183
           +T  TI TK L D F +N+ YAKVGG+   ELN LE  FL   +++        +L S+E
Sbjct: 218 ITGVTICTKFLSDFFYSNSRYAKVGGISLQELNHLELQFLILCDFK--------LLVSVE 269

Query: 184 QKQK 187
           + QK
Sbjct: 270 EMQK 273

>KAFR0I01840 Chr9 (376802..377779) [978 bp, 325 aa] {ON} Anc_7.240
           YIL050W
          Length = 325

 Score = 67.8 bits (164), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 39/119 (32%), Positives = 62/119 (52%), Gaps = 10/119 (8%)

Query: 63  TLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLL----------QTAYPDF 112
           +L  +H K  P+I+I  YF R+ K+    + V +  L   D +            +   F
Sbjct: 177 SLLCFHGKHVPDITIEKYFNRIQKYCPTTNDVFLLLLIAFDRIAKRCNTDSFGNKSQQLF 236

Query: 113 TLNSLTAHRFLLTATTIATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRII 171
            ++S   HRF++   T+ TK L D F +N+ YAKVGG+  HE+N LE  FL   ++++I
Sbjct: 237 VMDSYNIHRFIIAGVTVCTKFLSDFFYSNSRYAKVGGISVHEMNNLELQFLVLCDFKLI 295

>Ecym_4336 Chr4 complement(720123..721280) [1158 bp, 385 aa] {ON}
           similar to Ashbya gossypii ADL075W
          Length = 385

 Score = 66.6 bits (161), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 36/110 (32%), Positives = 60/110 (54%), Gaps = 5/110 (4%)

Query: 67  YHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQ----TAYPD-FTLNSLTAHR 121
           +  K  P I++ +YF R+ K+  + + V ++ L Y D +        P  F ++S   HR
Sbjct: 234 FRGKHIPAITLGDYFARIQKYCPITNDVFLSLLVYFDRIAKRCNAMDPQLFVMDSYNIHR 293

Query: 122 FLLTATTIATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRII 171
            ++ A T++TK   D F +N+ YA+VGG+  HELN LE  F    ++ +I
Sbjct: 294 LIIAAVTVSTKFFSDFFYSNSRYARVGGISLHELNRLELQFSILCDFELI 343

>Kwal_23.5807 s23 (1326104..1327501) [1398 bp, 465 aa] {ON} YIL050W
           (PCL7) - PHO85 cyclin [contig 11] FULL
          Length = 465

 Score = 64.3 bits (155), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 39/126 (30%), Positives = 64/126 (50%), Gaps = 13/126 (10%)

Query: 67  YHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPD-----FTLNSLTAHR 121
           +  K  P I++  YF R+ K+    + V ++ L Y D +           F ++S   HR
Sbjct: 324 FRGKHVPAITLQQYFQRIQKYCPTTNDVFLSLLVYFDRIAKTCNHGKEQLFVMDSYNIHR 383

Query: 122 FLLTATTIATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNIMLCS 181
            +++A T++TK   D F +N+ YA+VGG+   ELN LE  FL   ++ +I         S
Sbjct: 384 LIISAVTVSTKFFSDFFYSNSRYARVGGISLKELNHLELQFLVLCDFELI--------IS 435

Query: 182 IEQKQK 187
           +E+ QK
Sbjct: 436 VEELQK 441

>KNAG0D01630 Chr4 (274260..275576) [1317 bp, 438 aa] {ON} Anc_7.240
           YIL050W
          Length = 438

 Score = 64.3 bits (155), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 64/132 (48%), Gaps = 21/132 (15%)

Query: 64  LTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLL------------------ 105
           +T ++ K  P I+I  Y +R+ K+    + + ++ L + D +                  
Sbjct: 283 ITSFYGKHVPQITIEQYLLRIQKYCPTTNDIFLSLLVFFDRISKKFNIHQQKQQSNVSDS 342

Query: 106 --QTAYPDFTLNSLTAHRFLLTATTIATKGLCDSFSTNAHYAKVGGVRCHELNILENDFL 163
             Q  +  F ++S   HR L+   T++TK   D F +NA YA+VGG+   E+N LE  FL
Sbjct: 343 DEQAPHQTFVMDSYNIHRLLIAGVTVSTKFFSDFFYSNARYARVGGISLQEMNHLELQFL 402

Query: 164 KRVNYR-IIPRD 174
              +++ +IP D
Sbjct: 403 ILCDFKLLIPID 414

>SAKL0F08602g Chr6 (657898..659322) [1425 bp, 474 aa] {ON} similar
           to uniprot|P40186 Saccharomyces cerevisiae YIL050W PCL7
           Pho85p cyclin of the Pho80p subfamily forms a functional
           kinase complex with Pho85p which phosphorylates Mmr1p
           and is regulated by Pho81p involved in glycogen
           metabolism expression is cell-cycle regulated
          Length = 474

 Score = 64.3 bits (155), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 58/115 (50%), Gaps = 10/115 (8%)

Query: 67  YHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLL----------QTAYPDFTLNS 116
           +  K  P IS+  YF R+ K+    + V ++ L Y D +          +     F ++S
Sbjct: 337 FRGKHVPAISLDQYFQRIQKYCPTTNDVFLSLLVYFDRIAKRCNINEEGEDGQQLFVMDS 396

Query: 117 LTAHRFLLTATTIATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRII 171
              HR ++ A T++TK   D F +N+ YA+VGG+   ELN LE  FL   ++ +I
Sbjct: 397 YNIHRLIIAAVTVSTKFFSDFFYSNSRYARVGGISLQELNRLELQFLILCDFELI 451

>KLTH0A04268g Chr1 (358035..359777) [1743 bp, 580 aa] {ON} similar
           to uniprot|P40186 Saccharomyces cerevisiae YIL050W PCL7
           Pho85p cyclin of the Pho80p subfamily forms a functional
           kinase complex with Pho85p which phosphorylates Mmr1p
           and is regulated by Pho81p involved in glycogen
           metabolism expression is cell-cycle regulated
          Length = 580

 Score = 64.3 bits (155), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 39/126 (30%), Positives = 64/126 (50%), Gaps = 13/126 (10%)

Query: 67  YHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLL-----QTAYPDFTLNSLTAHR 121
           +  K  P I++  YF R+ K+    + V ++ L Y D +           F ++S   HR
Sbjct: 435 FRGKHVPAITLHQYFQRIQKYCPTTNDVFLSLLVYFDRIAKTCNHAKEQLFVMDSYNIHR 494

Query: 122 FLLTATTIATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNIMLCS 181
            +++A T++TK   D F +N+ YA+VGG+   ELN LE  FL   ++ +I         S
Sbjct: 495 LIISAVTVSTKFFSDFFYSNSRYARVGGISLKELNHLELQFLVLCDFELI--------IS 546

Query: 182 IEQKQK 187
           +E+ QK
Sbjct: 547 VEELQK 552

>ADL075W Chr4 (550941..551564) [624 bp, 207 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL050W (PCL7) and
           YER059W (PCL6)
          Length = 207

 Score = 61.6 bits (148), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 35/110 (31%), Positives = 59/110 (53%), Gaps = 5/110 (4%)

Query: 67  YHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAY----PD-FTLNSLTAHR 121
           +  K  P I++ +YF R+ K+  + + V ++ L Y D +        P  F ++S   HR
Sbjct: 65  FRGKHIPTITLGDYFARIQKYCPITNDVFLSLLVYFDRIAKRCNALDPQLFVMDSYNIHR 124

Query: 122 FLLTATTIATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRII 171
            ++ A T++TK   D F +N+ YA+VGG+   ELN LE  F    ++ +I
Sbjct: 125 LIIAAVTVSTKFFSDFFYSNSRYARVGGISLEELNRLELQFSILCDFELI 174

>NCAS0A13480 Chr1 complement(2653843..2655189) [1347 bp, 448 aa]
           {ON} Anc_7.240
          Length = 448

 Score = 62.0 bits (149), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 37/120 (30%), Positives = 58/120 (48%), Gaps = 15/120 (12%)

Query: 67  YHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQ-------TAYPD-------- 111
           +  K  P IS+  YF R+ K+    + V ++ L Y D +        T+  D        
Sbjct: 283 FRGKHVPQISLHQYFQRIQKYCPTTNDVFLSLLVYFDRISKRCNNSVTSQGDSPTNKSQL 342

Query: 112 FTLNSLTAHRFLLTATTIATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRII 171
           F ++S   HR ++   T+ TK   D F +N+ YA+VGGV   ELN LE  FL   ++ ++
Sbjct: 343 FVMDSYNIHRLIIAGVTVCTKFFSDFFYSNSRYARVGGVSLQELNHLELQFLVLCDFELM 402

>KAFR0L00880 Chr12 (163476..164417) [942 bp, 313 aa] {ON} Anc_7.240
           YIL050W
          Length = 313

 Score = 60.8 bits (146), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 44/153 (28%), Positives = 74/153 (48%), Gaps = 25/153 (16%)

Query: 52  NSVSKIPENQIT-----LTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLL- 105
           N + KI E+  T     +  +  K  P I++  YF R+ K+    + V ++ L Y D + 
Sbjct: 155 NEIPKILEHDSTGCLNAMLSFKGKHIPQINLEQYFKRIQKYCPTTNDVFLSLLIYFDRIF 214

Query: 106 ---QTAYPD--------FTLNSLTAHRFLLTATTIATKGLCDSFSTNAHYAKVGGVRCHE 154
               + + +        F ++S   HR ++   T++TK L D F +N+ YAKVGG+   E
Sbjct: 215 NKCNSKFDNYGHDNPQIFVMDSYNIHRLIIAGVTVSTKFLSDFFYSNSRYAKVGGISLKE 274

Query: 155 LNILENDFLKRVNYRIIPRDHNIMLCSIEQKQK 187
           LN LE  FL   ++         +L SIE+ ++
Sbjct: 275 LNYLELQFLILCDFN--------LLISIEEYER 299

>CAGL0M12342g Chr13 complement(1234192..1235565) [1374 bp, 457 aa]
           {ON} weakly similar to uniprot|P40038 Saccharomyces
           cerevisiae YER059w PCL6 cyclin like protein interacting
           with PHO85P
          Length = 457

 Score = 60.5 bits (145), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 59/119 (49%), Gaps = 14/119 (11%)

Query: 67  YHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQ------------TAYPD--F 112
           +  K  P I+++ YF R+ K+    + V ++ L Y D +             T+  D  F
Sbjct: 305 FKGKHVPQITLYQYFQRIQKYCPTTNDVFLSLLVYFDRISKKCNSSDSESADTSPADQLF 364

Query: 113 TLNSLTAHRFLLTATTIATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRII 171
            ++S   HR ++   T+ TK   D F +N+ YA+VGG+   ELN LE  FL   ++ ++
Sbjct: 365 VMDSYNIHRLVIAGVTVCTKFFSDFFYSNSRYARVGGISLSELNHLELQFLVLCDFELL 423

>KLLA0C08305g Chr3 complement(728996..730225) [1230 bp, 409 aa] {ON}
           similar to uniprot|P40186 Saccharomyces cerevisiae
           YIL050W PCL7 Pho85p cyclin of the Pho80p subfamily forms
           a functional kinase complex with Pho85p which
           phosphorylates Mmr1p and is regulated by Pho81p involved
           in glycogen metabolism expression is cell-cycle
           regulated and weakly similar to YER059W uniprot|P40038
           Saccharomyces cerevisiae YER059W PCL6 Pho85p cyclin of
           the Pho80p subfamily forms the major Glc8p kinase
           together with Pcl7p and Pho85p involved in the control
           of glycogen storage by Pho85p stabilized by Elongin C
           binding
          Length = 409

 Score = 59.7 bits (143), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 38/133 (28%), Positives = 63/133 (47%), Gaps = 28/133 (21%)

Query: 67  YHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQ--------------TAYPD- 111
           +  K  P I++  YF R+ K+    + VL++ L + D +                + PD 
Sbjct: 240 FRGKQVPGITLKQYFQRIQKYCPTTNDVLLSLLVHFDRIAKKCNAIAQEYMVSVVSTPDK 299

Query: 112 -------------FTLNSLTAHRFLLTATTIATKGLCDSFSTNAHYAKVGGVRCHELNIL 158
                        F ++S   HR ++ A T++TK + D F +N+ YA+VGG+   ELN L
Sbjct: 300 TTASLAHQSSPQLFVMDSHNIHRLIIAAITVSTKFISDFFYSNSRYARVGGISLQELNHL 359

Query: 159 ENDFLKRVNYRII 171
           E  FL   ++R+I
Sbjct: 360 ELQFLILCDFRLI 372

>NCAS0E03220 Chr5 complement(639650..640675) [1026 bp, 341 aa] {ON}
           Anc_7.240
          Length = 341

 Score = 58.9 bits (141), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 59/128 (46%), Gaps = 28/128 (21%)

Query: 71  IPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAY---------PD---------- 111
           IPP I +  YF R+ K+    + VL+  L Y D +             P+          
Sbjct: 189 IPP-IKLEQYFHRIQKYCPTNNLVLLAILIYFDRISKVLNGSKENESDPNISTHHHLLRN 247

Query: 112 --------FTLNSLTAHRFLLTATTIATKGLCDSFSTNAHYAKVGGVRCHELNILENDFL 163
                   F L+S   HR +++A T++TK   D F +N+ YAKVGG+   E+N LE  FL
Sbjct: 248 YDCKIEDKFLLDSYNIHRLIISAITVSTKFWSDFFYSNSRYAKVGGISLDEMNYLELQFL 307

Query: 164 KRVNYRII 171
              N+ +I
Sbjct: 308 LISNFDLI 315

>KNAG0L01470 Chr12 (259883..260947) [1065 bp, 354 aa] {ON} Anc_7.240
           YIL050W
          Length = 354

 Score = 58.5 bits (140), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 38/137 (27%), Positives = 62/137 (45%), Gaps = 24/137 (17%)

Query: 67  YHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLL----------------QTAYP 110
           +  K  P I++  YF R+ K+    + V ++ L Y D +                Q    
Sbjct: 211 FKGKHIPQITLEQYFHRIQKYCPTTNDVFLSLLIYFDRISEKCNSIPRGGDDDKVQDDTL 270

Query: 111 DFTLNSLTAHRFLLTATTIATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRI 170
            F +NS   HR ++    ++TK   D F +NA YAKVGG+   E+N LE  FL   ++  
Sbjct: 271 LFVMNSYNIHRLIIAGVAVSTKFSSDFFYSNARYAKVGGISLREMNYLELQFLVLCDFS- 329

Query: 171 IPRDHNIMLCSIEQKQK 187
                  +L S+E+ ++
Sbjct: 330 -------LLISVEEMER 339

>TPHA0C01090 Chr3 complement(247987..249144) [1158 bp, 385 aa] {ON}
           Anc_7.240 YIL050W
          Length = 385

 Score = 57.8 bits (138), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 39/157 (24%), Positives = 67/157 (42%), Gaps = 44/157 (28%)

Query: 67  YHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPD--------------- 111
           +  K  P IS+  YF R+ K+  + + V ++ L Y D +     +               
Sbjct: 208 FRGKHVPQISLEQYFQRIQKYCPITNDVFLSLLVYFDRISKKCNNINLEKENVISNDADE 267

Query: 112 ---------------------FTLNSLTAHRFLLTATTIATKGLCDSFSTNAHYAKVGGV 150
                                F ++S   HR ++TA T++TK   D F +N+ YA+VGG+
Sbjct: 268 SQNNVKQMKDENNSSIVKPQVFVMDSFNIHRLIITAVTVSTKFFSDLFYSNSRYARVGGI 327

Query: 151 RCHELNILENDFLKRVNYRIIPRDHNIMLCSIEQKQK 187
              ELN LE  FL   +++        ++ S+E+ Q+
Sbjct: 328 SLQELNHLELQFLILCDFQ--------LMISVEELQR 356

>NDAI0A02560 Chr1 (571529..573040) [1512 bp, 503 aa] {ON} Anc_7.240
           YER059W
          Length = 503

 Score = 57.0 bits (136), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 55/113 (48%), Gaps = 14/113 (12%)

Query: 73  PNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQ---TAYPD-----------FTLNSLT 118
           P I++  YF R+ K+    + V ++ L Y D +     + P            F ++S  
Sbjct: 358 PQITLHQYFQRIQKYCPTTNDVFLSLLVYFDRISKRCNSTPTTNSINDNNSQMFVMDSYN 417

Query: 119 AHRFLLTATTIATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRII 171
            HR ++   T+ TK   D F +N+ YA+VGG+   ELN LE  FL   ++ ++
Sbjct: 418 IHRLIIAGITVCTKFFSDFFYSNSRYARVGGISLQELNHLELQFLILCDFELM 470

>TDEL0H02020 Chr8 complement(346307..347398) [1092 bp, 363 aa] {ON}
           Anc_7.240 YIL050W
          Length = 363

 Score = 55.8 bits (133), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 38/136 (27%), Positives = 59/136 (43%), Gaps = 31/136 (22%)

Query: 67  YHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYID-----------------LLQTAY 109
           +  K  P IS+ +YF R+ K+    + V ++ L Y D                  LQ   
Sbjct: 196 FRGKHIPQISLEHYFQRIQKYCPTTNDVFLSLLVYFDRISKRCNSNNNDTTNDNDLQYDM 255

Query: 110 PD--------------FTLNSLTAHRFLLTATTIATKGLCDSFSTNAHYAKVGGVRCHEL 155
           P               F ++S   HR L+   T++TK   D F +N+ YA+VGG+   EL
Sbjct: 256 PAKQQQQTQQTQQQQAFVMDSHNIHRLLIAGVTVSTKFFSDFFYSNSRYARVGGISLQEL 315

Query: 156 NILENDFLKRVNYRII 171
           N LE  FL   ++ ++
Sbjct: 316 NHLELQFLVLCDFELL 331

>TBLA0D04070 Chr4 complement(1012284..1014269) [1986 bp, 661 aa]
           {ON} Anc_7.240 YIL050W
          Length = 661

 Score = 55.1 bits (131), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 37/60 (61%)

Query: 112 FTLNSLTAHRFLLTATTIATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRII 171
           F ++S   HR ++   T+ATK   D F +NA YAKVGG+   ELN LE  FL   +++++
Sbjct: 578 FVMDSYNIHRLIIAGVTVATKFFSDYFYSNARYAKVGGITLQELNHLELQFLLLCDFKLL 637

>Kpol_1033.13 s1033 (30454..31206) [753 bp, 250 aa] {ON}
           (30454..31206) [753 nt, 251 aa]
          Length = 250

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 42/76 (55%), Gaps = 8/76 (10%)

Query: 112 FTLNSLTAHRFLLTATTIATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRII 171
           F ++S   HR ++   T++TK   D F +N+ YA+VGG+   ELN LE  FL   ++   
Sbjct: 163 FVMDSYNIHRLIIAGVTVSTKFFSDLFYSNSRYARVGGISLQELNNLELQFLLMCDFH-- 220

Query: 172 PRDHNIMLCSIEQKQK 187
                 +L S+E+ Q+
Sbjct: 221 ------LLISVEELQR 230

>ZYRO0C08118g Chr3 (621320..622537) [1218 bp, 405 aa] {ON} similar
           to uniprot|P40186 Saccharomyces cerevisiae YIL050W PCL7
           Pho85p cyclin of the Pho80p subfamily forms a functional
           kinase complex with Pho85p which phosphorylates Mmr1p
           and is regulated by Pho81p involved in glycogen
           metabolism expression is cell-cycle regulated
          Length = 405

 Score = 53.1 bits (126), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 37/60 (61%)

Query: 112 FTLNSLTAHRFLLTATTIATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRII 171
           F ++S   HR ++  TT++TK   D F +N+ YA+VGG+   ELN LE  FL   ++ ++
Sbjct: 320 FVMDSHNIHRLIIAGTTVSTKFFSDFFYSNSRYARVGGISLQELNYLELQFLILCDFELL 379

>YER059W Chr5 (272624..273886) [1263 bp, 420 aa] {ON}  PCL6Pho85p
           cyclin of the Pho80p subfamily; forms the major Glc8p
           kinase together with Pcl7p and Pho85p; involved in the
           control of glycogen storage by Pho85p; stabilized by
           Elongin C binding
          Length = 420

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 40/65 (61%), Gaps = 1/65 (1%)

Query: 108 AYPD-FTLNSLTAHRFLLTATTIATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRV 166
           A+P  F ++S   HR ++   T++TK L D F +N+ Y++VGG+   ELN LE  FL   
Sbjct: 325 AHPQMFVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLC 384

Query: 167 NYRII 171
           ++ ++
Sbjct: 385 DFELL 389

>Smik_5.189 Chr5 (276775..278022) [1248 bp, 415 aa] {ON} YER059W
           (REAL)
          Length = 415

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 37/60 (61%)

Query: 112 FTLNSLTAHRFLLTATTIATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRII 171
           F ++S   HR ++   T++TK L D F +N+ Y++VGG+   ELN LE  FL   ++ ++
Sbjct: 325 FVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLCDFELL 384

>Suva_5.167 Chr5 (248778..250052) [1275 bp, 424 aa] {ON} YER059W
           (REAL)
          Length = 424

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 37/60 (61%)

Query: 112 FTLNSLTAHRFLLTATTIATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRII 171
           F ++S   HR ++   T++TK L D F +N+ Y++VGG+   ELN LE  FL   ++ ++
Sbjct: 334 FVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLCDFELL 393

>NDAI0E04770 Chr5 (1073112..1074023) [912 bp, 303 aa] {ON} Anc_7.240
           YER059W
          Length = 303

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 39/76 (51%), Gaps = 5/76 (6%)

Query: 114 LNSLTAHRFLLTATTIATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIP- 172
           +NS T HR +L   T+++K L D   +N  YA+  G+   ELN LE  FL+  N+ +   
Sbjct: 227 VNSCTVHRLILAGITVSSKFLSDFTYSNKRYAQASGLTLEELNYLEFQFLRLTNFNLSVS 286

Query: 173 ----RDHNIMLCSIEQ 184
                D+   LCS  Q
Sbjct: 287 LNELEDYGTALCSCSQ 302

>Skud_5.173 Chr5 (268792..270054) [1263 bp, 420 aa] {ON} YER059W
           (REAL)
          Length = 420

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 37/60 (61%)

Query: 112 FTLNSLTAHRFLLTATTIATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRII 171
           F ++S   HR ++   T++TK L D F +N+ Y++VGG+   ELN LE  FL   ++ ++
Sbjct: 330 FVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLCDFELL 389

>YDL179W Chr4 (138291..139205) [915 bp, 304 aa] {ON}  PCL9Cyclin,
           forms a functional kinase complex with Pho85p
           cyclin-dependent kinase (Cdk), expressed in late M/early
           G1 phase, activated by Swi5p
          Length = 304

 Score = 49.3 bits (116), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 71/138 (51%), Gaps = 14/138 (10%)

Query: 39  ISRMLVSLIAINENSVSKIPENQITLTRYHSKIPPNISIF--NYFIRLTKFSSLEHCVLM 96
           +S+ ++  +A +  S+ KI EN   +       PP++SIF  N  I+    S+++   LM
Sbjct: 16  VSQEMIQFLATSTASIIKIRENNNPIQGCR---PPDLSIFIKNVVIQ----SNVQTPTLM 68

Query: 97  TSLYYIDLLQTAYPD--FTLNSLTAHRFLLTATTIATKGLCDSFSTNAHYAKV--GGVRC 152
            +  Y++ L++  P   + +N+ T HR  L    +A K L DS   N H+     G +R 
Sbjct: 69  ATSVYLNKLKSVIPKNVYGINT-TRHRIFLGCLILAAKTLNDSSPWNKHWTTYTEGLLRI 127

Query: 153 HELNILENDFLKRVNYRI 170
            E+N +E + L+ +N+ +
Sbjct: 128 REVNTIERELLEYLNWDV 145

>Kpol_2000.14 s2000 (24019..24951) [933 bp, 310 aa] {ON}
           (24019..24951) [933 nt, 311 aa]
          Length = 310

 Score = 48.5 bits (114), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 54/109 (49%), Gaps = 5/109 (4%)

Query: 76  SIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPD--FTLNSLTAHRFLLTATTIATKG 133
           SIF +   L K S+++   LM S  Y+  L++  P   + + S T HR  L    +A K 
Sbjct: 44  SIFEFIKGLIKHSNVQTSTLMASTVYLTKLRSILPANVYGIES-TKHRIFLGCLILAAKS 102

Query: 134 LCDSFSTNAHYAKV--GGVRCHELNILENDFLKRVNYRIIPRDHNIMLC 180
           L DS   N H+ K   G +   ++N +E + L  +N+  I +  +++ C
Sbjct: 103 LNDSSPLNKHWTKYTNGLLNLADVNTIERELLAYLNWDTIIKQEDLIGC 151

>TBLA0C04850 Chr3 complement(1175677..1176783) [1107 bp, 368 aa]
           {ON} Anc_7.289 YDL179W
          Length = 368

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 40/155 (25%), Positives = 67/155 (43%), Gaps = 12/155 (7%)

Query: 29  KCSRTDLVVLISRMLVSLIAINENSVSKIPENQITLTRYHSKIPPNISIFNYFIRLTKFS 88
           K    +++  +S    S I I   S S +    I      S IPP   ++ +   L   S
Sbjct: 14  KAVTGEMIQFLSNCAASAIQIRPTSDSNLTNESI------SNIPP---LYTFIKNLVAHS 64

Query: 89  SLEHCVLMTSLYYIDLLQTAYPDFTLN-SLTAHRFLLTATTIATKGLCDSFSTNAHYAKV 147
           +++   LMT++ Y+  L+   P        T HR  L    IA K L DS   N H+AK 
Sbjct: 65  NVQTPTLMTTVVYLKKLKAIIPSNVYGIETTRHRMFLGCLIIAAKTLNDSSPLNKHWAKY 124

Query: 148 --GGVRCHELNILENDFLKRVNYRIIPRDHNIMLC 180
             G ++  E+N +E + L    + +    ++++ C
Sbjct: 125 TNGLLQLREVNTIEREILTYFKWDLQITVNDLLTC 159

>Suva_4.68 Chr4 (125518..126435) [918 bp, 305 aa] {ON} YDL179W
           (REAL)
          Length = 305

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 34/135 (25%), Positives = 65/135 (48%), Gaps = 8/135 (5%)

Query: 39  ISRMLVSLIAINENSVSKIPENQITLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTS 98
           +S+ ++  +A +  S+ +I +N    +  H   PP +SIF    ++   S+++   LM +
Sbjct: 15  VSQEMIQFLATSTASIIQIRKND---SPVHGCPPPELSIF--IKKVVVQSNVQTPTLMAT 69

Query: 99  LYYIDLLQTAYPDFTLN-SLTAHRFLLTATTIATKGLCDSFSTNAHYAKV--GGVRCHEL 155
             Y++ L++  P        T HR  L    +A K L DS   N H+     G ++  E+
Sbjct: 70  TVYLNKLKSIIPKNVYGIETTRHRIFLGCLILAAKTLNDSSPWNKHWTTYTEGLLKVREV 129

Query: 156 NILENDFLKRVNYRI 170
           N +E + L+  N+ +
Sbjct: 130 NTIERELLEYFNWDV 144

>NCAS0A13770 Chr1 complement(2704299..2705237) [939 bp, 312 aa] {ON}
           Anc_7.289
          Length = 312

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 61/127 (48%), Gaps = 10/127 (7%)

Query: 76  SIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLN-SLTAHRFLLTATTIATKGL 134
           ++ N+   L K S+++   LM +  Y+  L++  P        T HR  L    +A K L
Sbjct: 49  TLSNFIKALIKHSNVQTPTLMATTVYLSKLKSIIPCNVYGIETTRHRIFLGCLILAAKTL 108

Query: 135 CDSFSTNAHYAKV--GGVRCHELNILENDFLKRVNYRIIPRDHNIMLC-------SIEQK 185
            DS   N H+A+   G ++  E+N +E + L+  ++ +  +  ++++C        IEQ 
Sbjct: 109 NDSSPMNKHWAQYTDGLLQIREVNTIERELLEYFDWDVTIKTKDLIICLSPLLQPIIEQS 168

Query: 186 QKKFVID 192
            +K  +D
Sbjct: 169 LRKNQMD 175

>TDEL0H01550 Chr8 (266510..267439) [930 bp, 309 aa] {ON} Anc_7.289
           YDL179W
          Length = 309

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/133 (24%), Positives = 59/133 (44%), Gaps = 14/133 (10%)

Query: 73  PNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLN-SLTAHRFLLTATTIAT 131
           P  S+ N+   L   S+++   LM +  Y+  L++  P        T HR  L    +A 
Sbjct: 45  PAPSLTNFIKGLVLHSNVQTPTLMATAVYLAKLRSIIPGNVYGIETTRHRIFLGCLILAA 104

Query: 132 KGLCDSFSTNAHYAKV--GGVRCHELNILENDFLKRVNYRIIPRDHNIMLCS-------- 181
           K L DS   N H+A    G +  HE+N +E + L+  ++ +     +++ C         
Sbjct: 105 KTLNDSSPLNKHWALYTDGLLHIHEVNTIERELLEYFDWNVTVTTKDLITCLAPFLQPIK 164

Query: 182 ---IEQKQKKFVI 191
              I QKQ+ +++
Sbjct: 165 EQFIRQKQQNYLL 177

>TPHA0P00810 Chr16 complement(165632..166375) [744 bp, 247 aa] {ON}
           Anc_7.289 YDL179W
          Length = 247

 Score = 42.7 bits (99), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 50/98 (51%), Gaps = 3/98 (3%)

Query: 76  SIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTA-HRFLLTATTIATKGL 134
           S+ ++   + K+S ++   LM S  +++ L+   P +     TA HR  L    +A+K L
Sbjct: 44  SLTSFICDVVKYSKVKTPTLMASTVFLNRLRCIIPGYVEGIATATHRLFLGCLILASKTL 103

Query: 135 CDSFSTNAHYAKV--GGVRCHELNILENDFLKRVNYRI 170
            DS   N H+ K   G +   E+N +E + L+ +++ +
Sbjct: 104 NDSSPFNKHWEKYCRGLLSLMEINTIERELLEYMSWNV 141

>Smik_4.60 Chr4 (115068..115985) [918 bp, 305 aa] {ON} YDL179W
           (REAL)
          Length = 305

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 37/145 (25%), Positives = 68/145 (46%), Gaps = 11/145 (7%)

Query: 39  ISRMLVSLIAINENSVSKIPENQITLTRYHSKIPPNISIF--NYFIRLTKFSSLEHCVLM 96
           IS+ ++  +A +  S+ +I   Q +   +    PP++S F  N  I+    S+++   LM
Sbjct: 16  ISQEMIQFLATSTASIIQI--RQTSTPNHGFNRPPDLSTFIKNVVIQ----SNVQTPTLM 69

Query: 97  TSLYYIDLLQTAYPDFTLN-SLTAHRFLLTATTIATKGLCDSFSTNAHYAKV--GGVRCH 153
            +  Y++ L+   P        T HR  L    +A K L DS   N H+     G +R  
Sbjct: 70  ATSVYLNKLRNIIPRNVYGIETTRHRIFLGCLILAAKTLNDSSPWNKHWTTYTEGLLRVR 129

Query: 154 ELNILENDFLKRVNYRIIPRDHNIM 178
           E+N +E + L+  N+ +    H+++
Sbjct: 130 EVNTIERELLEYFNWDVRITTHDLV 154

>SAKL0C12100g Chr3 complement(1083684..1084628) [945 bp, 314 aa]
           {ON} similar to gnl|GLV|CAGL0E02233g Candida glabrata
           CAGL0E02233g and some similarites with YNL289W
           uniprot|P24867 Saccharomyces cerevisiae YNL289W PCL1
           Pho85 cyclin of the Pcl1 2-like subfamily involved in
           entry into the mitotic cell cycle and regulation of
           morphogenesis localizes to sites of polarized cell
           growth
          Length = 314

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 60/122 (49%), Gaps = 9/122 (7%)

Query: 76  SIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYP-DFTLNSLTAHRFLLTATTIATKGL 134
           S+  +  +L +++++    L+T++ Y+  L+T  P D T    T HR  L    ++ K  
Sbjct: 55  SLMTFITKLVRYTNVYTSTLLTTVCYLSKLKTILPRDATGLPSTTHRIFLACLILSAKFH 114

Query: 135 CDSFSTNAHYAKV--GGVRCHELNILENDFLK------RVNYRIIPRDHNIMLCSIEQKQ 186
            DS   NAH+++   G     ++N++E   L+      R+N   + +D   +L  I++  
Sbjct: 115 NDSSPLNAHWSRYTDGLFSLEDVNLMERQLLQLLHWDLRINQDALAQDLQWLLLPIKEDL 174

Query: 187 KK 188
           K+
Sbjct: 175 KR 176

>Suva_14.50 Chr14 (84601..85440) [840 bp, 279 aa] {ON} YNL289W
           (REAL)
          Length = 279

 Score = 42.4 bits (98), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 49/96 (51%), Gaps = 3/96 (3%)

Query: 76  SIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYP-DFTLNSLTAHRFLLTATTIATKGL 134
           S+  +  RL +++++    L+T++ Y++ L+   P D T    T HR  L    ++ K  
Sbjct: 54  SLMTFITRLVRYTNVYTPTLLTAVCYLNKLKRILPKDATGLPSTIHRIFLACLILSAKFH 113

Query: 135 CDSFSTNAHYAKV--GGVRCHELNILENDFLKRVNY 168
            DS   N H+AK   G     ++N++E   L+ +N+
Sbjct: 114 NDSSPLNKHWAKYTDGLFTLEDINLMERQLLQLLNW 149

>Kwal_23.6006 s23 complement(1411337..1412251) [915 bp, 304 aa] {ON}
           YDL127W (PCL2) - G1 cyclin [contig 12] FULL
          Length = 304

 Score = 42.4 bits (98), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 66/141 (46%), Gaps = 9/141 (6%)

Query: 43  LVSLIAINENSVSKIPENQITLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYI 102
           ++  +A +  SV ++ E+    +R   K+   +S+ N+   L   S+++   LM++  Y+
Sbjct: 19  MIEFLAASSRSVIQVRESDSERSR---KV---VSLENFIKGLVVQSNVQTPTLMSTAVYL 72

Query: 103 DLLQTAYPDFTLN-SLTAHRFLLTATTIATKGLCDSFSTNAHYAKV--GGVRCHELNILE 159
             L++  P   L    T HR  L    IA K L DS   N H+A    G +   E+N +E
Sbjct: 73  AKLRSIIPANVLGIETTRHRMFLGCLIIAAKNLNDSSPMNKHWASYTNGLLDTREVNTIE 132

Query: 160 NDFLKRVNYRIIPRDHNIMLC 180
            + L+  ++ +      + +C
Sbjct: 133 RELLEYFDWNLQFSTQELAIC 153

>TBLA0J00650 Chr10 complement(152884..153975) [1092 bp, 363 aa] {ON}
           Anc_7.289 YDL179W
          Length = 363

 Score = 42.4 bits (98), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 50/101 (49%), Gaps = 5/101 (4%)

Query: 73  PNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYP-DFTLNSLTAHRFLLTATTIAT 131
           P++++F    RL   S+++   LM++L Y+  L+   P D      T HR  +    +A 
Sbjct: 45  PSLALF--IKRLIVHSNVQTPTLMSTLVYLTKLREIIPSDVVGIETTRHRIFIGCLILAA 102

Query: 132 KGLCDSFSTNAHYAKV--GGVRCHELNILENDFLKRVNYRI 170
           K L DS   N H+ +   G  +  E+N +E + L+  N+ +
Sbjct: 103 KSLNDSSPLNRHWTQYTNGLFKIQEINTIERELLEYFNWDV 143

>ZYRO0C09284g Chr3 complement(706160..707095) [936 bp, 311 aa] {ON}
           some similarities with uniprot|P25693 Saccharomyces
           cerevisiae YDL127W PCL2 G1 cyclin associates with Pho85p
           cyclin-dependent kinase (Cdk) to contribute to entry
           into the mitotic cell cycle essential for cell
           morphogenesis localizes to sites of polarized cell
           growth
          Length = 311

 Score = 42.0 bits (97), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 35/146 (23%), Positives = 67/146 (45%), Gaps = 11/146 (7%)

Query: 39  ISRMLVSLIAINENSVSKIPENQITLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTS 98
           +S  +V  +A   +S+ K+ +N   +    S  PP   +  +   L  +S+++   LM +
Sbjct: 15  VSIEMVQYLASTTSSIIKVKKNSNIV---DSPAPP---LMRFIKTLISYSNVQTPTLMAT 68

Query: 99  LYYIDLLQTAYPD--FTLNSLTAHRFLLTATTIATKGLCDSFSTNAHYAKV--GGVRCHE 154
             Y+  L++  P   F + + T HR  L    +A K L DS   N H+A    G +   E
Sbjct: 69  TVYLTKLRSIIPANVFGIET-TRHRIFLGCLILAAKTLNDSSPLNKHWASYTDGLLHIRE 127

Query: 155 LNILENDFLKRVNYRIIPRDHNIMLC 180
           +N +E + L+  ++ +      ++ C
Sbjct: 128 VNTIERELLEYFDWNVCITTEELVAC 153

>Smik_4.110 Chr4 (211556..212482) [927 bp, 308 aa] {ON} YDL127W
           (REAL)
          Length = 308

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/145 (24%), Positives = 65/145 (44%), Gaps = 7/145 (4%)

Query: 39  ISRMLVSLIAINENSVSKIPENQITLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTS 98
           +S+ ++  +A    SV KI +   ++       PP     N   RL K S+++   LM +
Sbjct: 15  VSKEMIQYLASTTASVIKIKKTN-SMIDIALPAPPLTEFIN---RLIKHSNVQTPTLMAT 70

Query: 99  LYYIDLLQTAYPDFTLN-SLTAHRFLLTATTIATKGLCDSFSTNAHYAKV--GGVRCHEL 155
             Y+  L++  P        T HR  L    +A K L DS   N H+A+   G +   E+
Sbjct: 71  SVYLAKLRSLIPSKVYGIETTRHRIFLGCLILAAKTLNDSSPLNKHWAEYTDGLLLLREV 130

Query: 156 NILENDFLKRVNYRIIPRDHNIMLC 180
           N +E + L+  ++ +     +++ C
Sbjct: 131 NTIERELLEYFDWDVTISTEDLITC 155

>NDAI0A02270 Chr1 (511135..512127) [993 bp, 330 aa] {ON} Anc_7.289
          Length = 330

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/160 (26%), Positives = 69/160 (43%), Gaps = 14/160 (8%)

Query: 26  DFNKCSRTDLVVLISRMLVSLIAINENSVSKIPE-NQITLTRYHSKIPPNISIFNYFIR- 83
            FNK S       +S  +V  +A N  S+ ++ + N I  T   + IP  I   + FI+ 
Sbjct: 9   QFNKKS-------VSHEMVHFLATNTASIIQVKKGNNIVTTE--NGIPIEIPPLSNFIKN 59

Query: 84  LTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLN-SLTAHRFLLTATTIATKGLCDSFSTNA 142
           L   S+++   LM +  Y+  L+   P        T HR  L    +A K L DS   N 
Sbjct: 60  LVMHSNVQTPTLMATSVYLSKLRLIIPKNVYGMETTRHRIFLGCLILAAKTLNDSSPLNK 119

Query: 143 HYAKV--GGVRCHELNILENDFLKRVNYRIIPRDHNIMLC 180
           H+ K   G +   E+N +E + L+   + +      ++ C
Sbjct: 120 HWTKYTDGLLHIREVNTIERELLEYFEWNVTITTSELIKC 159

>SAKL0F09856g Chr6 complement(756909..757916) [1008 bp, 335 aa] {ON}
           similar to uniprot|P25693 Saccharomyces cerevisiae
           YDL127W PCL2 G1 cyclin associates with Pho85p cyclin-
           dependent kinase (Cdk) to contribute to entry into the
           mitotic cell cycle essential for cell morphogenesis
           localizes to sites of polarized cell growth
          Length = 335

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/150 (20%), Positives = 66/150 (44%), Gaps = 20/150 (13%)

Query: 34  DLVVLISRMLVSLIAINENSVSKIPENQITLTRYHSKIPPNISIFNYFIRLTKFSSLEHC 93
           D+V  ++    S+I + EN    +                 +S+ ++   L   S+++  
Sbjct: 18  DMVHFLAATTSSVIQVKENVAGSV-----------------VSLVDFIKGLITHSNVQTP 60

Query: 94  VLMTSLYYIDLLQTAYPDFTLN-SLTAHRFLLTATTIATKGLCDSFSTNAHYAKV--GGV 150
            LM+++ Y+  L++  P        T HR  L    +A K L DS   N H+++   G +
Sbjct: 61  TLMSTVVYLTRLRSIIPATVYGIETTRHRIFLGCLILAAKNLNDSSPLNKHWSRYTNGLL 120

Query: 151 RCHELNILENDFLKRVNYRIIPRDHNIMLC 180
              E+N +E + L+  ++++     +++ C
Sbjct: 121 DIREVNTIERELLEYFDWKLRIDTQDLITC 150

>CAGL0E02233g Chr5 (215934..216734) [801 bp, 266 aa] {ON} similar to
           uniprot|P24867 Saccharomyces cerevisiae YNL289w PCL1
           cyclin
          Length = 266

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 50/98 (51%), Gaps = 3/98 (3%)

Query: 76  SIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYP-DFTLNSLTAHRFLLTATTIATKGL 134
           S+  +  RL +++++    L+ ++ Y++ L+   P D T    T HR  L    +++K  
Sbjct: 54  SLMTFITRLVRYTNVYTPTLLATVCYLNKLKRILPKDATGLPSTIHRLFLACLILSSKCH 113

Query: 135 CDSFSTNAHYAKV--GGVRCHELNILENDFLKRVNYRI 170
            DS   N H+A+   G     ++N++E   L+ +N+ I
Sbjct: 114 NDSSPKNVHWARYTDGLFSLEDINLMERQLLQLLNWDI 151

>YDL127W Chr4 (234927..235853) [927 bp, 308 aa] {ON}  PCL2Cyclin,
           interacts with cyclin-dependent kinase Pho85p; member of
           the Pcl1,2-like subfamily, involved in the regulation of
           polarized growth and morphogenesis and progression
           through the cell cycle; localizes to sites of polarized
           cell growth
          Length = 308

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/145 (24%), Positives = 65/145 (44%), Gaps = 7/145 (4%)

Query: 39  ISRMLVSLIAINENSVSKIPENQITLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTS 98
           +S+ +V  +A    S+ KI +   ++       PP     N   RL K S+++   LM +
Sbjct: 15  VSKEMVQYLASTTASIIKIKKTN-SMIDIALPAPPLTKFIN---RLIKHSNVQTPTLMAT 70

Query: 99  LYYIDLLQTAYPDFTLN-SLTAHRFLLTATTIATKGLCDSFSTNAHYAKV--GGVRCHEL 155
             Y+  L++  P        T HR  L    +A K L DS   N H+A+   G +   E+
Sbjct: 71  SVYLAKLRSIIPSNVYGIETTRHRIFLGCLILAAKTLNDSSPLNKHWAEYTDGLLILREV 130

Query: 156 NILENDFLKRVNYRIIPRDHNIMLC 180
           N +E + L+  ++ +     +++ C
Sbjct: 131 NTIERELLEYFDWDVTISTDDLITC 155

>Kpol_1020.16 s1020 complement(33477..34325) [849 bp, 282 aa] {ON}
           complement(33477..34325) [849 nt, 283 aa]
          Length = 282

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/170 (23%), Positives = 75/170 (44%), Gaps = 31/170 (18%)

Query: 76  SIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYP-DFTLNSLTAHRFLLTATTIATKGL 134
           S+  +  +L +++++    L+T+  Y+  LQ   P D T    T HR  L    I+ K  
Sbjct: 54  SLMTFITKLVRYTNVYTSTLLTTTCYLKKLQRILPKDATGLPSTIHRMFLACLIISAKYH 113

Query: 135 CDSFSTNAHYAKV--GGVRCHELNILENDFLKRVNYRIIPRDHNIML------------C 180
            DS   N H+A+   G     ++N++E   L  +N+ +   +++++L             
Sbjct: 114 NDSSPLNKHWAEYTDGLFSLEDVNLMEMQLLALLNWDLRINENDLILDLRHLLEPIMRDL 173

Query: 181 SIEQKQKKFVIDKNALGSFDLDSYSYTDRPKS------GYNVLDKYYRRI 224
            I  ++KK +  K+       + + Y  RP S       YN   K+YR++
Sbjct: 174 EISYQRKKILKSKS-------EQHQYIQRPVSPISPTKSYN---KFYRQV 213

>Smik_14.42 Chr14 (72224..73063) [840 bp, 279 aa] {ON} YNL289W
           (REAL)
          Length = 279

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/106 (24%), Positives = 54/106 (50%), Gaps = 6/106 (5%)

Query: 66  RYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYP-DFTLNSLTAHRFLL 124
           ++ +++P   S+  +  RL +++++    L+T+  Y++ L+   P D T    T HR  L
Sbjct: 47  KHMARLP---SLMTFITRLVRYTNVYTPTLLTAACYLNKLKRILPKDATGLPSTIHRIFL 103

Query: 125 TATTIATKGLCDSFSTNAHYAKV--GGVRCHELNILENDFLKRVNY 168
               ++ K   DS   N H+A+   G     ++N++E   L+ +N+
Sbjct: 104 ACLILSAKFHNDSSPLNKHWARYTDGLFTLEDINLMERQLLQLLNW 149

>Kpol_1020.8 s1020 (18215..19105) [891 bp, 296 aa] {ON}
           (18215..19105) [891 nt, 297 aa]
          Length = 296

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 60/124 (48%), Gaps = 8/124 (6%)

Query: 54  VSKIPENQITLTRYHSKIP---PNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYP 110
           +S I E+ I + R +S I    P   +  +   L   S+++   LM +  Y+  L+   P
Sbjct: 23  LSNITESIIQVRRSNSMISIALPPPPLVKFITNLCLKSNVQTPTLMATTVYLKKLKNIIP 82

Query: 111 D--FTLNSLTAHRFLLTATTIATKGLCDSFSTNAHYAKV--GGVRCHELNILENDFLKRV 166
              + + S T HR  L    +A+K L DS   N H+A+   G ++  E+N +E + L+  
Sbjct: 83  PNVYGIES-TRHRIFLGCLILASKTLNDSSPLNKHWARYTSGILQLREVNTIERELLEYF 141

Query: 167 NYRI 170
           ++ I
Sbjct: 142 DWNI 145

>AFR159C Chr6 complement(723082..724008) [927 bp, 308 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL127W
           (PCL2) and YDL179W (PCL9)
          Length = 308

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/109 (24%), Positives = 55/109 (50%), Gaps = 3/109 (2%)

Query: 75  ISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTA-HRFLLTATTIATKG 133
           +S+ ++   L K S+++   LM+++ Y+  L++  P       T+ HR  L    +A K 
Sbjct: 43  LSLVDFIKGLVKRSNVQTPTLMSTVVYLARLRSIIPANVYGIETSRHRMFLGCLILAAKN 102

Query: 134 LCDSFSTNAHYAKV--GGVRCHELNILENDFLKRVNYRIIPRDHNIMLC 180
           L DS   N H+ +   G +   E+N +E + L+  N+ +   + +++ C
Sbjct: 103 LNDSSPMNKHWCRYTDGLLSLREVNTIERELLEYFNWNLRITNQDLISC 151

>TBLA0A07890 Chr1 (1943543..1944628) [1086 bp, 361 aa] {ON} Anc_3.70
           YNL289W
          Length = 361

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/112 (23%), Positives = 54/112 (48%), Gaps = 3/112 (2%)

Query: 71  IPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYP-DFTLNSLTAHRFLLTATTI 129
           IP   S+  +  R+ ++++++   L+ ++ Y++ L+   P D      T HR  L    +
Sbjct: 55  IPKLPSLMTFITRIVRYTNVQVSTLLMTVCYLNKLKKLLPADAVGIPSTIHRLFLACLIL 114

Query: 130 ATKGLCDSFSTNAHYAKV--GGVRCHELNILENDFLKRVNYRIIPRDHNIML 179
           + K   DS   N H+A    G     ++N++E   L  +++ +   +H I+L
Sbjct: 115 SAKFHNDSSPLNVHWANYTNGLFSVKDVNLMERQLLSLLDWNLQLTEHEIIL 166

>Skud_14.48 Chr14 (81435..82274) [840 bp, 279 aa] {ON} YNL289W
           (REAL)
          Length = 279

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/106 (24%), Positives = 54/106 (50%), Gaps = 6/106 (5%)

Query: 66  RYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYP-DFTLNSLTAHRFLL 124
           ++ +++P   S+  +  RL +++++    L+T+  Y++ L+   P D T    T HR  L
Sbjct: 47  KHVARLP---SLMTFITRLVRYTNVYTPTLLTAACYLNKLKRILPKDATGLPSTIHRIFL 103

Query: 125 TATTIATKGLCDSFSTNAHYAKV--GGVRCHELNILENDFLKRVNY 168
               ++ K   DS   N H+A+   G     ++N++E   L+ +N+
Sbjct: 104 ACLILSAKFHNDSSPLNKHWARYTDGLFTLEDINLMERQLLQLLNW 149

>Suva_4.118 Chr4 (223497..224426) [930 bp, 309 aa] {ON} YDL127W
           (REAL)
          Length = 309

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/135 (25%), Positives = 61/135 (45%), Gaps = 7/135 (5%)

Query: 39  ISRMLVSLIAINENSVSKIPENQITLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTS 98
           +S+ +V  +A    S+ KI +   ++       PP +   N   RL K S+++   LM +
Sbjct: 15  VSKEMVQYLASTTASIIKIKKTN-SMIDIALPAPPLVKFIN---RLIKHSNVQTPTLMAT 70

Query: 99  LYYIDLLQTAYPDFTLN-SLTAHRFLLTATTIATKGLCDSFSTNAHYAKV--GGVRCHEL 155
             Y+  L++  P        T HR  L    +A K L DS   N H+A+   G +   E+
Sbjct: 71  SVYLVKLRSIIPSNVYGIETTRHRIFLGCLILAAKTLNDSSPLNKHWAEYTDGLLLLREV 130

Query: 156 NILENDFLKRVNYRI 170
           N +E + L   ++ +
Sbjct: 131 NTIERELLGYFDWDV 145

>YNL289W Chr14 (87897..88736) [840 bp, 279 aa] {ON}  PCL1Cyclin,
           interacts with cyclin-dependent kinase Pho85p; member of
           the Pcl1,2-like subfamily, involved in the regulation of
           polarized growth and morphogenesis and progression
           through the cell cycle; localizes to sites of polarized
           cell growth
          Length = 279

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/106 (24%), Positives = 54/106 (50%), Gaps = 6/106 (5%)

Query: 66  RYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYP-DFTLNSLTAHRFLL 124
           ++ +++P   S+  +  RL +++++    L+T+  Y++ L+   P D T    T HR  L
Sbjct: 47  KHLTRLP---SLMTFITRLVRYTNVYTPTLLTAACYLNKLKRILPRDATGLPSTIHRIFL 103

Query: 125 TATTIATKGLCDSFSTNAHYAKV--GGVRCHELNILENDFLKRVNY 168
               ++ K   DS   N H+A+   G     ++N++E   L+ +N+
Sbjct: 104 ACLILSAKFHNDSSPLNKHWARYTDGLFTLEDINLMERQLLQLLNW 149

>Ecym_8038 Chr8 complement(87401..88345) [945 bp, 314 aa] {ON}
           similar to Ashbya gossypii AFR159C
          Length = 314

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/111 (23%), Positives = 55/111 (49%), Gaps = 3/111 (2%)

Query: 73  PNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLN-SLTAHRFLLTATTIAT 131
           P +S+ ++   L   S+++   LM+++ Y+  L++  P        T HR  L    +A+
Sbjct: 41  PILSLVDFIKGLINKSNVQTPTLMSTVVYLTRLRSIIPPNVHGIETTRHRIFLGCLILAS 100

Query: 132 KGLCDSFSTNAHYAKVGG--VRCHELNILENDFLKRVNYRIIPRDHNIMLC 180
           K L DS   N H+ +     +   E+N +E + L+  N+ ++  + +++ C
Sbjct: 101 KNLNDSSPMNKHWCQYTNSLLSLREVNTVERELLEYFNWDLLITNKDLITC 151

>KLTH0A05346g Chr1 complement(445174..446079) [906 bp, 301 aa] {ON}
           similar to uniprot|P25693 Saccharomyces cerevisiae
           YDL127W PCL2 G1 cyclin associates with Pho85p cyclin-
           dependent kinase (Cdk) to contribute to entry into the
           mitotic cell cycle essential for cell morphogenesis
           localizes to sites of polarized cell growth
          Length = 301

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 34/145 (23%), Positives = 66/145 (45%), Gaps = 11/145 (7%)

Query: 39  ISRMLVSLIAINENSVSKIPENQITLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTS 98
           +S  ++  +A   NSV      Q+      +K+   +S+ ++   L   S+++   LM++
Sbjct: 15  VSMEMIEFLASTSNSVI-----QVRTGESSAKV---VSLVDFIKGLVVQSNVQTPTLMST 66

Query: 99  LYYIDLLQTAYP-DFTLNSLTAHRFLLTATTIATKGLCDSFSTNAHYAKV--GGVRCHEL 155
             Y+  L++  P +      T HR  L    IA K L DS   N H+A    G +   E+
Sbjct: 67  AVYLSKLRSIIPANVHGMETTRHRVFLGCLIIAAKNLNDSSPMNKHWASYTNGLLNTREV 126

Query: 156 NILENDFLKRVNYRIIPRDHNIMLC 180
           N +E + L+  ++ +     +++ C
Sbjct: 127 NTIERELLEYFDWNLRISTQDLVTC 151

>KNAG0A01490 Chr1 (62182..62970) [789 bp, 262 aa] {ON} Anc_3.70
           YNL289W
          Length = 262

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 31/139 (22%), Positives = 62/139 (44%), Gaps = 3/139 (2%)

Query: 44  VSLIAINENSVSKIPENQITLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYID 103
           V+L  +      + P    + T    K P   S+  +  +L +++++    L+T++ Y++
Sbjct: 27  VTLKVLPNTPAQQYPSPPSSPTELSGKEPRLPSLRTFITKLVRYTNVYTPTLLTTVCYLN 86

Query: 104 LLQTAYP-DFTLNSLTAHRFLLTATTIATKGLCDSFSTNAHYAKV--GGVRCHELNILEN 160
            L+   P D      T HR  L    ++ K   DS   N H+AK   G     ++N++E 
Sbjct: 87  KLKRILPKDAKGLPSTIHRLFLACLILSAKYHNDSSPLNKHWAKYTDGLFSLEDINLMER 146

Query: 161 DFLKRVNYRIIPRDHNIML 179
             L  +N+ +     +++L
Sbjct: 147 QLLNLLNWDLRVEQEDLIL 165

>KNAG0B02930 Chr2 (563319..564257) [939 bp, 312 aa] {ON} Anc_7.289
           YDL179W
          Length = 312

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 55/123 (44%), Gaps = 6/123 (4%)

Query: 54  VSKIPENQITLTRYH---SKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYP 110
           ++K+ E+ +T  R     S  PP  ++  +   L   S +    LM S  Y+  L+   P
Sbjct: 23  LAKVTESIVTHLRPEVRSSDKPPIPTLVEFIAGLVTNSKVGTPTLMASTVYLVRLKDILP 82

Query: 111 DFTLN-SLTAHRFLLTATTIATKGLCDSFSTNAHYAKVGG--VRCHELNILENDFLKRVN 167
              +    T HR  L    IA K L D+   N H++K     +   E+NI+E + L  + 
Sbjct: 83  PNIIGIETTRHRLFLGCLIIAAKTLNDNSPLNKHWSKHTNNLLPNREINIIERELLSYLR 142

Query: 168 YRI 170
           +R+
Sbjct: 143 WRV 145

>Ecym_3535 Chr3 (1015509..1016621) [1113 bp, 370 aa] {ON} similar to
           Ashbya gossypii AEL195W
          Length = 370

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 24/105 (22%), Positives = 53/105 (50%), Gaps = 3/105 (2%)

Query: 76  SIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYP-DFTLNSLTAHRFLLTATTIATKGL 134
           S+  +  ++ +++++    L+T++ Y++ L+   P D T    T+HR  L    ++ K  
Sbjct: 115 SLTTFIAKIVRYTNVYTATLLTTVVYLNKLKKVLPKDATGIPSTSHRIFLACLILSAKFH 174

Query: 135 CDSFSTNAHYAKV--GGVRCHELNILENDFLKRVNYRIIPRDHNI 177
            DS   N H+ +   G     ++N++E   LK  ++ I   +H++
Sbjct: 175 NDSSPLNKHWTEYTDGLFTIQDVNLMERQLLKLFDWNIRVSEHDL 219

>Skud_4.79 Chr4 (134241..135170) [930 bp, 309 aa] {ON} YDL179W
           (REAL)
          Length = 309

 Score = 39.3 bits (90), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 31/136 (22%), Positives = 65/136 (47%), Gaps = 10/136 (7%)

Query: 39  ISRMLVSLIAINENSVSKIPENQITLTRYHS-KIPPNISIFNYFIRLTKFSSLEHCVLMT 97
           +S+ ++  +A +  S+ +I +N     + H  ++P    +F +  ++   S+++   LM 
Sbjct: 15  VSQEMIQFLATSTASIIQIRQNS---NQTHGCQLP---ELFTFIKKVVIQSNVQTPTLMA 68

Query: 98  SLYYIDLLQTAYPDFTLN-SLTAHRFLLTATTIATKGLCDSFSTNAHYAKV--GGVRCHE 154
           +  Y++ L+   P        T HR  L    +A K L DS   N H++    G ++  E
Sbjct: 69  TTVYLNKLKNIIPTNVYGIETTRHRIFLGCLILAAKTLNDSSPWNKHWSTYTEGLLKVRE 128

Query: 155 LNILENDFLKRVNYRI 170
           +N +E + L+  N+ +
Sbjct: 129 VNTIERELLEYFNWDV 144

>CAGL0J09328g Chr10 (920703..921596) [894 bp, 297 aa] {ON} similar
           to uniprot|P25693 Saccharomyces cerevisiae YDL127w PCL2
           and similar to uniprot|Q12477 Saccharomyces cerevisiae
           YDL179w PCL9
          Length = 297

 Score = 38.9 bits (89), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 32/136 (23%), Positives = 67/136 (49%), Gaps = 9/136 (6%)

Query: 39  ISRMLVSLIAINENSVSKIPENQITLTRYHSKIP-PNISIFNYFIRLTKFSSLEHCVLMT 97
           +S+ +++ +A +  S+ ++ E   T +     IP P + +F    +L K+S+++   LM 
Sbjct: 15  VSQEMITYLARSTESIIQVRE---THSMIDVAIPAPKLELF--IKKLVKYSNVQTPTLMA 69

Query: 98  SLYYIDLLQTAYPDFTLN-SLTAHRFLLTATTIATKGLCDSFSTNAHYAKV--GGVRCHE 154
           +  ++  L++  P        T HR  L    ++ K L DS   N H+A+   G +   E
Sbjct: 70  TTVFLTKLRSIIPANVYGIETTRHRIFLGCLILSAKTLNDSSPLNKHWAQYTDGLLHLKE 129

Query: 155 LNILENDFLKRVNYRI 170
           +N +E + L+  ++ +
Sbjct: 130 VNTIERELLEYFDWNL 145

>Skud_4.128 Chr4 (230632..231558) [927 bp, 308 aa] {ON} YDL127W
           (REAL)
          Length = 308

 Score = 38.1 bits (87), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 34/135 (25%), Positives = 60/135 (44%), Gaps = 7/135 (5%)

Query: 39  ISRMLVSLIAINENSVSKIPENQITLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTS 98
           +S+ +V  +A    S+ KI +   ++       PP     N  I   K S+++   LM +
Sbjct: 15  VSKEMVQYLASTTASIIKIKKTN-SMIDIALPAPPLTKFINGLI---KHSNVQTPTLMAT 70

Query: 99  LYYIDLLQTAYPDFTLN-SLTAHRFLLTATTIATKGLCDSFSTNAHYAKV--GGVRCHEL 155
             Y+  L++  P        T HR  L    +A K L DS   N H+A+   G +   E+
Sbjct: 71  SVYLAKLRSIIPSNVYGIETTRHRIFLGCLILAAKTLNDSSPLNKHWAEYTDGLLVLREV 130

Query: 156 NILENDFLKRVNYRI 170
           N +E + L+  ++ +
Sbjct: 131 NTIERELLEYFDWDV 145

>KLLA0E13223g Chr5 (1170139..1170987) [849 bp, 282 aa] {ON} similar
           to uniprot|P24867 Saccharomyces cerevisiae YNL289W PCL1
           Pho85 cyclin of the Pcl1 2-like subfamily involved in
           entry into the mitotic cell cycle and regulation of
           morphogenesis localizes to sites of polarized cell
           growth
          Length = 282

 Score = 37.7 bits (86), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 25/104 (24%), Positives = 49/104 (47%), Gaps = 6/104 (5%)

Query: 68  HSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYP-DFTLNSLTAHRFLLTA 126
           H+ +P   S+  +  RL +++++    L+T++ Y++ L+   P D      T HR  L  
Sbjct: 53  HNGVP---SLMTFISRLVRYTNVYTSTLLTTVVYLNRLRELLPSDAAGLPTTCHRIFLAC 109

Query: 127 TTIATKGLCDSFSTNAHYAKV--GGVRCHELNILENDFLKRVNY 168
             ++ K   DS   N H+ K   G     ++N++E   L+   +
Sbjct: 110 LILSAKYHNDSSPLNKHWTKYTDGMFTLRDVNLMERQLLQLFEW 153

>TPHA0A00580 Chr1 (101866..102735) [870 bp, 289 aa] {ON} Anc_3.70
           YNL289W
          Length = 289

 Score = 37.4 bits (85), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 29/115 (25%), Positives = 56/115 (48%), Gaps = 8/115 (6%)

Query: 69  SKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSL--TAHRFLLTA 126
           SK+P   S+  +  +L +++++    L+T+  Y+  LQ   P    N L  T HR  L  
Sbjct: 53  SKLP---SLKTFITKLVRYTNVYTSTLLTTACYLKKLQRILPK-DANGLPSTIHRIFLAC 108

Query: 127 TTIATKGLCDSFSTNAHYAKV--GGVRCHELNILENDFLKRVNYRIIPRDHNIML 179
             ++ K   DS   N H+A+   G     ++N++E   L  +N+ I  ++ ++ +
Sbjct: 109 LILSAKFHNDSSPLNKHWAEYTDGLFSLEDVNLMEVQLLALLNWDIRIKEEDLFI 163

>Suva_16.87 Chr16 (146154..147659) [1506 bp, 501 aa] {ON} YPL219W
           (REAL)
          Length = 501

 Score = 37.7 bits (86), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 42/174 (24%), Positives = 72/174 (41%), Gaps = 18/174 (10%)

Query: 34  DLVVLISRMLVSLIAINENSVSKIPENQITLTRYHSKIPPNISIFNYFIRLTKFSSLEHC 93
           DL++ +S+     I  N N ++   E+      +  K PP++S  ++  R+         
Sbjct: 336 DLILQLSKK----IDENANILAISAEDPQKFVNFTMKNPPSLSFKDFIDRIQNKCMFGAI 391

Query: 94  VLMTSLYYIDLLQTAYPDF--------TLNSLTAHRFLLTATTIATKGLCDSFSTNAHYA 145
           V + + Y + L+     +          L     HR +++   IATK L D   +  +  
Sbjct: 392 VYLGATYLLQLVFLTRDELDGPIKLKAKLQEDQTHRIIISTIRIATKLLEDFVHSQNYIC 451

Query: 146 KVGGVRCHELNILENDFLKRVNYRIIPRDHNIMLCSIEQKQKKFVID-KNALGS 198
           KV G+    L  LE  FL  VN+     D  ++ C   +K    + D + ALGS
Sbjct: 452 KVFGISKRLLTKLEISFLASVNF-----DGLMITCEKLEKTSHILDDTRQALGS 500

>ZYRO0C02068g Chr3 complement(163475..164467) [993 bp, 330 aa] {ON}
           similar to uniprot|P24867 Saccharomyces cerevisiae
           YNL289W PCL1 Pho85 cyclin of the Pcl1 2-like subfamily
           involved in entry into the mitotic cell cycle and
           regulation of morphogenesis localizes to sites of
           polarized cell growth
          Length = 330

 Score = 37.4 bits (85), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 26/103 (25%), Positives = 51/103 (49%), Gaps = 6/103 (5%)

Query: 69  SKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYP-DFTLNSLTAHRFLLTAT 127
           SK+P   S+ ++  RL + +++    L+ +  Y++ L+   P D +    T HR  L   
Sbjct: 83  SKLP---SLMSFISRLVRHTNVYTSTLLVTACYLNRLKCILPKDASGLPSTIHRMFLACL 139

Query: 128 TIATKGLCDSFSTNAHYAKV--GGVRCHELNILENDFLKRVNY 168
            ++ K   DS   N H+AK   G     ++N++E   ++ +N+
Sbjct: 140 ILSAKFHNDSSPLNKHWAKYTDGLFSVEDVNLMERQLVQLLNW 182

>YPL219W Chr16 (136750..138228) [1479 bp, 492 aa] {ON}  PCL8Cyclin,
           interacts with Pho85p cyclin-dependent kinase (Cdk) to
           phosphorylate and regulate glycogen synthase, also
           activates Pho85p for Glc8p phosphorylation
          Length = 492

 Score = 36.2 bits (82), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 37/157 (23%), Positives = 65/157 (41%), Gaps = 14/157 (8%)

Query: 50  NENSVSKIPENQITLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAY 109
           N N+++   E+      +  K PP++S  ++  R+         V + + Y + L+    
Sbjct: 339 NANTLAISSEDPQKFVNFVMKNPPSLSFRDFIDRIQNKCMFGAVVYLGATYLLQLVFLTR 398

Query: 110 PDF--------TLNSLTAHRFLLTATTIATKGLCDSFSTNAHYAKVGGVRCHELNILEND 161
            +          L    AHR +++   IATK L D   +  +  KV G+    L  LE  
Sbjct: 399 DEMDGPIKLKAKLQEDQAHRIIISTIRIATKLLEDFVHSQNYICKVFGISKRLLTKLEIS 458

Query: 162 FLKRVNYRIIPRDHNIMLCSIEQKQKKFVID-KNALG 197
           F+  VN+     D  ++ C   +K    + D + ALG
Sbjct: 459 FMASVNF-----DGLMITCEKLEKTLHILDDTRQALG 490

>TDEL0E00790 Chr5 (163333..164097) [765 bp, 254 aa] {ON} Anc_3.70
           YNL289W
          Length = 254

 Score = 35.0 bits (79), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 25/102 (24%), Positives = 50/102 (49%), Gaps = 6/102 (5%)

Query: 70  KIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYP-DFTLNSLTAHRFLLTATT 128
           K+P   S+ ++  RL + +++    L+T+  Y++ L+   P D +    T HR  L    
Sbjct: 48  KLP---SLMSFISRLVRHTNVYTSTLLTTACYLNKLKCILPKDASGLPSTVHRIFLACLI 104

Query: 129 IATKGLCDSFSTNAHYAKVGG--VRCHELNILENDFLKRVNY 168
           ++ K   DS   N H+AK         ++N++E   ++ +N+
Sbjct: 105 LSAKFHNDSSPLNRHWAKYTDELFTLEDINLMERQLIQLLNW 146

>ZYRO0B14410g Chr2 complement(1170689..1172413) [1725 bp, 574 aa]
           {ON} highly similar to uniprot|Q04636 Saccharomyces
           cerevisiae YML069W POB3 facilitates RNA Polymerase II
           transcription elongation
          Length = 574

 Score = 35.4 bits (80), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 37/69 (53%), Gaps = 10/69 (14%)

Query: 118 TAHRFLLTATTIAT----KGLCDSF-----STNAHYAKVGGVRCHELNILENDFLKRVNY 168
           T   FLL AT ++T    +G C  F     + N    ++ G    + N+++NDF +R N 
Sbjct: 41  TKQPFLLPATELSTVQWSRG-CRGFELKVNTKNQGVVQLDGFAPDDFNLIKNDFHRRFNV 99

Query: 169 RIIPRDHNI 177
           ++ P++H++
Sbjct: 100 QVEPKEHSL 108

>NDAI0A06050 Chr1 complement(1372672..1373532) [861 bp, 286 aa] {ON}
           Anc_3.70
          Length = 286

 Score = 35.0 bits (79), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 46/96 (47%), Gaps = 6/96 (6%)

Query: 67  YHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYP-DFTLNSLTAHRFLLT 125
           Y  ++P   S+  +   L +++++    L+T++ Y++ L+   P D T    T HR  L 
Sbjct: 48  YQPRLP---SLMTFITNLVRYTNVYTPTLLTTVCYLNKLKRLLPKDATGLPSTIHRIFLA 104

Query: 126 ATTIATKGLCDSFSTNAHYAKV--GGVRCHELNILE 159
              ++ K   DS   N H+ K   G     ++N++E
Sbjct: 105 CLILSAKFHNDSSPLNKHWVKYTDGLFTLEDVNLME 140

>NCAS0A09870 Chr1 complement(1974028..1974912) [885 bp, 294 aa] {ON}
           Anc_3.70
          Length = 294

 Score = 34.7 bits (78), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 43/87 (49%), Gaps = 3/87 (3%)

Query: 76  SIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYP-DFTLNSLTAHRFLLTATTIATKGL 134
           S+  +  RL +++++    L+T++ Y++ L+   P D T    T HR  L    ++ K  
Sbjct: 54  SLMTFITRLVRYTNVYTPTLLTTVCYLNKLKRILPKDATGLPSTIHRIFLACLILSAKFH 113

Query: 135 CDSFSTNAHYAKV--GGVRCHELNILE 159
            DS   N H+ K   G     ++N++E
Sbjct: 114 NDSSPLNKHWVKYTDGLFTLEDVNLME 140

>AEL195W Chr5 (266347..267060) [714 bp, 237 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL289W (PCL1)
          Length = 237

 Score = 34.3 bits (77), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 53/117 (45%), Gaps = 9/117 (7%)

Query: 76  SIFNYFIRLTKFSSLEHCVLMT-SLYYIDLLQTAYPDFTLNSLTAHRFLLTATTIATKGL 134
           SI  +  RL +++++    L+T ++Y   L      D T    TAHR  L    ++ K  
Sbjct: 53  SIHMFITRLVRYTNVYTATLLTTAVYLERLRLLLPRDATGIPSTAHRIFLACLILSAKFH 112

Query: 135 CDSFSTNAHYAKV--GGVRCHELNILENDFLK------RVNYRIIPRDHNIMLCSIE 183
            DS   N H+ K   G     ++N++E   L+      RV +R + RD   +L  I+
Sbjct: 113 NDSSPLNKHWTKYTDGLFTTQDVNLMERQLLRLFDWNVRVGHRDLCRDLAPLLAPIK 169

>NCAS0D04070 Chr4 (764711..766132) [1422 bp, 473 aa] {ON} Anc_6.236
          Length = 473

 Score = 34.7 bits (78), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 26/117 (22%), Positives = 49/117 (41%), Gaps = 8/117 (6%)

Query: 51  ENSVSKIPENQITLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYP 110
           E S+ +  +  I  + +  K PP++S  ++  R+      +  V + + Y +  L     
Sbjct: 324 ELSIDEPLDEMIAFSNFKMKSPPSLSYADFIQRIQNKCEYDPHVYLIATYLLQTLLLIRE 383

Query: 111 D--------FTLNSLTAHRFLLTATTIATKGLCDSFSTNAHYAKVGGVRCHELNILE 159
           +        F       HR ++    IATK L D   ++ ++ KV G+    L+ LE
Sbjct: 384 EHSRKLKLRFKFEKSDVHRLIIATVRIATKLLEDHVHSHEYFCKVSGISKKLLSKLE 440

>TBLA0B08440 Chr2 complement(2023101..2023907) [807 bp, 268 aa] {ON}
           Anc_3.70 YNL289W
          Length = 268

 Score = 33.9 bits (76), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 24/106 (22%), Positives = 53/106 (50%), Gaps = 3/106 (2%)

Query: 76  SIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYP-DFTLNSLTAHRFLLTATTIATKGL 134
           S+  +  RL  ++++    L+T+  Y++ L+   P + +    T HR  L    ++ K  
Sbjct: 46  SLQTFITRLVNYTNVPSGTLLTTAVYLNRLKQLLPAEASGIQSTRHRIFLACLILSAKYN 105

Query: 135 CDSFSTNAHYAK-VGGVRC-HELNILENDFLKRVNYRIIPRDHNIM 178
            DS   N H+      + C +++N++E   LK +N+ +   +H+++
Sbjct: 106 NDSSPLNIHWMNHTNDLFCLNDINLMERQLLKLLNWDLSITEHDLI 151

>Smik_6.424 Chr6 complement(686097..687575) [1479 bp, 492 aa] {ON}
           YPL219W (REAL)
          Length = 492

 Score = 33.9 bits (76), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 30/127 (23%), Positives = 52/127 (40%), Gaps = 8/127 (6%)

Query: 50  NENSVSKIPENQITLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAY 109
           N N ++   E+      +  K PP++S  ++  R+         V + + Y + L+    
Sbjct: 339 NANILAISSEDPQKFVNFVMKNPPSLSFRDFIDRIQNKCMFGAVVYLGATYLLQLVFLTR 398

Query: 110 PDFT--------LNSLTAHRFLLTATTIATKGLCDSFSTNAHYAKVGGVRCHELNILEND 161
            +          L    AHR +++   IATK L D   +  +  KV G+    L  LE  
Sbjct: 399 DEMNGPIKLKTKLQEDQAHRIIISTIRIATKLLEDFVHSQNYICKVFGISKRLLTKLEIS 458

Query: 162 FLKRVNY 168
           F+  VN+
Sbjct: 459 FMACVNF 465

>KLTH0H03674g Chr8 (333755..335209) [1455 bp, 484 aa] {ON} weakly
           similar to uniprot|P53124 Saccharomyces cerevisiae
           YGL134W PCL10 Pho85p cyclin recruits activates and
           targets Pho85p cyclin-dependent protein kinase to its
           substrate
          Length = 484

 Score = 33.5 bits (75), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 25/103 (24%), Positives = 51/103 (49%), Gaps = 6/103 (5%)

Query: 73  PNISIFNYFIRL-TKFS-----SLEHCVLMTSLYYIDLLQTAYPDFTLNSLTAHRFLLTA 126
           P ++  +Y  RL  KFS      L    L+ +L+   + +  +    L+    HR ++ +
Sbjct: 358 PTLAYEDYLKRLHCKFSFAPIVYLTAAHLLQTLFLTRVDEELHCKHHLDPRQVHRLVIAS 417

Query: 127 TTIATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYR 169
             +ATK L D   ++++++++ G+    L  LE  FL+ +N+ 
Sbjct: 418 IRLATKLLEDCVHSHSYFSRICGISKKLLTKLEVAFLECLNFE 460

>KLLA0F05654g Chr6 (552056..552991) [936 bp, 311 aa] {ON} weakly
           similar to uniprot|P25693 Saccharomyces cerevisiae
           YDL127W PCL2 G1 cyclin associates with Pho85p
           cyclin-dependent kinase (Cdk) to contribute to entry
           into the mitotic cell cycle essential for cell
           morphogenesis localizes to sites of polarized cell
           growth
          Length = 311

 Score = 33.1 bits (74), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 34/149 (22%), Positives = 64/149 (42%), Gaps = 19/149 (12%)

Query: 26  DFNK-CSRTDLVVLISRMLVSLIAINENSVSKIPENQITLTRYHSKIPPNISIFNYFIRL 84
            FNK     ++V  ++    S+I+IN+  V           R+ S     +S+ ++   L
Sbjct: 9   QFNKQVVNLEMVHFLAATTASVISINDTDV-----------RHGS----TVSLVDFIKSL 53

Query: 85  TKFSSLEHCVLMTSLYYIDLLQTAYP-DFTLNSLTAHRFLLTATTIATKGLCDSFSTNAH 143
            + S+++   LM +  Y+  L++  P D      T HR  +    +A K L DS   N H
Sbjct: 54  IRHSNVQTPTLMATTVYLTKLRSILPHDVCGIETTRHRIFIGCLILAAKNLNDSSPLNKH 113

Query: 144 YAKV--GGVRCHELNILENDFLKRVNYRI 170
           +     G     ++N +E + L   ++ +
Sbjct: 114 WTNYTDGLFTLEDVNTIERELLSLFSWNL 142

>Kwal_56.24151 s56 complement(874353..875795) [1443 bp, 480 aa] {ON}
           YPL219W (PCL8) - cyclin (Pho85p) [contig 165] FULL
          Length = 480

 Score = 33.5 bits (75), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 30/137 (21%), Positives = 61/137 (44%), Gaps = 17/137 (12%)

Query: 72  PPNISIFN-----------YFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPD------FTL 114
           PP ++ FN           Y  RL    S    V +T+ + +  L     D      + L
Sbjct: 342 PPQLATFNMDSTPTLAYEEYLQRLHCKFSFAPIVYLTAAHLLQSLFLTRKDNKLCCKYHL 401

Query: 115 NSLTAHRFLLTATTIATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRD 174
           ++   HR ++ +  +ATK L D   ++  ++++ G+    L  LE  FL  +N+  +   
Sbjct: 402 DNCQVHRLIIASIRLATKLLEDCVHSHTCFSRICGISKKLLTKLEIAFLNCINFEGLKIT 461

Query: 175 HNIMLCSIEQKQKKFVI 191
           ++ +L + + +Q+  V+
Sbjct: 462 NHSLLQAAQVQQELSVL 478

>Kwal_23.5231 s23 complement(1069167..1069937) [771 bp, 256 aa] {ON}
           YNL289W (PCL1) - G(sub)1 cyclin that associates with
           PHO85 [contig 8] FULL
          Length = 256

 Score = 32.7 bits (73), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 44/87 (50%), Gaps = 3/87 (3%)

Query: 76  SIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYP-DFTLNSLTAHRFLLTATTIATKGL 134
           S+  +  RL +++++    L+T+  Y++ L+   P D      T+HR  L    ++ K  
Sbjct: 59  SLMTFVTRLVRYTNVYTSTLLTATCYLEKLRRLLPRDAHGLPSTSHRIFLACLILSAKFH 118

Query: 135 CDSFSTNAHYAK-VGGVRCHE-LNILE 159
            DS   N H+A    G+ C E +N++E
Sbjct: 119 NDSSPQNKHWAAYTDGLFCLEDVNLME 145

>TPHA0A03250 Chr1 (717085..717954) [870 bp, 289 aa] {ON} Anc_7.289
           YDL179W
          Length = 289

 Score = 32.7 bits (73), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 26/55 (47%), Gaps = 2/55 (3%)

Query: 118 TAHRFLLTATTIATKGLCDSFSTNAHYAKVGGVRCH--ELNILENDFLKRVNYRI 170
           T HR  L    ++ K L DS   N H+AK      H  E+N +E + L   ++ +
Sbjct: 91  TRHRIFLGCLILSAKSLNDSSPLNKHWAKYTESYIHLREVNTIERELLNYFDWNV 145

>KAFR0A08280 Chr1 complement(1661106..1661831) [726 bp, 241 aa] {ON}
           Anc_3.70 YNL289W
          Length = 241

 Score = 32.0 bits (71), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 31/159 (19%), Positives = 69/159 (43%), Gaps = 21/159 (13%)

Query: 25  TDFNKCSRTDLVVLISRMLVSLIAINENSVSKIPENQITLTRYHSKIPPNISIFN----- 79
           +D++K  R  +   +++ +++L+           EN + L R +   PP+  +++     
Sbjct: 2   SDYSKALRVLMKSPVTQEMITLLVTTT-------ENVMDLKRTYPT-PPSSPLYDEEDEL 53

Query: 80  -----YFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLN-SLTAHRFLLTATTIATKG 133
                +  +L +++ +    L+ ++ Y++ L+   P        T HR  L    I+ K 
Sbjct: 54  PTLREFICKLVEYTHVYTPTLLMTISYLNRLRRILPKGAAGIPSTLHRIFLACLIISAKN 113

Query: 134 LCDSFSTNAHYAKV--GGVRCHELNILENDFLKRVNYRI 170
             DS   N H+ K   G     ++N++E   L  +N+ +
Sbjct: 114 HNDSSPLNRHWTKYTDGLFTLEDVNLMERHLLDLLNWNL 152

>KAFR0C01560 Chr3 complement(320148..320951) [804 bp, 267 aa] {ON}
           Anc_3.70 YNL289W
          Length = 267

 Score = 31.6 bits (70), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 42/87 (48%), Gaps = 3/87 (3%)

Query: 76  SIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYP-DFTLNSLTAHRFLLTATTIATKGL 134
           S+  +  RL +++++    L+T++ Y++ L+   P D      T HR  L    I+ K  
Sbjct: 59  SLRTFITRLVRYTNVYTPTLLTTVCYLNKLKRILPKDAKGLPSTIHRLFLACLIISAKFH 118

Query: 135 CDSFSTNAHYAKV--GGVRCHELNILE 159
            DS   N H+ +   G     ++N++E
Sbjct: 119 NDSSPLNKHWTRYTDGLFSLEDINLME 145

>NDAI0C01980 Chr3 complement(445212..445892) [681 bp, 226 aa] {ON}
           Anc_5.347 YHR071W
          Length = 226

 Score = 31.6 bits (70), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 52/104 (50%), Gaps = 12/104 (11%)

Query: 76  SIFNYFIRLTKFS-SLEHCVLMTSLYY------IDLLQTAYPDFTLNSLTAHRFLLTATT 128
           SI  Y + + K S S  + V++ S Y+      + L Q   P+F      + R  L+   
Sbjct: 87  SIKTYLMEILKRSQSSRNNVIVASFYFQKLYNSVQLNQDPNPEFVH---CSKRIFLSCLI 143

Query: 129 IATKGLCD-SFSTNAHYAKVGGVRCHELNILENDFLKRVNYRII 171
           ++ K L D +FS  A ++ + G+   +L+ILE   L R+NY ++
Sbjct: 144 LSHKFLNDKTFSMKA-WSLISGISKRDLSILERWCLMRLNYHLV 186

>NCAS0B03700 Chr2 complement(661199..663811) [2613 bp, 870 aa]
          {ON} Anc_8.287 YDR127W
          Length = 870

 Score = 32.0 bits (71), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 34/74 (45%), Gaps = 11/74 (14%)

Query: 10 ENMHEDQGIQKVILPTDFNKCSRTDLVVLISRMLVSLIAINENSVSKIPENQITLTRYHS 69
          E +H    I + I+ T    C  +  V+           +N+ ++SK+P  Q  +  + S
Sbjct: 13 ETIHVGYDIHEHIIDTIITGCKSSTYVI-----------VNDTNLSKVPYFQQFIKEFES 61

Query: 70 KIPPNISIFNYFIR 83
          K+P +  + NY I+
Sbjct: 62 KLPADTRVLNYVIK 75

>KLTH0A01584g Chr1 (141289..142134) [846 bp, 281 aa] {ON} similar to
           uniprot|P24867 Saccharomyces cerevisiae YNL289W PCL1
           Pho85 cyclin of the Pcl1 2-like subfamily involved in
           entry into the mitotic cell cycle and regulation of
           morphogenesis localizes to sites of polarized cell
           growth
          Length = 281

 Score = 31.2 bits (69), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 43/87 (49%), Gaps = 3/87 (3%)

Query: 76  SIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYP-DFTLNSLTAHRFLLTATTIATKGL 134
           S+  +  RL +++++    L+T+  Y++ L+   P D      T HR  L    ++ K  
Sbjct: 87  SLMTFITRLVRYTNVYTSTLLTATCYLEKLRRLLPRDAHGLPSTGHRIFLACLILSAKYH 146

Query: 135 CDSFSTNAHYAK-VGGVRC-HELNILE 159
            DS   N H+A    G+ C  ++N++E
Sbjct: 147 NDSSPQNKHWAAYTDGLFCLDDVNLME 173

>Skud_7.139 Chr7 (260060..261364) [1305 bp, 434 aa] {ON} YGL134W
           (REAL)
          Length = 434

 Score = 31.2 bits (69), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 29/138 (21%), Positives = 61/138 (44%), Gaps = 12/138 (8%)

Query: 34  DLVVLISRMLVSLIAINENSVSKIPENQITLTRY---HSKIPPNISIFNYFIRLTKFSSL 90
           D +   S  +  L+ ++++    I +N +    Y   + K  P++S  ++  R+      
Sbjct: 264 DALANFSETIELLLKLSDDEKCTISKNDVEKKEYANFYMKSKPSLSSVDFLRRIQDKCEY 323

Query: 91  EHCVLMTSLYYIDLLQTAYPDFTLNSL---------TAHRFLLTATTIATKGLCDSFSTN 141
           E  V + + + +D L     +   N+L           HR ++ +  ++TK L D   ++
Sbjct: 324 EPAVYLVATFLMDTLFLTRNERNNNALQLKLKLQEKEVHRVIIASVRLSTKLLEDFVHSH 383

Query: 142 AHYAKVGGVRCHELNILE 159
            +++KV GV    L+ LE
Sbjct: 384 EYFSKVCGVSKRLLSKLE 401

>Suva_7.130 Chr7 (251870..253198) [1329 bp, 442 aa] {ON} YGL134W
           (REAL)
          Length = 442

 Score = 30.4 bits (67), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 24/112 (21%), Positives = 47/112 (41%), Gaps = 7/112 (6%)

Query: 59  ENQITLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPD------- 111
           E +     ++ K  P++S  ++  R+      E  V + + + +D +     D       
Sbjct: 301 ETEKEYANFYMKSKPSLSSVDFLKRIQDKCEYESTVYLVATFLMDTIYLTRNDNDVLQLK 360

Query: 112 FTLNSLTAHRFLLTATTIATKGLCDSFSTNAHYAKVGGVRCHELNILENDFL 163
             L     HR ++    ++TK L D   ++ +++KV GV    L+ LE   L
Sbjct: 361 LKLQEKEIHRMIIATVRLSTKLLEDFVHSHEYFSKVCGVSKRLLSKLEVSLL 412

>NDAI0C04300 Chr3 (981107..981829) [723 bp, 240 aa] {ON} 
          Length = 240

 Score = 30.0 bits (66), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 49/107 (45%), Gaps = 11/107 (10%)

Query: 76  SIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAY--------PDFTLNSLTAHRFLLTAT 127
           S+ ++   +TK S  +  +L+ + YY   L T+         P+F   +  A R  LT  
Sbjct: 94  SLKSFINEITKRSKSKRNILLLATYYFQKLYTSLSTCPVSTIPEF---AFCAKRSFLTCI 150

Query: 128 TIATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRD 174
            IA K L DS  +   ++ + G+    L+ +E   L +++Y +   D
Sbjct: 151 IIAHKYLNDSTFSMESWSLISGLNKKALSTIERWCLGKLDYNLFVDD 197

>YDR515W Chr4 (1473429..1474772) [1344 bp, 447 aa] {ON}  SLF1RNA
           binding protein that associates with polysomes; proposed
           to be involved in regulating mRNA translation; involved
           in the copper-dependent mineralization of copper sulfide
           complexes on cell surface in cells cultured in copper
           salts
          Length = 447

 Score = 30.4 bits (67), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 31/59 (52%), Gaps = 3/59 (5%)

Query: 152 CHELNILENDFLKRVNYRIIPRDHNIMLCSIEQKQKKFVIDKNALGSFDLDSYSYTDRP 210
             + N LEN F++R N+     + N      + + +K+ I+K  LG  DLD+YSY   P
Sbjct: 360 ADDFNPLENYFIRRENWAEYAMESN--FDENDDETEKYNIEK-LLGPNDLDNYSYMGYP 415

>KNAG0F01870 Chr6 (356849..358300) [1452 bp, 483 aa] {ON} Anc_6.236
           YGL134W
          Length = 483

 Score = 30.4 bits (67), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 25/109 (22%), Positives = 50/109 (45%), Gaps = 14/109 (12%)

Query: 56  KIPENQIT------LTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLL---Q 106
           + PEN          +R+  K  P++S  ++  R+      +  V +++ Y + +L   +
Sbjct: 334 RCPENSAVKSEHDLCSRFIMKNIPSLSFVDFIKRIHDKCHFDTPVYLSATYLLQILFLER 393

Query: 107 TAYPD-----FTLNSLTAHRFLLTATTIATKGLCDSFSTNAHYAKVGGV 150
           +A  +     F L     HR ++    I+TK L D   ++ +++KV GV
Sbjct: 394 SAESNSLELKFKLQRDGLHRLIIALVRISTKLLEDQIHSHDYFSKVCGV 442

>ZYRO0C10054g Chr3 complement(760918..764043) [3126 bp, 1041 aa]
           {ON} similar to uniprot|P08004 Saccharomyces cerevisiae
           YNL192W CHS1 Chitin synthase I requires activation from
           zymogenic form in order to catalyze the transfer of N-
           acetylglucosamine (GlcNAc) to chitin required for
           repairing the chitin septum during cytokinesis
           transcription activated by mating factor
          Length = 1041

 Score = 30.4 bits (67), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 20/91 (21%), Positives = 44/91 (48%), Gaps = 6/91 (6%)

Query: 111 DFTLNSLTAHRFLLTATTIATKGLCDSFSTNAHYAKVGGVRCHELNILENDF-LKRVNYR 169
           +F  +S  +   L   T+++++ + + F     + +   V C    I EN+F ++++NY 
Sbjct: 297 NFVFDSPISASLLRQYTSVSSEKVSNEFK----FMRYQAVTCEPDQIEENNFTVRQLNY- 351

Query: 170 IIPRDHNIMLCSIEQKQKKFVIDKNALGSFD 200
           I+PR+  +M+      +  F++     G  D
Sbjct: 352 IVPRETELMIVITMYNEDHFLLGNTLKGVMD 382

>NCAS0D01640 Chr4 (309081..311141) [2061 bp, 686 aa] {ON} Anc_5.117
           YLR047C
          Length = 686

 Score = 30.0 bits (66), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 32/58 (55%), Gaps = 5/58 (8%)

Query: 148 GGVRCHELNILENDFLKRVNYRIIPRDHNIMLCSIEQKQKKFVIDKNALGSFDLDSYS 205
           G VR   + I+EN+FLKR  +++IP  H   + S+       +I +N  G+F L S S
Sbjct: 306 GHVR---IQIVENNFLKRWFHKLIPLQHPYTISSLPTDDTVKLIIRN--GNFPLKSNS 358

>CAGL0J10846g Chr10 complement(1058824..1059513) [690 bp, 229 aa]
           {ON} similar to uniprot|P38794 Saccharomyces cerevisiae
           YHR071w PCL5 cyclin like protein interacting with PHO85P
          Length = 229

 Score = 29.6 bits (65), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 47/100 (47%), Gaps = 11/100 (11%)

Query: 76  SIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAY------PDFTLNSLTAHRFLLTATTI 129
           SI N+   +TK + +   +L+ +  Y D L  ++      P+F   +    R LL    +
Sbjct: 72  SIANFLKEVTKRAHISRDILLLASIYFDKLIKSHEGAINVPEF---AYCGKRLLLVCIIL 128

Query: 130 ATKGLCD-SFSTNAHYAKVGGVRCHELNILENDFLKRVNY 168
           A K   D +FS    + +V G+    + I+E   LK++NY
Sbjct: 129 AHKFSNDITFSMRV-WTQVSGLPTRSIAIMERWCLKQLNY 167

>Smik_7.138 Chr7 (249640..250953) [1314 bp, 437 aa] {ON} YGL134W
           (REAL)
          Length = 437

 Score = 29.6 bits (65), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 23/106 (21%), Positives = 46/106 (43%), Gaps = 9/106 (8%)

Query: 67  YHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLL---------QTAYPDFTLNSL 117
           ++ K  P++S  ++  R+      E  V + +++ I++L                 L   
Sbjct: 302 FYMKSKPSLSSVDFLKRIQDKCKYEPTVYLVAMFLIEMLFLTRNKNGDDGLQLKRKLKEK 361

Query: 118 TAHRFLLTATTIATKGLCDSFSTNAHYAKVGGVRCHELNILENDFL 163
             HR ++ A  ++TK L D   ++ +++KV G+    L  LE   L
Sbjct: 362 EVHRVIIAAVRLSTKLLEDYVHSHEYFSKVCGISKRLLTKLEVSLL 407

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 32,859,087
Number of extensions: 1514269
Number of successful extensions: 4928
Number of sequences better than 10.0: 133
Number of HSP's gapped: 5036
Number of HSP's successfully gapped: 134
Length of query: 291
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 182
Effective length of database: 40,982,805
Effective search space: 7458870510
Effective search space used: 7458870510
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)