Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_15.1686.27ON32732717220.0
Skud_15.1606.27ON32732716430.0
YOL002C (IZH2)6.27ON31731716200.0
Suva_15.1736.27ON32732715240.0
SAKL0E01474g6.27ON31128110501e-143
KNAG0M012406.27ON31428310341e-141
NCAS0H015106.27ON31328910081e-137
TDEL0G044206.27ON32231610071e-137
CAGL0E02519g6.27ON3152789981e-135
KAFR0G026506.27ON3212859811e-133
TBLA0E030606.27ON3193179611e-130
NDAI0F017406.27ON3133109491e-128
KLTH0C11044g6.27ON3153099441e-127
ZYRO0C07612g6.27ON3192789291e-125
Ecym_30316.27ON3283169291e-125
Kwal_56.224546.27ON3152909211e-124
TPHA0M002906.27ON3273179071e-121
KLLA0D01331g6.27ON3082999021e-121
Kpol_1032.96.27ON3182768991e-120
ACL002C6.27ON3292758761e-117
SAKL0C09218g3.90ON3143067151e-92
KLTH0C09504g3.90ON3193137072e-91
YDR492W (IZH1)3.90ON3163097012e-90
Skud_4.7663.90ON3163096993e-90
TPHA0A006403.90ON3273176961e-89
CAGL0G04631g3.90ON3163106942e-89
NDAI0A071603.90ON3303166943e-89
Suva_2.6683.90ON3153126923e-89
TDEL0D053403.90ON3163146891e-88
Smik_4.7693.90ON3162886863e-88
Kwal_56.227043.90ON3203046777e-87
ZYRO0B06556g3.90ON3183016752e-86
AFR337W3.90ON3173006716e-86
NCAS0I025703.90ON3143146691e-85
Ecym_35883.90ON3052776653e-85
KLLA0C12441g3.90ON3153106593e-84
Kpol_1053.263.90ON3243186586e-84
KAFR0A081303.90ON3193086316e-80
TBLA0B022903.90ON3263106257e-79
KNAG0K021603.90ON3233175934e-74
TBLA0B082553.90ON2962843843e-43
NCAS0C049203.90ON3263243182e-33
NDAI0G043003.90ON3182832851e-28
CAGL0I07491g3.90ON3012952112e-18
Suva_15.643.90ON3123111911e-15
Skud_12.915.197ON5422331895e-15
KLLA0F15510g5.197ON6223151887e-15
NDAI0I023305.197ON5782401852e-14
Smik_12.865.197ON5422341744e-13
Suva_10.1045.197ON5412381744e-13
KAFR0J006705.197ON5092321735e-13
NCAS0D026005.197ON5432901701e-12
YLR023C (IZH3)5.197ON5433191664e-12
KNAG0B051005.197ON5382441664e-12
AAL153C5.197ON4193331654e-12
Skud_15.533.90ON3123181636e-12
TPHA0E031205.197ON5692461656e-12
Smik_15.563.90ON3123161555e-11
ZYRO0B10538g5.197ON5312391532e-10
Kpol_2002.945.197ON5772371514e-10
KLTH0B03498g5.197ON5462781452e-09
Kwal_33.151225.197ON5662461442e-09
YOL101C (IZH4)3.90ON3123051423e-09
TDEL0E043205.197ON4502381424e-09
SAKL0G12980g5.197ON5632521344e-08
Ecym_71095.197ON5682411328e-08
CAGL0D03322g5.197ON5452381292e-07
TBLA0C060505.197ON4372971238e-07
KNAG0K006703.90ON3212041032e-04
Skud_5.1697.236ON53391790.26
KLTH0D09174g2.171ON1117107780.34
NDAI0E047807.241ON53585760.58
Suva_14.2322.171ON118581760.64
KLLA0B02541g4.288ON510106750.78
KAFR0L008907.241ON52779712.4
Suva_5.169na 1ON526110712.5
YER060W (FCY21)na 1ON528110702.7
CAGL0J02948g7.241ON51592693.7
Smik_5.1857.236ON49785694.1
NDAI0A025707.236ON43989684.5
Smik_5.184na 2ON53385684.9
Kpol_1066.487.241ON533100685.4
Smik_5.190na 1ON528110676.5
KNAG0L014907.241ON53494668.4
NCAS0E03160singletonON533108669.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_15.168
         (327 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_15.168 Chr15 complement(290724..291707) [984 bp, 327 aa] {O...   667   0.0  
Skud_15.160 Chr15 complement(283003..283986) [984 bp, 327 aa] {O...   637   0.0  
YOL002C Chr15 complement(323411..324364) [954 bp, 317 aa] {ON}  ...   628   0.0  
Suva_15.173 Chr15 complement(297915..298898) [984 bp, 327 aa] {O...   591   0.0  
SAKL0E01474g Chr5 (112382..113317) [936 bp, 311 aa] {ON} similar...   409   e-143
KNAG0M01240 Chr13 (226766..227710) [945 bp, 314 aa] {ON} Anc_6.2...   402   e-141
NCAS0H01510 Chr8 complement(287981..288922) [942 bp, 313 aa] {ON...   392   e-137
TDEL0G04420 Chr7 complement(802412..803380) [969 bp, 322 aa] {ON...   392   e-137
CAGL0E02519g Chr5 complement(242867..243814) [948 bp, 315 aa] {O...   389   e-135
KAFR0G02650 Chr7 complement(547561..548526) [966 bp, 321 aa] {ON...   382   e-133
TBLA0E03060 Chr5 (769031..769990) [960 bp, 319 aa] {ON} Anc_6.27...   374   e-130
NDAI0F01740 Chr6 (429141..430082) [942 bp, 313 aa] {ON} Anc_6.27      370   e-128
KLTH0C11044g Chr3 complement(908604..909551) [948 bp, 315 aa] {O...   368   e-127
ZYRO0C07612g Chr3 complement(578864..579823) [960 bp, 319 aa] {O...   362   e-125
Ecym_3031 Chr3 (61592..62578) [987 bp, 328 aa] {ON} similar to A...   362   e-125
Kwal_56.22454 s56 (136175..137122) [948 bp, 315 aa] {ON} YOL002C...   359   e-124
TPHA0M00290 Chr13 (57784..58767) [984 bp, 327 aa] {ON} Anc_6.27 ...   353   e-121
KLLA0D01331g Chr4 (117469..118395) [927 bp, 308 aa] {ON} similar...   352   e-121
Kpol_1032.9 s1032 (22700..23656) [957 bp, 318 aa] {ON} (22700..2...   350   e-120
ACL002C Chr3 complement(353449..354438) [990 bp, 329 aa] {ON} Sy...   342   e-117
SAKL0C09218g Chr3 (839747..840691) [945 bp, 314 aa] {ON} similar...   280   1e-92
KLTH0C09504g Chr3 complement(788442..789401) [960 bp, 319 aa] {O...   276   2e-91
YDR492W Chr4 (1434924..1435874) [951 bp, 316 aa] {ON}  IZH1Membr...   274   2e-90
Skud_4.766 Chr4 (1354630..1355580) [951 bp, 316 aa] {ON} YDR492W...   273   3e-90
TPHA0A00640 Chr1 complement(115042..116025) [984 bp, 327 aa] {ON...   272   1e-89
CAGL0G04631g Chr7 (441149..442099) [951 bp, 316 aa] {ON} similar...   271   2e-89
NDAI0A07160 Chr1 complement(1630482..1631474) [993 bp, 330 aa] {...   271   3e-89
Suva_2.668 Chr2 (1186763..1187710) [948 bp, 315 aa] {ON} YDR492W...   271   3e-89
TDEL0D05340 Chr4 (969608..970558) [951 bp, 316 aa] {ON} Anc_3.90...   270   1e-88
Smik_4.769 Chr4 (1356263..1357213) [951 bp, 316 aa] {ON} YDR492W...   268   3e-88
Kwal_56.22704 s56 (244431..245393) [963 bp, 320 aa] {ON} YDR492W...   265   7e-87
ZYRO0B06556g Chr2 (526478..527434) [957 bp, 318 aa] {ON} similar...   264   2e-86
AFR337W Chr6 (1051645..1052598) [954 bp, 317 aa] {ON} Syntenic h...   263   6e-86
NCAS0I02570 Chr9 complement(480266..481210) [945 bp, 314 aa] {ON...   262   1e-85
Ecym_3588 Chr3 (1117646..1118563) [918 bp, 305 aa] {ON} similar ...   260   3e-85
KLLA0C12441g Chr3 complement(1057427..1058374) [948 bp, 315 aa] ...   258   3e-84
Kpol_1053.26 s1053 complement(40099..41073) [975 bp, 324 aa] {ON...   258   6e-84
KAFR0A08130 Chr1 (1638153..1639112) [960 bp, 319 aa] {ON} Anc_3....   247   6e-80
TBLA0B02290 Chr2 complement(534472..535452) [981 bp, 326 aa] {ON...   245   7e-79
KNAG0K02160 Chr11 (436744..437715) [972 bp, 323 aa] {ON} Anc_3.9...   233   4e-74
TBLA0B08255 Chr2 (1973757..1974647) [891 bp, 296 aa] {ON}             152   3e-43
NCAS0C04920 Chr3 complement(1003692..1004672) [981 bp, 326 aa] {...   127   2e-33
NDAI0G04300 Chr7 (1035664..1036620) [957 bp, 318 aa] {ON} Anc_3.90    114   1e-28
CAGL0I07491g Chr9 complement(719539..720444) [906 bp, 301 aa] {O...    86   2e-18
Suva_15.64 Chr15 complement(100035..100973) [939 bp, 312 aa] {ON...    78   1e-15
Skud_12.91 Chr12 complement(177334..178962) [1629 bp, 542 aa] {O...    77   5e-15
KLLA0F15510g Chr6 (1433494..1435362) [1869 bp, 622 aa] {ON} some...    77   7e-15
NDAI0I02330 Chr9 (532412..534148) [1737 bp, 578 aa] {ON} Anc_5.197     76   2e-14
Smik_12.86 Chr12 complement(172288..173916) [1629 bp, 542 aa] {O...    72   4e-13
Suva_10.104 Chr10 complement(191663..193288) [1626 bp, 541 aa] {...    72   4e-13
KAFR0J00670 Chr10 (120378..121907) [1530 bp, 509 aa] {ON} Anc_5....    71   5e-13
NCAS0D02600 Chr4 (499689..501320) [1632 bp, 543 aa] {ON} Anc_5.1...    70   1e-12
YLR023C Chr12 complement(185498..187129) [1632 bp, 543 aa] {ON} ...    69   4e-12
KNAG0B05100 Chr2 (976101..977717) [1617 bp, 538 aa] {ON} Anc_5.1...    69   4e-12
AAL153C Chr1 complement(75086..76345) [1260 bp, 419 aa] {ON} Syn...    68   4e-12
Skud_15.53 Chr15 complement(86339..87277) [939 bp, 312 aa] {ON} ...    67   6e-12
TPHA0E03120 Chr5 complement(654079..655788) [1710 bp, 569 aa] {O...    68   6e-12
Smik_15.56 Chr15 complement(90083..91021) [939 bp, 312 aa] {ON} ...    64   5e-11
ZYRO0B10538g Chr2 complement(830311..831906) [1596 bp, 531 aa] {...    64   2e-10
Kpol_2002.94 s2002 (229517..231250) [1734 bp, 577 aa] {ON} (2295...    63   4e-10
KLTH0B03498g Chr2 complement(281148..282788) [1641 bp, 546 aa] {...    60   2e-09
Kwal_33.15122 s33 (968885..970585) [1701 bp, 566 aa] {ON} YLR023...    60   2e-09
YOL101C Chr15 complement(126982..127920) [939 bp, 312 aa] {ON}  ...    59   3e-09
TDEL0E04320 Chr5 complement(804655..806007) [1353 bp, 450 aa] {O...    59   4e-09
SAKL0G12980g Chr7 complement(1108751..1110442) [1692 bp, 563 aa]...    56   4e-08
Ecym_7109 Chr7 complement(210829..212535) [1707 bp, 568 aa] {ON}...    55   8e-08
CAGL0D03322g Chr4 complement(340949..342586) [1638 bp, 545 aa] {...    54   2e-07
TBLA0C06050 Chr3 (1468152..1469465) [1314 bp, 437 aa] {ON} Anc_5...    52   8e-07
KNAG0K00670 Chr11 complement(119419..120384) [966 bp, 321 aa] {O...    44   2e-04
Skud_5.169 Chr5 complement(262759..264360) [1602 bp, 533 aa] {ON...    35   0.26 
KLTH0D09174g Chr4 (762443..765796) [3354 bp, 1117 aa] {ON} simil...    35   0.34 
NDAI0E04780 Chr5 (1074922..1076529) [1608 bp, 535 aa] {ON}             34   0.58 
Suva_14.232 Chr14 complement(417816..421373) [3558 bp, 1185 aa] ...    34   0.64 
KLLA0B02541g Chr2 complement(221104..222636) [1533 bp, 510 aa] {...    33   0.78 
KAFR0L00890 Chr12 (165185..166768) [1584 bp, 527 aa] {ON}  YER060W     32   2.4  
Suva_5.169 Chr5 (251694..253274) [1581 bp, 526 aa] {ON} YER060W-...    32   2.5  
YER060W Chr5 (274567..276153) [1587 bp, 528 aa] {ON}  FCY21Putat...    32   2.7  
CAGL0J02948g Chr10 (285162..286709) [1548 bp, 515 aa] {ON} highl...    31   3.7  
Smik_5.185 Chr5 complement(270718..272211) [1494 bp, 497 aa] {ON...    31   4.1  
NDAI0A02570 Chr1 (573728..575047) [1320 bp, 439 aa] {ON}               31   4.5  
Smik_5.184 Chr5 complement(270545..270777,270843..272211) [1602 ...    31   4.9  
Kpol_1066.48 s1066 (91933..92886,92889..93536) [1602 bp, 533 aa]...    31   5.4  
Smik_5.190 Chr5 (278724..280310) [1587 bp, 528 aa] {ON} YER056C ...    30   6.5  
KNAG0L01490 Chr12 (264062..265666) [1605 bp, 534 aa] {ON}              30   8.4  
NCAS0E03160 Chr5 complement(625452..627053) [1602 bp, 533 aa] {O...    30   9.0  

>Smik_15.168 Chr15 complement(290724..291707) [984 bp, 327 aa] {ON}
           YOL002C (REAL)
          Length = 327

 Score =  667 bits (1722), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/327 (100%), Positives = 327/327 (100%)

Query: 1   MMHVRKESFQMSTLLERTKSVQELKKRAAGKTSANPAEVAEAKKVLKRLYSWDEIPEWQR 60
           MMHVRKESFQMSTLLERTKSVQELKKRAAGKTSANPAEVAEAKKVLKRLYSWDEIPEWQR
Sbjct: 1   MMHVRKESFQMSTLLERTKSVQELKKRAAGKTSANPAEVAEAKKVLKRLYSWDEIPEWQR 60

Query: 61  DNDFILHGYVRETSSFIETFKSLFYLHNESVNIYSHLVPALGFFTVLLLDKSTIKVFETT 120
           DNDFILHGYVRETSSFIETFKSLFYLHNESVNIYSHLVPALGFFTVLLLDKSTIKVFETT
Sbjct: 61  DNDFILHGYVRETSSFIETFKSLFYLHNESVNIYSHLVPALGFFTVLLLDKSTIKVFETT 120

Query: 121 TWKDHVVIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILF 180
           TWKDHVVIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILF
Sbjct: 121 TWKDHVVIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILF 180

Query: 181 YGYYEKFSLFCLFALITVSFGVACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSG 240
           YGYYEKFSLFCLFALITVSFGVACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSG
Sbjct: 181 YGYYEKFSLFCLFALITVSFGVACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSG 240

Query: 241 LYCYSFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVV 300
           LYCYSFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVV
Sbjct: 241 LYCYSFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVV 300

Query: 301 IASLCHLRGLLNSYELVHIKMESGIIS 327
           IASLCHLRGLLNSYELVHIKMESGIIS
Sbjct: 301 IASLCHLRGLLNSYELVHIKMESGIIS 327

>Skud_15.160 Chr15 complement(283003..283986) [984 bp, 327 aa] {ON}
           YOL002C (REAL)
          Length = 327

 Score =  637 bits (1643), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/327 (93%), Positives = 318/327 (97%)

Query: 1   MMHVRKESFQMSTLLERTKSVQELKKRAAGKTSANPAEVAEAKKVLKRLYSWDEIPEWQR 60
           MM + KE FQMSTLLERTKSVQELKKRAAGKT ANPAEVAEAKKVLKRLYSWDEIPEWQR
Sbjct: 1   MMLIAKEPFQMSTLLERTKSVQELKKRAAGKTPANPAEVAEAKKVLKRLYSWDEIPEWQR 60

Query: 61  DNDFILHGYVRETSSFIETFKSLFYLHNESVNIYSHLVPALGFFTVLLLDKSTIKVFETT 120
           DND+ILHGYVRET SF+ETFKSLFY+HNESVNIYSHL+PALGFFTVLLLDKSTIKVFETT
Sbjct: 61  DNDYILHGYVRETCSFVETFKSLFYMHNESVNIYSHLIPALGFFTVLLLDKSTIKVFETT 120

Query: 121 TWKDHVVIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILF 180
           TWKDH++IDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSM SIL+
Sbjct: 121 TWKDHMIIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMTSILY 180

Query: 181 YGYYEKFSLFCLFALITVSFGVACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSG 240
           YGYYEKFSLFCLFALITVSFG+ACSIV+LKDKFRKREWRPYRAGLFVCFGLSSIVPIFSG
Sbjct: 181 YGYYEKFSLFCLFALITVSFGIACSIVTLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSG 240

Query: 241 LYCYSFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVV 300
           LYCY+FSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVV
Sbjct: 241 LYCYTFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVV 300

Query: 301 IASLCHLRGLLNSYELVHIKMESGIIS 327
           IAS CHLRGLLNSYELVH+KME  I+S
Sbjct: 301 IASFCHLRGLLNSYELVHLKMEGKIVS 327

>YOL002C Chr15 complement(323411..324364) [954 bp, 317 aa] {ON}
           IZH2Plasma membrane protein involved in zinc homeostasis
           and osmotin-induced apoptosis; transcription regulated
           by Zap1p, zinc and fatty acid levels; similar to
           mammalian adiponectins; deletion increases sensitivity
           to elevated zinc
          Length = 317

 Score =  628 bits (1620), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/317 (95%), Positives = 315/317 (99%)

Query: 11  MSTLLERTKSVQELKKRAAGKTSANPAEVAEAKKVLKRLYSWDEIPEWQRDNDFILHGYV 70
           MSTLLERTKSVQELKKRAAGKTSANPAEVA+AKKVL+RLYSWDEIPEWQRDNDFILHGYV
Sbjct: 1   MSTLLERTKSVQELKKRAAGKTSANPAEVAKAKKVLRRLYSWDEIPEWQRDNDFILHGYV 60

Query: 71  RETSSFIETFKSLFYLHNESVNIYSHLVPALGFFTVLLLDKSTIKVFETTTWKDHVVIDL 130
           +ETSSFIETFKSLFYLHNESVNIYSHL+PALGFFTVLLLDKSTIKVF TTTW DH+VIDL
Sbjct: 61  KETSSFIETFKSLFYLHNESVNIYSHLIPALGFFTVLLLDKSTIKVFATTTWLDHMVIDL 120

Query: 131 FYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILFYGYYEKFSLF 190
           FYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSIL+YGY+EKFSLF
Sbjct: 121 FYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILYYGYFEKFSLF 180

Query: 191 CLFALITVSFGVACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYCYSFSEIW 250
           CLFALITVSFG+ACSIVSLKDKFRKREWRPYRAGLFVCFGLSSI+PIFSGLYCYSFSEIW
Sbjct: 181 CLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIIPIFSGLYCYSFSEIW 240

Query: 251 TQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVVIASLCHLRGL 310
           TQIQLFWVLLGGVLYIIGAVLYGMRFPEK+CPGKFDIWGHSHQLFHFLVVIA+LCHLRGL
Sbjct: 241 TQIQLFWVLLGGVLYIIGAVLYGMRFPEKICPGKFDIWGHSHQLFHFLVVIAALCHLRGL 300

Query: 311 LNSYELVHIKMESGIIS 327
           LNSYELVHIKME+GI+S
Sbjct: 301 LNSYELVHIKMENGIVS 317

>Suva_15.173 Chr15 complement(297915..298898) [984 bp, 327 aa] {ON}
           YOL002C (REAL)
          Length = 327

 Score =  591 bits (1524), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/327 (87%), Positives = 315/327 (96%)

Query: 1   MMHVRKESFQMSTLLERTKSVQELKKRAAGKTSANPAEVAEAKKVLKRLYSWDEIPEWQR 60
           M+H+RKE+F+MSTLLERT SVQELKKRAAG T+ANPAEVA+AKKVLKR+YSWDEIPEWQR
Sbjct: 1   MIHIRKEAFEMSTLLERTNSVQELKKRAAGNTAANPAEVAKAKKVLKRVYSWDEIPEWQR 60

Query: 61  DNDFILHGYVRETSSFIETFKSLFYLHNESVNIYSHLVPALGFFTVLLLDKSTIKVFETT 120
           DND+ILHGYV+ETSSF++TFKSLFY+HNESVNIYSHL+PA+GF TVLLLDK+TI VFETT
Sbjct: 61  DNDYILHGYVKETSSFVDTFKSLFYMHNESVNIYSHLIPAVGFLTVLLLDKTTITVFETT 120

Query: 121 TWKDHVVIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILF 180
           TW DH++IDLF++GAFACLILSSSFHC KSHSL+IATLGNKLDYLGICILIVTSMVSIL+
Sbjct: 121 TWLDHMMIDLFFTGAFACLILSSSFHCFKSHSLKIATLGNKLDYLGICILIVTSMVSILY 180

Query: 181 YGYYEKFSLFCLFALITVSFGVACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSG 240
           YGYY+KF  FCLFALITVSFG+ACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSG
Sbjct: 181 YGYYDKFPAFCLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSG 240

Query: 241 LYCYSFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVV 300
           LY YSFSEIW QIQLFWVLLGG LYIIGAVLYGMRFPEKV PG+FDIWGHSHQLFHFLVV
Sbjct: 241 LYYYSFSEIWNQIQLFWVLLGGALYIIGAVLYGMRFPEKVYPGRFDIWGHSHQLFHFLVV 300

Query: 301 IASLCHLRGLLNSYELVHIKMESGIIS 327
           IASLCH+RG+LNSYELVHIKM++GI+S
Sbjct: 301 IASLCHMRGVLNSYELVHIKMQNGIVS 327

>SAKL0E01474g Chr5 (112382..113317) [936 bp, 311 aa] {ON} similar to
           uniprot|Q12442 Saccharomyces cerevisiae YOL002C IZH2
           Membrane protein involved in zinc metabolism member of
           the four-protein IZH family direct target of the Zap1p
           transcription factor expression induced by zinc
           deficiency and fatty acids deletion increases
           sensitivity to elevated zinc
          Length = 311

 Score =  409 bits (1050), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 185/281 (65%), Positives = 234/281 (83%)

Query: 43  KKVLKRLYSWDEIPEWQRDNDFILHGYVRETSSFIETFKSLFYLHNESVNIYSHLVPALG 102
           KK ++RLYSW+EIP+WQ+DN+ I HGYVRET+SF+  F SLFY+HNESVNIY+HL+P L 
Sbjct: 30  KKRVRRLYSWEEIPDWQKDNEHIRHGYVRETNSFLGCFDSLFYMHNESVNIYTHLLPGLC 89

Query: 103 FFTVLLLDKSTIKVFETTTWKDHVVIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKL 162
           FF V+L DK  IKVF+TTT+ D++++DLF+ GAF CLILSS+FHCLK+HSLRIA LGNKL
Sbjct: 90  FFFVVLFDKVAIKVFDTTTFLDYIMVDLFFLGAFTCLILSSTFHCLKTHSLRIAILGNKL 149

Query: 163 DYLGICILIVTSMVSILFYGYYEKFSLFCLFALITVSFGVACSIVSLKDKFRKREWRPYR 222
           DYLGI  LIV+SM+SI++YG+++    F  F+ +T+ FG+AC+I SL D FR REWRPYR
Sbjct: 150 DYLGIVALIVSSMISIMYYGFFDSGKFFYGFSTLTLVFGIACAIASLSDTFRSREWRPYR 209

Query: 223 AGLFVCFGLSSIVPIFSGLYCYSFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCP 282
           A LFV FGLS+++PIFSG+  Y F E W ++Q+ WVLLGGV YIIGA+LY +R PE++ P
Sbjct: 210 AALFVAFGLSAVLPIFSGVAVYGFKETWVKVQVKWVLLGGVFYIIGALLYALRLPERISP 269

Query: 283 GKFDIWGHSHQLFHFLVVIASLCHLRGLLNSYELVHIKMES 323
           GKFDIWGHSHQ+FH LVVIA+LCHL+ +LNSYELVH K+ S
Sbjct: 270 GKFDIWGHSHQIFHILVVIAALCHLKAVLNSYELVHKKLAS 310

>KNAG0M01240 Chr13 (226766..227710) [945 bp, 314 aa] {ON} Anc_6.27
           YOL002C
          Length = 314

 Score =  402 bits (1034), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 183/283 (64%), Positives = 233/283 (82%)

Query: 42  AKKVLKRLYSWDEIPEWQRDNDFILHGYVRETSSFIETFKSLFYLHNESVNIYSHLVPAL 101
            KK+ KR+Y+W+EIPEWQ+DN+ I+ GYVRET+SF++   SLFYLHNESVN+YSHL+PAL
Sbjct: 29  TKKITKRIYTWNEIPEWQKDNEHIIDGYVRETNSFLKCVHSLFYLHNESVNVYSHLIPAL 88

Query: 102 GFFTVLLLDKSTIKVFETTTWKDHVVIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNK 161
            FF+VL L+K  +K FETT+  D++ IDLF+ GAF CLILSS+FHC KSHSL++AT GNK
Sbjct: 89  CFFSVLFLNKYCVKSFETTSLVDYLFIDLFFLGAFTCLILSSTFHCFKSHSLKVATFGNK 148

Query: 162 LDYLGICILIVTSMVSILFYGYYEKFSLFCLFALITVSFGVACSIVSLKDKFRKREWRPY 221
           LDYLGI +LIVTSM+SIL+YG+Y+   +F  F+ +T+SFG AC +VSLKD FR REWRPY
Sbjct: 149 LDYLGIVVLIVTSMISILYYGFYDSSVMFYFFSFVTLSFGTACGVVSLKDHFRSREWRPY 208

Query: 222 RAGLFVCFGLSSIVPIFSGLYCYSFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVC 281
           RAGLFV FGLS+I+PI SG++ Y   E + +IQ+ W++L GV YI+GA LYG+RFPEK  
Sbjct: 209 RAGLFVAFGLSAILPILSGMFAYGIEEAFHRIQIKWIILEGVFYILGAFLYGIRFPEKGS 268

Query: 282 PGKFDIWGHSHQLFHFLVVIASLCHLRGLLNSYELVHIKMESG 324
           PGK+DIWGHSHQ+FH LVV+A+LCHL+GL+ SYELVH  + S 
Sbjct: 269 PGKYDIWGHSHQVFHILVVVAALCHLKGLMVSYELVHKGLSSA 311

>NCAS0H01510 Chr8 complement(287981..288922) [942 bp, 313 aa] {ON}
           Anc_6.27
          Length = 313

 Score =  392 bits (1008), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 183/289 (63%), Positives = 228/289 (78%), Gaps = 2/289 (0%)

Query: 35  NPAEVAEAKKV--LKRLYSWDEIPEWQRDNDFILHGYVRETSSFIETFKSLFYLHNESVN 92
           +   +   KK   +++LY+WDEIPEWQ+DN+ I+ GYVRET+SF   F SLFY+HNE+ N
Sbjct: 25  DNVSIKHTKKTTTIRKLYTWDEIPEWQKDNEHIIAGYVRETNSFRRCFDSLFYIHNETGN 84

Query: 93  IYSHLVPALGFFTVLLLDKSTIKVFETTTWKDHVVIDLFYSGAFACLILSSSFHCLKSHS 152
           +YSHLVP + FF  +L DK  I  FETTT+ D+++I+LF+ GAF CLILSS+FHC KSHS
Sbjct: 85  VYSHLVPGVVFFLTMLFDKYAIVSFETTTFTDYLIINLFFLGAFTCLILSSTFHCFKSHS 144

Query: 153 LRIATLGNKLDYLGICILIVTSMVSILFYGYYEKFSLFCLFALITVSFGVACSIVSLKDK 212
           L+IAT GNKLDYLGI +LIVTSM+SILFYG+Y+    F  F+L+T+SFG AC+IVSLKDK
Sbjct: 145 LKIATFGNKLDYLGIVVLIVTSMISILFYGFYDNGPFFYGFSLLTLSFGSACAIVSLKDK 204

Query: 213 FRKREWRPYRAGLFVCFGLSSIVPIFSGLYCYSFSEIWTQIQLFWVLLGGVLYIIGAVLY 272
           FR REWRPYRAGLFV FGLS+++PI +G+  Y   E WT+IQL WV+L GV YI GA LY
Sbjct: 205 FRSREWRPYRAGLFVAFGLSAVLPILTGVMYYGPHETWTRIQLKWVVLEGVFYIFGAFLY 264

Query: 273 GMRFPEKVCPGKFDIWGHSHQLFHFLVVIASLCHLRGLLNSYELVHIKM 321
           G+RFPEK   G FDIWGHSHQ+FH LVV+A+ CHL+ LL SYELVH+ +
Sbjct: 265 GIRFPEKYVNGTFDIWGHSHQIFHLLVVVAAFCHLKALLGSYELVHMNL 313

>TDEL0G04420 Chr7 complement(802412..803380) [969 bp, 322 aa] {ON}
           Anc_6.27 YOL002C
          Length = 322

 Score =  392 bits (1007), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 187/316 (59%), Positives = 237/316 (75%), Gaps = 4/316 (1%)

Query: 6   KESFQMSTLLERTKSVQELKKRAAGKTSANPAEVAEAKKVLKRLYSWDEIPEWQRDNDFI 65
           K+  Q S   ++T +V   K+  +G       +    KK  ++LY+WDEIP WQRDN+ I
Sbjct: 6   KKRSQCSLTTDQTSTVT--KEETSGPVKGQKTDKMSKKK--RKLYTWDEIPHWQRDNEHI 61

Query: 66  LHGYVRETSSFIETFKSLFYLHNESVNIYSHLVPALGFFTVLLLDKSTIKVFETTTWKDH 125
           L GYV ET S  + F SLFYLHNESVNIY+HL+P + F  VL  DK  +  FETTT  D+
Sbjct: 62  LSGYVGETRSMFQCFLSLFYLHNESVNIYTHLLPGIAFLFVLCFDKFAVTQFETTTLIDY 121

Query: 126 VVIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILFYGYYE 185
           V+IDLF   +F CL LSS FHCLK+HS  +AT GNKLDYLGI +L+VTSMVSI++YG++E
Sbjct: 122 VMIDLFSLVSFTCLTLSSIFHCLKNHSRSVATFGNKLDYLGIVVLVVTSMVSIMYYGFFE 181

Query: 186 KFSLFCLFALITVSFGVACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYCYS 245
             +LF LF+ IT +FG AC++VSLK+ FR REWRPYRA +FV FGLS+++PI +G++ Y 
Sbjct: 182 TPALFYLFSFITCTFGAACAVVSLKEGFRTREWRPYRAAMFVAFGLSAVLPIVTGIFYYG 241

Query: 246 FSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVVIASLC 305
           FSEI+ +IQ+ WVLLGG+ YI GAVLYG+RFPEK  PGK+DIWGHSHQLFH LVV+A+LC
Sbjct: 242 FSEIYLRIQVKWVLLGGIFYITGAVLYGVRFPEKYAPGKYDIWGHSHQLFHVLVVVAALC 301

Query: 306 HLRGLLNSYELVHIKM 321
           HL GL+ SY LVH+KM
Sbjct: 302 HLYGLIKSYNLVHLKM 317

>CAGL0E02519g Chr5 complement(242867..243814) [948 bp, 315 aa] {ON}
           similar to uniprot|Q12442 Saccharomyces cerevisiae
           YOL002c
          Length = 315

 Score =  389 bits (998), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 176/278 (63%), Positives = 226/278 (81%)

Query: 43  KKVLKRLYSWDEIPEWQRDNDFILHGYVRETSSFIETFKSLFYLHNESVNIYSHLVPALG 102
           K V+++LY+W+EIPEWQ+DN+ I  GYVRETSS +E  +SLFYLHNE+VNIYSHL+PA+ 
Sbjct: 32  KTVVRKLYTWEEIPEWQKDNEHIHTGYVRETSSVMECIRSLFYLHNETVNIYSHLIPAIA 91

Query: 103 FFTVLLLDKSTIKVFETTTWKDHVVIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKL 162
           FF+ +  +K  +  + TTT  D+++ID+F+ GAF+CLILSS+FHCLKSHSLR+A  GNKL
Sbjct: 92  FFSTIFFNKYVVPTYSTTTLIDYLIIDIFFLGAFSCLILSSTFHCLKSHSLRVAVFGNKL 151

Query: 163 DYLGICILIVTSMVSILFYGYYEKFSLFCLFALITVSFGVACSIVSLKDKFRKREWRPYR 222
           DYLGI  LIV SMVSIL+YG++     F +F+LIT++FG AC++VSLKD FR REWRPYR
Sbjct: 152 DYLGIVFLIVASMVSILYYGFHGNPWFFGIFSLITMTFGAACAVVSLKDTFRSREWRPYR 211

Query: 223 AGLFVCFGLSSIVPIFSGLYCYSFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCP 282
           A LFV FGLS+++PI +GL+ Y  +E WT+IQL WV+L GV YI GA LYG+RFPEK+ P
Sbjct: 212 AALFVIFGLSAVLPILAGLFKYGPTETWTRIQLKWVILEGVFYIFGAFLYGIRFPEKMSP 271

Query: 283 GKFDIWGHSHQLFHFLVVIASLCHLRGLLNSYELVHIK 320
           G FD+WGHSHQ+FH LVV+A+LCHL+ LL SY LVH +
Sbjct: 272 GSFDLWGHSHQIFHILVVVAALCHLKALLGSYSLVHYR 309

>KAFR0G02650 Chr7 complement(547561..548526) [966 bp, 321 aa] {ON}
           Anc_6.27 YOL002C
          Length = 321

 Score =  382 bits (981), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 180/285 (63%), Positives = 224/285 (78%)

Query: 35  NPAEVAEAKKVLKRLYSWDEIPEWQRDNDFILHGYVRETSSFIETFKSLFYLHNESVNIY 94
           N  E   + + + +LY+W+EIP+WQ+DN+ I+ GYV+ET+SF    +SLFYLHNESVN+Y
Sbjct: 26  NKGETIRSLEKIIQLYNWNEIPDWQKDNEHIISGYVKETNSFFSCIESLFYLHNESVNVY 85

Query: 95  SHLVPALGFFTVLLLDKSTIKVFETTTWKDHVVIDLFYSGAFACLILSSSFHCLKSHSLR 154
           SHL+PA+ F    LL+K+ +  F TTT  D++ IDLF+ GAF CLILSS+FHC KSHSLR
Sbjct: 86  SHLIPAVCFLMTSLLNKTIVPKFRTTTVLDYLYIDLFFLGAFTCLILSSTFHCFKSHSLR 145

Query: 155 IATLGNKLDYLGICILIVTSMVSILFYGYYEKFSLFCLFALITVSFGVACSIVSLKDKFR 214
           IAT GNKLDYLGI +LI TSM+S+L+YG+Y+  SLF +FA IT+SFG+AC+ VSLKDKFR
Sbjct: 146 IATFGNKLDYLGIVVLISTSMISLLYYGFYDTPSLFYVFAFITLSFGLACATVSLKDKFR 205

Query: 215 KREWRPYRAGLFVCFGLSSIVPIFSGLYCYSFSEIWTQIQLFWVLLGGVLYIIGAVLYGM 274
            RE R YRA LFVCFGLS+++P+  GLY Y F   W +IQL WVLL GV YI GA LYG+
Sbjct: 206 SRECRAYRATLFVCFGLSAVLPVICGLYHYGFYNTWHRIQLKWVLLEGVFYIFGAFLYGI 265

Query: 275 RFPEKVCPGKFDIWGHSHQLFHFLVVIASLCHLRGLLNSYELVHI 319
           RFPEK  PGK+DIWGHSHQLFH LVVIA+LCH + L+ SYE VH+
Sbjct: 266 RFPEKYTPGKYDIWGHSHQLFHILVVIAALCHFKALMCSYEHVHM 310

>TBLA0E03060 Chr5 (769031..769990) [960 bp, 319 aa] {ON} Anc_6.27
           YOL002C
          Length = 319

 Score =  374 bits (961), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 178/317 (56%), Positives = 232/317 (73%)

Query: 11  MSTLLERTKSVQELKKRAAGKTSANPAEVAEAKKVLKRLYSWDEIPEWQRDNDFILHGYV 70
           M T ++R K     ++        N  ++  +    KRLY+WDEIP WQ DN++I  GYV
Sbjct: 1   MVTEVQRRKLTSSTEEGVELLYGDNQQQLNTSGSSGKRLYTWDEIPVWQHDNEYIYTGYV 60

Query: 71  RETSSFIETFKSLFYLHNESVNIYSHLVPALGFFTVLLLDKSTIKVFETTTWKDHVVIDL 130
           RET+S  E+F SLFY+HNESVNIY+HL+PA  F ++LL +   +K   TTT+ D+V IDL
Sbjct: 61  RETNSMKESFLSLFYIHNESVNIYTHLIPAFCFLSMLLFNTYGVKPHPTTTYGDYVAIDL 120

Query: 131 FYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILFYGYYEKFSLF 190
           F+ GAF CL LSS+FHC KSHSL+I+  GNKLDYLGI ILI TS++S+L++GY++   +F
Sbjct: 121 FFIGAFTCLGLSSTFHCFKSHSLKISVFGNKLDYLGIVILISTSLISVLYFGYHDDPFIF 180

Query: 191 CLFALITVSFGVACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYCYSFSEIW 250
            +F+ IT+ FG+AC I SLKDKFR REWRPYRA LFV FGLS ++PI +G+  Y   E++
Sbjct: 181 YIFSGITLCFGIACGIASLKDKFRTREWRPYRAALFVLFGLSGVLPIIAGIMKYGIREVF 240

Query: 251 TQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVVIASLCHLRGL 310
            ++QL W++  GVLYI GA LYG RFPEK  PGK DIWG SHQ+FH LVVIA+LCHLRGL
Sbjct: 241 ERVQLKWIIWEGVLYIFGAFLYGARFPEKFMPGKVDIWGQSHQIFHVLVVIAALCHLRGL 300

Query: 311 LNSYELVHIKMESGIIS 327
           + SYELVH K+++ + S
Sbjct: 301 IGSYELVHQKLDAQLQS 317

>NDAI0F01740 Chr6 (429141..430082) [942 bp, 313 aa] {ON} Anc_6.27
          Length = 313

 Score =  370 bits (949), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 175/310 (56%), Positives = 229/310 (73%), Gaps = 1/310 (0%)

Query: 13  TLLERTKSVQELKKRAAGKTSANPAEVAEAK-KVLKRLYSWDEIPEWQRDNDFILHGYVR 71
           T+ +R  +            + N   + + K KV+ +LY WDEIPEWQ+DN+ I+ GYVR
Sbjct: 4   TIQKRGNTSTTTVVEGIINNTDNGDSIEQVKRKVVYKLYRWDEIPEWQKDNEHIISGYVR 63

Query: 72  ETSSFIETFKSLFYLHNESVNIYSHLVPALGFFTVLLLDKSTIKVFETTTWKDHVVIDLF 131
           ET+SF     SLFY+HNES N+YSHL+P + FF  ++L+K  I ++ TT+  D+++IDLF
Sbjct: 64  ETNSFKGCLHSLFYVHNESGNVYSHLLPGVFFFFTMVLNKYGITIYSTTSIVDYLMIDLF 123

Query: 132 YSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILFYGYYEKFSLFC 191
           + GAF CLILSS FHC KSHSL++ATLGNKLDYLGI ILIVTSM+SI+++G+++    F 
Sbjct: 124 FFGAFCCLILSSLFHCFKSHSLKVATLGNKLDYLGIVILIVTSMISIMYFGFFDNPLFFY 183

Query: 192 LFALITVSFGVACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYCYSFSEIWT 251
            F+ +T  FG AC+ VSLKD FR REWRPYRAGLFV FGLS+I+PI +G + Y   E + 
Sbjct: 184 FFSSLTFLFGGACATVSLKDHFRSREWRPYRAGLFVAFGLSAILPILAGTFYYGIEETFI 243

Query: 252 QIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVVIASLCHLRGLL 311
           +IQL W++L G  YI GA LYG+RFPEK  PG FDIWGHSHQ+FH LVV+A+ CHLRGLL
Sbjct: 244 RIQLKWIILEGFFYIFGAFLYGVRFPEKYVPGSFDIWGHSHQIFHILVVVAAFCHLRGLL 303

Query: 312 NSYELVHIKM 321
           +SYE+VH ++
Sbjct: 304 SSYEIVHSRL 313

>KLTH0C11044g Chr3 complement(908604..909551) [948 bp, 315 aa] {ON}
           similar to uniprot|Q12442 Saccharomyces cerevisiae
           YOL002C IZH2 Membrane protein involved in zinc
           metabolism member of the four-protein IZH family direct
           target of the Zap1p transcription factor expression
           induced by zinc deficiency and fatty acids deletion
           increases sensitivity to elevated zinc
          Length = 315

 Score =  368 bits (944), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 176/309 (56%), Positives = 226/309 (73%)

Query: 10  QMSTLLERTKSVQELKKRAAGKTSANPAEVAEAKKVLKRLYSWDEIPEWQRDNDFILHGY 69
           +   L +R     EL  R   + S+   +    ++  +RLY+WDEIPEWQRDN+ I+ GY
Sbjct: 2   EQGGLTQRKPVEVELHHRMVEENSSLLKDSNLKQRTKRRLYTWDEIPEWQRDNEHIVGGY 61

Query: 70  VRETSSFIETFKSLFYLHNESVNIYSHLVPALGFFTVLLLDKSTIKVFETTTWKDHVVID 129
           + ET S  E  KSL YLHNESVNIY+HL+P   F  V + ++  I+ FETT   D+V+ID
Sbjct: 62  ILETKSTWECLKSLLYLHNESVNIYTHLLPGWCFLLVAVFNQVVIEKFETTRLIDYVMID 121

Query: 130 LFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILFYGYYEKFSL 189
           LF+ G F CL++SS FHC K HSL +A LGNKLDYLGI  L+VTS+VSILFYG+++    
Sbjct: 122 LFFLGGFTCLMMSSVFHCFKCHSLPVAILGNKLDYLGIVALVVTSIVSILFYGFHDYDLY 181

Query: 190 FCLFALITVSFGVACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYCYSFSEI 249
           F LF+ +T++FG+AC+ VSL +KFR REWRPYRA LFV FGLS+++P+ +G   Y   E 
Sbjct: 182 FWLFSGLTMAFGLACATVSLSNKFRSREWRPYRASLFVAFGLSALLPVIAGALHYGLKET 241

Query: 250 WTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVVIASLCHLRG 309
           WT+IQL WVLLGGV YI+GAVLYG+RFPE++ PG FDIWGHSHQLFH LVV+A+LCHLR 
Sbjct: 242 WTRIQLEWVLLGGVFYILGAVLYGIRFPERMAPGCFDIWGHSHQLFHILVVVAALCHLRA 301

Query: 310 LLNSYELVH 318
           LL +Y+L H
Sbjct: 302 LLGAYKLFH 310

>ZYRO0C07612g Chr3 complement(578864..579823) [960 bp, 319 aa] {ON}
           similar to uniprot|Q12442 Saccharomyces cerevisiae
           YOL002C IZH2 Membrane protein involved in zinc
           metabolism member of the four-protein IZH family direct
           target of the Zap1p transcription factor expression
           induced by zinc deficiency and fatty acids deletion
           increases sensitivity to elevated zinc
          Length = 319

 Score =  362 bits (929), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 167/278 (60%), Positives = 209/278 (75%)

Query: 47  KRLYSWDEIPEWQRDNDFILHGYVRETSSFIETFKSLFYLHNESVNIYSHLVPALGFFTV 106
           K LY+W+EIP+WQ+DN+ I+ GYVRET+S  E  +SL YLHNES+NIY+H +P L F   
Sbjct: 40  KLLYTWNEIPDWQKDNEHIVGGYVRETNSIRECLQSLLYLHNESINIYTHFLPGLCFLAT 99

Query: 107 LLLDKSTIKVFETTTWKDHVVIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLG 166
            + DK  IK F+TTTW D++ ID F+ GAF+CLILSS+FHC KSHS R++  GNKLDYLG
Sbjct: 100 CIFDKFAIKNFDTTTWIDYMAIDFFFFGAFSCLILSSTFHCFKSHSSRVSVFGNKLDYLG 159

Query: 167 ICILIVTSMVSILFYGYYEKFSLFCLFALITVSFGVACSIVSLKDKFRKREWRPYRAGLF 226
           I ILIV SM+SIL+Y +++   LF  F LI   FGV+C+I S  D FR REWRPYRAGLF
Sbjct: 160 IVILIVCSMISILYYAFHDSNKLFYSFTLIIFCFGVSCTIASFDDTFRSREWRPYRAGLF 219

Query: 227 VCFGLSSIVPIFSGLYCYSFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFD 286
           V FGLS+++PI  G+  Y F E WT+IQ+ WV+L G+ YI GA LY +RFPE++ PG FD
Sbjct: 220 VAFGLSALLPIMGGIIKYGFHETWTRIQMKWVILEGIFYIFGAFLYSIRFPERLAPGAFD 279

Query: 287 IWGHSHQLFHFLVVIASLCHLRGLLNSYELVHIKMESG 324
             GHSHQ+FH LVVIA+LCHL  L+NSYELVH  + S 
Sbjct: 280 FVGHSHQIFHVLVVIAALCHLVALMNSYELVHTNLLSN 317

>Ecym_3031 Chr3 (61592..62578) [987 bp, 328 aa] {ON} similar to
           Ashbya gossypii ACL002C
          Length = 328

 Score =  362 bits (929), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 169/316 (53%), Positives = 224/316 (70%), Gaps = 9/316 (2%)

Query: 19  KSVQELKKRAAGK-----TSANPAEVAEAK----KVLKRLYSWDEIPEWQRDNDFILHGY 69
           + +Q+     AGK     TS    ++ +A     K   +L+SW EIPEWQRDN+ IL GY
Sbjct: 9   RKIQKATSSLAGKNRTLETSVIFEDLNQATTIPLKPASKLFSWHEIPEWQRDNEHILGGY 68

Query: 70  VRETSSFIETFKSLFYLHNESVNIYSHLVPALGFFTVLLLDKSTIKVFETTTWKDHVVID 129
           V+ET+SF ET  SL YLHNESVNIY+HL+P + FF VL L+K  I  F+TTTWKD+ +ID
Sbjct: 69  VKETNSFKETLHSLLYLHNESVNIYTHLIPGVCFFCVLFLNKYVISRFKTTTWKDYAIID 128

Query: 130 LFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILFYGYYEKFSL 189
            F+ GAFACL++S ++HCLKSHS  ++ +GN+LDY+GI ILI TSM S+L+YG+Y    +
Sbjct: 129 TFFVGAFACLVMSGTYHCLKSHSYPVSIVGNQLDYIGIVILISTSMFSLLYYGFYNSSKM 188

Query: 190 FCLFALITVSFGVACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYCYSFSEI 249
           F  F+ +T+  G  C++V+L  +FR R WRPYRA +FV FGLSSI+PI + +  Y   E 
Sbjct: 189 FYGFSGVTLLLGTICTVVTLDSRFRSRLWRPYRASIFVAFGLSSILPILASILYYGSEET 248

Query: 250 WTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVVIASLCHLRG 309
           W  +QL W++L GVLYI GA +YG+RFPE + PG FDIWGHSHQLFH LVVIA+LCH + 
Sbjct: 249 WNSVQLGWIILEGVLYIFGAFIYGIRFPESMAPGSFDIWGHSHQLFHVLVVIAALCHFKA 308

Query: 310 LLNSYELVHIKMESGI 325
           +  SYELVH ++   +
Sbjct: 309 VTQSYELVHFRLNEAV 324

>Kwal_56.22454 s56 (136175..137122) [948 bp, 315 aa] {ON} YOL002C -
           Hypothetical ORF [contig 185] FULL
          Length = 315

 Score =  359 bits (921), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 169/290 (58%), Positives = 217/290 (74%), Gaps = 2/290 (0%)

Query: 32  TSANPAEVAEAKKVLKRLYSWDEIPEWQRDNDFILHGYVRETSSFIETFKSLFYLHNESV 91
           T  N + + E  +  +RLY WDEIPEWQ+DN+ IL+GY+ ET S     KSL YLHNESV
Sbjct: 26  TLLNGSRIEERTR--RRLYKWDEIPEWQKDNEHILNGYILETKSVGACLKSLLYLHNESV 83

Query: 92  NIYSHLVPALGFFTVLLLDKSTIKVFETTTWKDHVVIDLFYSGAFACLILSSSFHCLKSH 151
           NIY+HL+P   F  + L ++  I+ +ETT   D+++IDLF+ G F CL++SS+FHC K H
Sbjct: 84  NIYTHLIPGWCFLLMTLFNQLAIERYETTRMIDYIMIDLFFLGGFTCLMMSSTFHCFKCH 143

Query: 152 SLRIATLGNKLDYLGICILIVTSMVSILFYGYYEKFSLFCLFALITVSFGVACSIVSLKD 211
           SL +A LGNKLDYLGI  L+VTSMVSILFYG+++    F +F+ +T+ FG+AC+IVSL D
Sbjct: 144 SLPVAVLGNKLDYLGIVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSD 203

Query: 212 KFRKREWRPYRAGLFVCFGLSSIVPIFSGLYCYSFSEIWTQIQLFWVLLGGVLYIIGAVL 271
           KFR R+WRPYRA LFV FGLS++ P+ +G+  Y F   WT+IQL WV L GV YI+GA+L
Sbjct: 204 KFRSRDWRPYRAALFVAFGLSALFPVIAGICHYGFKVTWTRIQLKWVFLEGVFYILGALL 263

Query: 272 YGMRFPEKVCPGKFDIWGHSHQLFHFLVVIASLCHLRGLLNSYELVHIKM 321
           YG+RFPE+V PG FDIWG SHQLFH LVVIA+ CHLR LL +Y+ VH +M
Sbjct: 264 YGVRFPERVAPGTFDIWGQSHQLFHVLVVIAASCHLRALLGAYKWVHSQM 313

>TPHA0M00290 Chr13 (57784..58767) [984 bp, 327 aa] {ON} Anc_6.27
           YOL002C
          Length = 327

 Score =  353 bits (907), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 168/317 (52%), Positives = 225/317 (70%), Gaps = 3/317 (0%)

Query: 5   RKESFQMSTLLERTKSVQELKKRAAGKTSANPAEVAEAKKVLKRLYS---WDEIPEWQRD 61
           R +     T++  +   +E    A     +N   V    +  ++L +   WD++P+WQ+D
Sbjct: 6   RLQKRNGETIVSSSAVTEEEYTIANDGVKSNKKLVKIIGRFTRQLITITHWDDLPDWQKD 65

Query: 62  NDFILHGYVRETSSFIETFKSLFYLHNESVNIYSHLVPALGFFTVLLLDKSTIKVFETTT 121
           N+ I  GYV+ET+SFI  F+SLF+LHNESVNIYSH+VP L    +LL+D + IK F TTT
Sbjct: 66  NEHIHEGYVKETNSFINCFESLFFLHNESVNIYSHMVPGLCALFMLLIDINIIKKFPTTT 125

Query: 122 WKDHVVIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILFY 181
           + D+ +IDLF +GAF+CLILSS+FH LKSHSL +A  GNKLDYLGI ILIVTSM+SIL+Y
Sbjct: 126 FVDYFMIDLFLAGAFSCLILSSAFHTLKSHSLFVAIYGNKLDYLGIVILIVTSMISILYY 185

Query: 182 GYYEKFSLFCLFALITVSFGVACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGL 241
           G+Y+    F LF+ IT+ FG+AC  VSL +KFR REWRPYRA LFVCFGLS++ P+ +G+
Sbjct: 186 GFYDTPYFFHLFSTITILFGIACGTVSLANKFRSREWRPYRATLFVCFGLSAVFPVLTGI 245

Query: 242 YCYSFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVVI 301
           + Y   + + +IQL W++  G  YI GA LY MR+PE++CPG FD+WGHSHQ+FH  VVI
Sbjct: 246 WYYGLEDTFKRIQLKWIVTEGFFYIFGAFLYAMRYPERICPGAFDLWGHSHQIFHVFVVI 305

Query: 302 ASLCHLRGLLNSYELVH 318
           A+  H  GLL++YE  H
Sbjct: 306 AAYSHFHGLLSAYEYAH 322

>KLLA0D01331g Chr4 (117469..118395) [927 bp, 308 aa] {ON} similar to
           uniprot|Q12442 Saccharomyces cerevisiae YOL002C IZH2
           Membrane protein involved in zinc metabolism member of
           the four-protein IZH family direct target of the Zap1p
           transcription factor expression induced by zinc
           deficiency and fatty acids deletion increases
           sensitivity to elevated zinc
          Length = 308

 Score =  352 bits (902), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 172/299 (57%), Positives = 216/299 (72%), Gaps = 5/299 (1%)

Query: 25  KKRAAGKTSANPAEVAEAKKVLK----RLYSWDEIPEWQRDNDFILHGYVRETSSFIETF 80
           K+    + +A   E    KK ++    R+YSWDEIP+WQ+DN+ ILHGYVRET S+ E F
Sbjct: 5   KRSVVTEETALIEETPGTKKTVRVYERRVYSWDEIPDWQKDNEHILHGYVRETQSWKELF 64

Query: 81  KSLFYLHNESVNIYSHLVPALG-FFTVLLLDKSTIKVFETTTWKDHVVIDLFYSGAFACL 139
            SLFYLHNESVNIY+HL+PA+  FF +L      I  + TT+  D+ +I+LF+ G   CL
Sbjct: 65  HSLFYLHNESVNIYTHLIPAVALFFIMLFATHHVINEYPTTSAIDYFMINLFFFGCATCL 124

Query: 140 ILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILFYGYYEKFSLFCLFALITVS 199
            +SS FH +K HSL IAT GNKLDYLGI +LI TSM+SILFYG+++   LF  FA +T  
Sbjct: 125 TMSSMFHTIKCHSLPIATFGNKLDYLGIVVLISTSMISILFYGFHDSSLLFYPFAGLTSL 184

Query: 200 FGVACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYCYSFSEIWTQIQLFWVL 259
           FG+ C  +SLKDKFR REWRPYRA +FV FGLS++ PI +G   Y   E W ++QL WV+
Sbjct: 185 FGLICGYMSLKDKFRSREWRPYRATMFVLFGLSAVFPIVAGFIVYGKDETWKRVQLTWVI 244

Query: 260 LGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVVIASLCHLRGLLNSYELVH 318
             GVLYI GA LYG+RFPE++ PGKFDIWGHSHQLFH LVV+A+LCHL+ L+ SY LVH
Sbjct: 245 WEGVLYIFGAFLYGVRFPERLAPGKFDIWGHSHQLFHVLVVVAALCHLKALVVSYGLVH 303

>Kpol_1032.9 s1032 (22700..23656) [957 bp, 318 aa] {ON}
           (22700..23656) [957 nt, 319 aa]
          Length = 318

 Score =  350 bits (899), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 157/276 (56%), Positives = 216/276 (78%)

Query: 48  RLYSWDEIPEWQRDNDFILHGYVRETSSFIETFKSLFYLHNESVNIYSHLVPALGFFTVL 107
           +L +W+ +P+WQ+DN+ IL GYV+ET+S      SL ++HNESVNI+SHLVPA  F T +
Sbjct: 40  QLVTWEHLPDWQKDNEHILSGYVKETNSIKACLHSLLFIHNESVNIFSHLVPAFCFMTTI 99

Query: 108 LLDKSTIKVFETTTWKDHVVIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGI 167
           + DK  ++ + TTT KD++++DLF  GAF CL++SS+FHCLK+HS  +++ GNKLDYLGI
Sbjct: 100 IFDKYVVERYPTTTLKDYLMLDLFLFGAFTCLMMSSAFHCLKAHSPYVSSFGNKLDYLGI 159

Query: 168 CILIVTSMVSILFYGYYEKFSLFCLFALITVSFGVACSIVSLKDKFRKREWRPYRAGLFV 227
            +LIV+SM SIL+YG+Y+   L+  F+ IT +FG++C++VSL ++FR REWRPYRA +FV
Sbjct: 160 VVLIVSSMSSILYYGFYDNSFLYFTFSAITFTFGLSCAVVSLGERFRAREWRPYRAAMFV 219

Query: 228 CFGLSSIVPIFSGLYCYSFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDI 287
            FGLS+++PIF+G   Y   E   ++QL WV+L GV YI GA+LYG+RFPE++ PG FDI
Sbjct: 220 AFGLSALLPIFAGFLYYGVQETTIRVQLKWVVLEGVFYIFGALLYGVRFPERLKPGMFDI 279

Query: 288 WGHSHQLFHFLVVIASLCHLRGLLNSYELVHIKMES 323
           WGHSHQLFH LVV+A+LCHLRGLL SY +VH ++ S
Sbjct: 280 WGHSHQLFHILVVVAALCHLRGLLGSYTIVHTRLSS 315

>ACL002C Chr3 complement(353449..354438) [990 bp, 329 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL002C
          Length = 329

 Score =  342 bits (876), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 155/275 (56%), Positives = 208/275 (75%)

Query: 46  LKRLYSWDEIPEWQRDNDFILHGYVRETSSFIETFKSLFYLHNESVNIYSHLVPALGFFT 105
           +  L SWD++P+WQ+DN+ IL GYVRET+S+ +TF+SLFYLHNESVNIYSHL+P + F  
Sbjct: 49  VSSLCSWDDLPDWQKDNEHILSGYVRETNSYRKTFRSLFYLHNESVNIYSHLIPGICFLF 108

Query: 106 VLLLDKSTIKVFETTTWKDHVVIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYL 165
           + L +K  +  + TTTWKD+++ID+F  GA  CL LS  +HC+KSHSL ++  GNKLDY+
Sbjct: 109 IALFNKYVVADYSTTTWKDYLMIDIFLLGAVVCLTLSGVYHCMKSHSLEVSVFGNKLDYI 168

Query: 166 GICILIVTSMVSILFYGYYEKFSLFCLFALITVSFGVACSIVSLKDKFRKREWRPYRAGL 225
           GI  LI  SM+S ++YG+Y+  ++F LF+ +T+S  +AC++VSL   FR REWR YRA +
Sbjct: 169 GIVALISCSMISQMYYGFYDSTAMFSLFSTVTLSLALACAVVSLSPHFRSREWRKYRAAI 228

Query: 226 FVCFGLSSIVPIFSGLYCYSFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKF 285
           F  FGLS ++P+ +  + Y   E +++IQL W+ L GVLYI GAVLYG+RFPEK+ PG F
Sbjct: 229 FTAFGLSGLLPVITSCFYYGPIEAYSRIQLKWLSLEGVLYISGAVLYGVRFPEKLEPGSF 288

Query: 286 DIWGHSHQLFHFLVVIASLCHLRGLLNSYELVHIK 320
           DIWGHSHQLFH LVVIA+LCHLR LL+ Y+ VH  
Sbjct: 289 DIWGHSHQLFHVLVVIAALCHLRALLSCYKNVHTN 323

>SAKL0C09218g Chr3 (839747..840691) [945 bp, 314 aa] {ON} similar to
           uniprot|Q6Q557 Saccharomyces cerevisiae YDR492W IZH1
           Membrane protein involved in zinc metabolism member of
           the four-protein IZH family transcription is regulated
           directly by Zap1p expression induced by zinc deficiency
           and fatty acids deletion increases sensitivity to
           elevated zinc
          Length = 314

 Score =  280 bits (715), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 141/306 (46%), Positives = 199/306 (65%), Gaps = 6/306 (1%)

Query: 15  LERTKSVQELKKRAAGKTSANPAEVAEAKKVLKRLYSWDEIPEWQRDNDFILHGYVRETS 74
           +  T +V++ +++   K SA     A+ +K   RL +++E+P+WQ+DN+ IL GYVRET 
Sbjct: 1   MSSTTTVRQ-RRKTTQKASAESIATAKGRK---RLCTFEELPDWQKDNELILDGYVRETR 56

Query: 75  SFIETFKSLFYLHNESVNIYSHLVPALGFFTVL--LLDKSTIKVFETTTWKDHVVIDLFY 132
           S  E FKSL Y HNE+VNIY+HLVP + +  +L  L D   I  F ++T  D+++I+ F 
Sbjct: 57  SVSECFKSLLYFHNETVNIYTHLVPGVTYLLMLMFLTDFILIPKFPSSTMTDYIIINFFL 116

Query: 133 SGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILFYGYYEKFSLFCL 192
            GAF CL+ SS FHCLK HS   + + +K+DY+GI +LI  SMVSIL+YG+++    F +
Sbjct: 117 LGAFVCLMCSSCFHCLKQHSEEHSDIWSKVDYMGIIVLISCSMVSILYYGFHDHLFHFKI 176

Query: 193 FALITVSFGVACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYCYSFSEIWTQ 252
           F ++TV  G  C+   L D+F  + +R +RA  FV FG S +VPI  GL  +  SE   +
Sbjct: 177 FTVVTVILGSCCAAFVLNDRFNSKNFRVFRASFFVSFGFSGLVPIIFGLVKFGISESVHR 236

Query: 253 IQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVVIASLCHLRGLLN 312
           +QL +V L  V YI GAV YG R PE   PGKFD+ GHSHQ+FH +VV+ SLCHLR ++ 
Sbjct: 237 VQLKYVGLEAVFYIGGAVFYGFRIPENFGPGKFDLVGHSHQIFHVMVVLGSLCHLRAVVG 296

Query: 313 SYELVH 318
           SY  +H
Sbjct: 297 SYIFMH 302

>KLTH0C09504g Chr3 complement(788442..789401) [960 bp, 319 aa] {ON}
           similar to uniprot|Q6Q557 Saccharomyces cerevisiae
           YDR492W IZH1 Membrane protein involved in zinc
           metabolism member of the four-protein IZH family
           transcription is regulated directly by Zap1p expression
           induced by zinc deficiency and fatty acids deletion
           increases sensitivity to elevated zinc
          Length = 319

 Score =  276 bits (707), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 141/313 (45%), Positives = 193/313 (61%), Gaps = 10/313 (3%)

Query: 13  TLLERTKSVQELKKRAAGKTSANPAEVAEAKKVLKRLYSWDEIPEWQRDNDFILHGYVRE 72
           TL +R +     K +A    +  P +          L  ++E+P+WQRDND IL GYVRE
Sbjct: 6   TLRQRRQQCAPNKGKAGTSGATAPGK--------NGLCCFEELPDWQRDNDKILAGYVRE 57

Query: 73  TSSFIETFKSLFYLHNESVNIYSHLVPALGFFTVLLL--DKSTIKVFETTTWKDHVVIDL 130
           T+S  + F+SL Y HNE+VNIY+HL+P+  +  +L+   D   I  F TTT  D+++I+ 
Sbjct: 58  TNSMKKCFESLTYFHNETVNIYTHLIPSGTYLVMLMFFTDLFLIPQFPTTTMSDYIMINF 117

Query: 131 FYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILFYGYYEKFSLF 190
           F  GAF CL+ S+ FHCLK HS   + + +K+DY+GI +LI  S VS+L+YG+Y+    F
Sbjct: 118 FLLGAFLCLMCSTCFHCLKQHSEAQSNIWSKVDYMGIIVLISCSTVSLLYYGFYDYLFHF 177

Query: 191 CLFALITVSFGVACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYCYSFSEIW 250
            +F +  V  G  C+   L D+F  + WR  RAG FV FG S IVPI  GL  +  +E  
Sbjct: 178 KMFTIAVVVLGSCCAAFVLNDRFNAKNWRACRAGFFVTFGFSGIVPIVVGLVKFGIAESS 237

Query: 251 TQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVVIASLCHLRGL 310
            ++QL +VLL  + YI GAV+YG R PE + PGKFD  GHSHQ+FH LVV+ SLCH R L
Sbjct: 238 KRVQLRFVLLEALFYISGAVIYGFRIPETLLPGKFDFVGHSHQIFHILVVLGSLCHFRAL 297

Query: 311 LNSYELVHIKMES 323
           L SY  +H  + S
Sbjct: 298 LGSYFFMHTGISS 310

>YDR492W Chr4 (1434924..1435874) [951 bp, 316 aa] {ON}  IZH1Membrane
           protein involved in zinc ion homeostasis, member of the
           four-protein IZH family; transcription is regulated
           directly by Zap1p, expression induced by zinc deficiency
           and fatty acids; deletion increases sensitivity to
           elevated zinc
          Length = 316

 Score =  274 bits (701), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 134/309 (43%), Positives = 202/309 (65%), Gaps = 4/309 (1%)

Query: 12  STLLERTKSVQELKKRAAGKTSANPAEVAEAKKVLKRLYSWDEIPEWQRDNDFILHGYVR 71
           +T      SV     RA+ K  A   +    K+  K L+++DE+PEWQ+DND IL GYVR
Sbjct: 5   TTRRRNQDSVCCKATRASIKVEAVSGQTVFEKQ--KLLHNFDELPEWQKDNDKILTGYVR 62

Query: 72  ETSSFIETFKSLFYLHNESVNIYSHLVPALGFF--TVLLLDKSTIKVFETTTWKDHVVID 129
           ET S+ +   SLFY +NE+VNIY+HLVPA+ +F   + L +   I VF +T+W D+ VI+
Sbjct: 63  ETLSWKKCLYSLFYWNNETVNIYTHLVPAIVYFVFAITLTNYFLIPVFPSTSWSDYTVIN 122

Query: 130 LFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILFYGYYEKFSL 189
           +F  GAF+CL+ SS FHC+K HS + +   +KLDYLGI  LI  SM+ I+++GY++  S 
Sbjct: 123 IFLMGAFSCLMCSSCFHCMKQHSEKQSNFWSKLDYLGIISLISCSMIPIIYFGYFDHISY 182

Query: 190 FCLFALITVSFGVACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYCYSFSEI 249
           F LF ++T+     C++  L DKF    +RP+RA  F+ FG S ++P+ +G + +    +
Sbjct: 183 FSLFTIVTLVLATFCTVCVLHDKFNTSTFRPFRAMFFILFGFSGLLPLTTGFFKFGIQGV 242

Query: 250 WTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVVIASLCHLRG 309
             +I++ +V    + YI GAV+YG R PE + PGKFD +G SHQ+FH +VV+ S+CHL+ 
Sbjct: 243 LNRIKVSFVFWEALFYISGAVIYGFRIPETLAPGKFDFFGSSHQIFHIMVVLGSVCHLKA 302

Query: 310 LLNSYELVH 318
           +++SY+L+H
Sbjct: 303 IIDSYKLMH 311

>Skud_4.766 Chr4 (1354630..1355580) [951 bp, 316 aa] {ON} YDR492W
           (REAL)
          Length = 316

 Score =  273 bits (699), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 135/309 (43%), Positives = 202/309 (65%), Gaps = 4/309 (1%)

Query: 12  STLLERTKSVQELKKRAAGKTSANPAEVAEAKKVLKRLYSWDEIPEWQRDNDFILHGYVR 71
           +T     +SV      A+ K  A  ++ A  K+  K L+++DE+PEWQ+DND IL GYVR
Sbjct: 5   TTRRRNQESVCCKATTASIKVEAVQSKTASEKE--KLLHNFDELPEWQKDNDKILTGYVR 62

Query: 72  ETSSFIETFKSLFYLHNESVNIYSHLVPALGFF--TVLLLDKSTIKVFETTTWKDHVVID 129
           ET S+ +  +SLFY +NE+VNIY+HLVPA+ +F   + L +   I VF +T+W D+ VI+
Sbjct: 63  ETLSWKKCLRSLFYWNNETVNIYTHLVPAIIYFLFAITLTNYFLIPVFPSTSWSDYTVIN 122

Query: 130 LFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILFYGYYEKFSL 189
           +F  GAF+CL+ SS FHCLK HS   +   +KLDYLGI  LI  SM+ I+++GY++  S 
Sbjct: 123 IFLMGAFSCLMCSSCFHCLKQHSEEQSNFWSKLDYLGIISLISCSMIPIIYFGYFDHVSY 182

Query: 190 FCLFALITVSFGVACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYCYSFSEI 249
           F LF  +T+     C++  L +KF    +RP+RA  F+ FG S ++P+ +G + +    +
Sbjct: 183 FSLFTTVTLVLATFCTVCVLHEKFNTSTFRPFRAMFFILFGFSGLLPLTTGFFKFGIQGV 242

Query: 250 WTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVVIASLCHLRG 309
             +I++ +V    + YI GAV+YG R PE + PGKFD  G SHQ+FH +VV+ SLCHL+ 
Sbjct: 243 LNRIKVSFVFWEALFYISGAVIYGFRIPETIAPGKFDFLGSSHQIFHIMVVLGSLCHLKA 302

Query: 310 LLNSYELVH 318
           +++SY+L+H
Sbjct: 303 IIDSYKLMH 311

>TPHA0A00640 Chr1 complement(115042..116025) [984 bp, 327 aa] {ON}
           Anc_3.90 YOL101C
          Length = 327

 Score =  272 bits (696), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 139/317 (43%), Positives = 200/317 (63%), Gaps = 9/317 (2%)

Query: 4   VRKESFQMSTLLERTKSVQELKKRAAGKTSANPAEVAEAKKVLKRLYSWDEIPEWQRDND 63
           V +   Q S L  R  SV +      G       E+ E     K+LYS+ E+PEWQ+DN+
Sbjct: 7   VHRGEEQSSKLSRRRFSVSK-----NGTVLLESTEIVETYS--KKLYSFHELPEWQKDNE 59

Query: 64  FILHGYVRETSSFIETFKSLFYLHNESVNIYSHLVPALGFFTVLLL--DKSTIKVFETTT 121
            I+ GYVRET+S+ + F SL Y HNES+NIY+HL+P L +F +LL   D   +  F +TT
Sbjct: 60  LIIQGYVRETNSWFKCFHSLSYFHNESINIYTHLIPGLVYFIMLLFYTDLLVVPSFPSTT 119

Query: 122 WKDHVVIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILFY 181
             D++VID +  GAF CL+ SS FHCLK HS   +   +K+DY+GI  LI  S++S+L+Y
Sbjct: 120 IMDYIVIDFYLLGAFICLVGSSCFHCLKQHSEDQSNFWSKIDYVGIICLISCSLISLLYY 179

Query: 182 GYYEKFSLFCLFALITVSFGVACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGL 241
           GY++ F  F +F LIT+     C++  L ++F  + +RP RAG FV F  S+++PI +GL
Sbjct: 180 GYFDHFIYFKVFTLITLILATICTVCVLDERFNAKNFRPIRAGFFVVFATSAVIPICTGL 239

Query: 242 YCYSFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVVI 301
             + + E+  +IQL +V      Y++GA+LYG R PE   PG+FD+ G SHQ+FH +VVI
Sbjct: 240 IKFDYVEVINRIQLRFVGWETFFYVVGALLYGYRIPEIFAPGRFDLVGSSHQIFHVMVVI 299

Query: 302 ASLCHLRGLLNSYELVH 318
            SL HL+ ++ SYE +H
Sbjct: 300 GSLFHLKAVIGSYEFMH 316

>CAGL0G04631g Chr7 (441149..442099) [951 bp, 316 aa] {ON} similar to
           uniprot|Q03419 Saccharomyces cerevisiae YDR492w
          Length = 316

 Score =  271 bits (694), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 139/310 (44%), Positives = 201/310 (64%), Gaps = 8/310 (2%)

Query: 12  STLLER-TKSVQELKKRAAGKTSANPAEVAEAKKVLKRLYSWDEIPEWQRDNDFILHGYV 70
           +TL +R +KSV E   R  G   A+  E +E     K L+ ++E+PEWQ+DND IL GYV
Sbjct: 5   TTLRKRASKSVGESGGRNDGSIHAHGEEKSE-----KLLWHFNELPEWQKDNDKILRGYV 59

Query: 71  RETSSFIETFKSLFYLHNESVNIYSHLVPALGF--FTVLLLDKSTIKVFETTTWKDHVVI 128
           RET+SF    +SL YL+NESVNIY+HL+PA+ +   ++ L +   I V+ +T+  D+V+I
Sbjct: 60  RETNSFKRCLQSLLYLNNESVNIYTHLIPAVFYISLSLYLANVFLIPVYPSTSSVDYVII 119

Query: 129 DLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILFYGYYEKFS 188
           ++F+ GAF CL+ SS FHC+K HS     + +KLDYLGI  LI  S V +++YGY++  S
Sbjct: 120 NVFFLGAFFCLLCSSCFHCMKQHSESQCNVWSKLDYLGIICLISCSTVPMIYYGYFDHIS 179

Query: 189 LFCLFALITVSFGVACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYCYSFSE 248
            F +F  IT+   + CS+  L DKF   E+RP RA  F  FG S I+P+ +G   +    
Sbjct: 180 EFTIFTGITLLLAIGCSVFVLTDKFNTTEYRPIRASFFTLFGFSGIIPLGAGFLKFGAEG 239

Query: 249 IWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVVIASLCHLR 308
           +  +I L ++ L  + YI GA++YG RFPE + PGKFD +G SHQ+FH +VV+ S+CHL 
Sbjct: 240 VLQRISLPFIGLEALFYISGAIIYGFRFPETIAPGKFDFFGSSHQIFHIMVVLGSICHLF 299

Query: 309 GLLNSYELVH 318
            ++ SY L+H
Sbjct: 300 AMVESYHLIH 309

>NDAI0A07160 Chr1 complement(1630482..1631474) [993 bp, 330 aa] {ON}
           Anc_3.90
          Length = 330

 Score =  271 bits (694), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 141/316 (44%), Positives = 206/316 (65%), Gaps = 11/316 (3%)

Query: 12  STLLERTKS-----VQELKKRAAGKTSANPAEVAEAKKVLKRLYSWDEIPEWQRDNDFIL 66
           +T L R++S     + E        TS  P      +K+   L  +DE+PEWQ+DND IL
Sbjct: 13  TTCLLRSRSNSVGGIFETNHLEDNDTSQKPKTNRRKRKI--HLSKFDELPEWQKDNDKIL 70

Query: 67  HGYVRETSSFIETFKSLFYLHNESVNIYSHLVPALGFF----TVLLLDKSTIKVFETTTW 122
            GYVRET+SFI  F+SLFYL+NE++NIY+HL+P++ +     T + ++   I  F TT+ 
Sbjct: 71  TGYVRETNSFIHCFQSLFYLNNETINIYTHLIPSIIYLIVSLTFIFINFIAIPKFPTTSV 130

Query: 123 KDHVVIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILFYG 182
            D++VI++F  GAF CL+LSS FHCLK HS +  TL +KLDY+GI ILI  S++ IL++G
Sbjct: 131 IDYIVINIFILGAFTCLLLSSCFHCLKQHSFKQCTLWSKLDYIGIIILISCSIIPILYFG 190

Query: 183 YYEKFSLFCLFALITVSFGVACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLY 242
           Y+++ S F  F ++T SF + CSI+ L +KF    +RP RAGLF+ F  + ++P+ +G Y
Sbjct: 191 YFDRLSYFKFFTILTFSFAIVCSIIVLNEKFDLPSYRPLRAGLFMLFSFTGLIPMITGFY 250

Query: 243 CYSFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVVIA 302
            + +  +  +I L +VLL  + YIIG +LYG R PE   PG FD++G SHQ+FH  VV+ 
Sbjct: 251 IFGYKGVMERISLNFVLLEAIFYIIGTLLYGFRIPETFKPGNFDMFGSSHQIFHIFVVLG 310

Query: 303 SLCHLRGLLNSYELVH 318
           S+CH   ++ SY L+H
Sbjct: 311 SICHFGAVIKSYCLMH 326

>Suva_2.668 Chr2 (1186763..1187710) [948 bp, 315 aa] {ON} YDR492W
           (REAL)
          Length = 315

 Score =  271 bits (692), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 135/312 (43%), Positives = 204/312 (65%), Gaps = 6/312 (1%)

Query: 18  TKSVQELKKRAAGKTSAN-PAEVAEAKKVLKR---LYSWDEIPEWQRDNDFILHGYVRET 73
           T + +  ++    KTS +   E  ++K  L++   L+ + E+P+WQRDND IL GYVRET
Sbjct: 4   TATRRRNQENVCCKTSTSIKVEALKSKVTLRKEKLLHDFHELPDWQRDNDKILTGYVRET 63

Query: 74  SSFIETFKSLFYLHNESVNIYSHLVPALGFFT--VLLLDKSTIKVFETTTWKDHVVIDLF 131
            S+ +   SLFY +NE+VNIY+HLVPA+ +F   V L +   I VF +TTW D+ VI++F
Sbjct: 64  LSWKKCLYSLFYWNNETVNIYTHLVPAIVYFVFGVTLTNYFLIPVFPSTTWSDYTVINIF 123

Query: 132 YSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILFYGYYEKFSLFC 191
             GAF CL+ SS FHC+K HS + +   +KLDYLGI  LI  SM+ I+++GY++  S F 
Sbjct: 124 LMGAFLCLMCSSCFHCMKQHSEKQSDFWSKLDYLGIISLISCSMIPIIYFGYFDHASYFS 183

Query: 192 LFALITVSFGVACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYCYSFSEIWT 251
           LF ++T+     C+I  L DKF    +RP+RA  F+ FG S ++P+ +GL+ +    +  
Sbjct: 184 LFTIVTLVLATFCTICVLHDKFNTSTFRPFRAMFFILFGFSGLLPLTTGLFKFGLQGVLN 243

Query: 252 QIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVVIASLCHLRGLL 311
           +I++ +V    + YI GA++YG R PE + PGKFD +G SHQ+FH +VV+ S+CHL+ ++
Sbjct: 244 RIRVSFVFWEALFYISGALIYGFRIPETLAPGKFDFFGSSHQIFHIMVVLGSVCHLKAII 303

Query: 312 NSYELVHIKMES 323
           +SY+L+H    S
Sbjct: 304 DSYKLMHSHFHS 315

>TDEL0D05340 Chr4 (969608..970558) [951 bp, 316 aa] {ON} Anc_3.90
           YOL101C
          Length = 316

 Score =  270 bits (689), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 135/314 (42%), Positives = 201/314 (64%), Gaps = 12/314 (3%)

Query: 12  STLLERTKSVQELKKRAAGKTSANPAEVAEAKKVLKRLYSWDEIPEWQRDNDFILHGYVR 71
           +T+ +R  +VQE +K          A  ++   + K+LY ++E+PEWQ+DND IL GYVR
Sbjct: 5   TTIRQRKTTVQETQK----------ARDSKDGIMGKKLYHFNELPEWQQDNDKILTGYVR 54

Query: 72  ETSSFIETFKSLFYLHNESVNIYSHLVPALGFFTVLLL--DKSTIKVFETTTWKDHVVID 129
           ET S +    SL Y +NESVNIY+HL+ A+ +F +LL   D   I  F +TT  D+++I+
Sbjct: 55  ETKSVLRCLDSLSYWNNESVNIYTHLLSAVAYFVLLLFFTDILLIPSFPSTTMTDYIIIN 114

Query: 130 LFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILFYGYYEKFSL 189
            +  GAF CL+ SS FHC K HS   +   +K+DY+GI  LI  S++S+L+YGY++    
Sbjct: 115 FYLLGAFVCLMCSSCFHCFKQHSNSQSDAWSKVDYMGIIGLISCSVISLLYYGYFDHVFY 174

Query: 190 FCLFALITVSFGVACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYCYSFSEI 249
           F LF++ITV   +ACS+  L D+F   + RP RA  F+ F  SS++PI +G++ + ++E+
Sbjct: 175 FKLFSVITVVLAMACSVCVLSDRFNTSDMRPLRASFFITFAFSSVIPIATGMFKFGWTEV 234

Query: 250 WTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVVIASLCHLRG 309
           + ++QL +V      Y+ GA+LYG R PE + PGKFD  G SHQLFH LVV+ S CHLR 
Sbjct: 235 FHRVQLRFVGWEAFFYLSGALLYGYRIPETIAPGKFDFIGSSHQLFHVLVVLGSFCHLRA 294

Query: 310 LLNSYELVHIKMES 323
           ++ SY  +H  + +
Sbjct: 295 VMGSYMFMHAHINA 308

>Smik_4.769 Chr4 (1356263..1357213) [951 bp, 316 aa] {ON} YDR492W
           (REAL)
          Length = 316

 Score =  268 bits (686), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 128/288 (44%), Positives = 195/288 (67%), Gaps = 5/288 (1%)

Query: 33  SANPAEVAEAKKVLKRLYSWDEIPEWQRDNDFILHGYVRETSSFIETFKSLFYLHNESVN 92
           + +   V+E KK+L   +++DE+PEWQ+DND IL GYVRET S+ +   SLFY +NE+VN
Sbjct: 27  AVSSTTVSEKKKLL---HNFDELPEWQKDNDKILTGYVRETLSWKKCLYSLFYWNNETVN 83

Query: 93  IYSHLVPALGFF--TVLLLDKSTIKVFETTTWKDHVVIDLFYSGAFACLILSSSFHCLKS 150
           IY+HLVPA+ +F   + L +   I VF +T+W D+ VI++F  GAF+CL+ SS FHC+K 
Sbjct: 84  IYTHLVPAVIYFVFAITLTNYFLIPVFPSTSWSDYTVINIFLMGAFSCLMCSSCFHCMKQ 143

Query: 151 HSLRIATLGNKLDYLGICILIVTSMVSILFYGYYEKFSLFCLFALITVSFGVACSIVSLK 210
           HS + +   +KLDYLGI  LI  SM+ I+++GY++  S F LF ++T+     C++  L 
Sbjct: 144 HSEKQSNFWSKLDYLGIISLISCSMIPIIYFGYFDHISYFSLFTIVTLVLATFCTVCVLH 203

Query: 211 DKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYCYSFSEIWTQIQLFWVLLGGVLYIIGAV 270
           +KF    +RP+RA  F+ FG S ++P+ +G + +    +  +I++ +V    + YI GAV
Sbjct: 204 EKFNTSTFRPFRAMFFILFGFSGLLPLTTGFFKFGIQGVLNRIKVSFVFWEALFYISGAV 263

Query: 271 LYGMRFPEKVCPGKFDIWGHSHQLFHFLVVIASLCHLRGLLNSYELVH 318
           +YG R PE + PGKFD  G SHQ+FH +VV+ S+CHL+ ++ SY+L+H
Sbjct: 264 IYGFRIPETLAPGKFDFLGSSHQIFHIMVVLGSICHLKAIIGSYKLMH 311

>Kwal_56.22704 s56 (244431..245393) [963 bp, 320 aa] {ON} YDR492W -
           Hypothetical ORF [contig 184] FULL
          Length = 320

 Score =  265 bits (677), Expect = 7e-87,   Method: Compositional matrix adjust.
 Identities = 135/304 (44%), Positives = 194/304 (63%), Gaps = 6/304 (1%)

Query: 25  KKRAAGKTSANPAEVAEAKKVLKR--LYSWDEIPEWQRDNDFILHGYVRETSSFIETFKS 82
           ++R+A K      + +++ +  K+  L  ++E+PEWQRDN+ IL GYVRET S  +  +S
Sbjct: 9   QRRSACKNELKNGKNSKSAEQTKKSALCRFEELPEWQRDNEKILAGYVRETRSMRKCLES 68

Query: 83  LFYLHNESVNIYSHLVPALGFFTVLLL---DKSTIKVFETTTWKDHVVIDLFYSGAFACL 139
           L Y HNE++NIY+HL+P+ G + VLL+   D   I  F +TT  D+++I+ +  GAF CL
Sbjct: 69  LTYFHNETLNIYTHLIPS-GTYLVLLMFFTDVFLIPHFPSTTMSDYIMINFYLLGAFLCL 127

Query: 140 ILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILFYGYYEKFSLFCLFALITVS 199
           + S+ FHCLK HS   + + +K+DY+GI +LI  S VS+L+YG+++    F +F +  V 
Sbjct: 128 LCSTCFHCLKQHSEAQSNIWSKVDYMGIIVLISCSTVSLLYYGFHDYLFHFKIFTIAVVV 187

Query: 200 FGVACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYCYSFSEIWTQIQLFWVL 259
            G  C+   L D+F  + WR  RAG FV FG S IVPI  GL  +  +E   ++QL +VL
Sbjct: 188 LGSCCAAFVLNDRFNAKNWRACRAGFFVTFGFSGIVPIIMGLVKFGVAESSKRVQLRFVL 247

Query: 260 LGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVVIASLCHLRGLLNSYELVHI 319
           L    YI GA++YG R PE + PGKFD  GHSHQ+FH LVV+ SLCH R L+ SY  +H 
Sbjct: 248 LEAFFYIGGAIIYGFRIPETLIPGKFDFVGHSHQIFHILVVLGSLCHFRALIGSYFFMHT 307

Query: 320 KMES 323
            + S
Sbjct: 308 GISS 311

>ZYRO0B06556g Chr2 (526478..527434) [957 bp, 318 aa] {ON} similar to
           uniprot|Q6Q557 Saccharomyces cerevisiae YDR492W IZH1
           Membrane protein involved in zinc metabolism member of
           the four-protein IZH family transcription is regulated
           directly by Zap1p expression induced by zinc deficiency
           and fatty acids deletion increases sensitivity to
           elevated zinc
          Length = 318

 Score =  264 bits (675), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 127/301 (42%), Positives = 194/301 (64%), Gaps = 2/301 (0%)

Query: 20  SVQELKKRAAGKTSANPAEVAEAKKVLKRLYSWDEIPEWQRDNDFILHGYVRETSSFIET 79
           S+ E+K+R     + N   + +     K LY + E+PEWQ+DND IL GY+RET S ++ 
Sbjct: 3   SITEVKRRRVPIGNGNGEGLYKEVLEEKTLYDFHELPEWQQDNDKILTGYIRETKSVLKC 62

Query: 80  FKSLFYLHNESVNIYSHLVPALGFFTVLL--LDKSTIKVFETTTWKDHVVIDLFYSGAFA 137
            +SLF  +NE+VNIY+HLV A+ +F ++L   D   +  F T+T+ D+ VI+ +  GAF 
Sbjct: 63  VRSLFIWNNETVNIYTHLVSAVSYFLLMLGITDLVMVPHFPTSTFTDYSVINFYLLGAFG 122

Query: 138 CLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILFYGYYEKFSLFCLFALIT 197
           CL+ SS FH  K HS   +   +K+DY+GI +LI  SM+S+++YG+++    F LF ++T
Sbjct: 123 CLMCSSCFHTFKQHSGPHSDAWSKVDYMGIIVLITCSMISLIYYGFFDHMEYFRLFTVLT 182

Query: 198 VSFGVACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYCYSFSEIWTQIQLFW 257
           ++   AC++  L DKF  +++RP RAG F+ FGLS + P+ +G+  +       ++QL +
Sbjct: 183 LTLATACTVCVLSDKFNHKDFRPLRAGFFIAFGLSGVFPVAAGIIKFGIQGGVQRVQLKY 242

Query: 258 VLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVVIASLCHLRGLLNSYELV 317
           + L  + YI GA++YG R PE + PG+FD WGHSHQ+FH LVVIAS  HL+ ++ SY   
Sbjct: 243 LGLEAIFYIAGALIYGFRIPETMFPGRFDFWGHSHQIFHVLVVIASFLHLKAVMGSYIFK 302

Query: 318 H 318
           H
Sbjct: 303 H 303

>AFR337W Chr6 (1051645..1052598) [954 bp, 317 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR492W (IZH1) and
           YOL101C (IZH4)
          Length = 317

 Score =  263 bits (671), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 127/300 (42%), Positives = 190/300 (63%), Gaps = 8/300 (2%)

Query: 17  RTKSVQELKKRAAGKTSANPAEVAEAKKVLKRLYSWDEIPEWQRDNDFILHGYVRETSSF 76
           + +++ E+ +  A  TS         KK +++LY++DE+P WQ+DN+ IL GYVRET+S 
Sbjct: 8   KEQTISEMAQEMAHTTSEG------LKKRIRKLYTFDELPAWQKDNELILSGYVRETNSV 61

Query: 77  IETFKSLFYLHNESVNIYSHLVPALGFFTVLLL--DKSTIKVFETTTWKDHVVIDLFYSG 134
            E  +++ Y +NES+NIY+HL+P + +  + L+  D    ++       +H ++  +  G
Sbjct: 62  KECLRAMTYFNNESINIYTHLIPGVAYLVLFLIFADLVLAQLLPGLDAGEHRMLRFYLLG 121

Query: 135 AFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILFYGYYEKFSLFCLFA 194
           AF CL  SS FHCLK HS   + L +K+DYLGI   I  S +S+L+YGY+   S F  F+
Sbjct: 122 AFTCLACSSCFHCLKQHSEPHSRLWSKVDYLGILAQITCSTISLLYYGYHSYPSHFVFFS 181

Query: 195 LITVSFGVACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYCYSFSEIWTQIQ 254
            +TV+   AC+++ L D F    +RP RA LF+ FGLS ++P+ +G Y + F+E   +IQ
Sbjct: 182 TLTVALCSACAVLVLNDSFNTVAFRPLRAFLFMAFGLSGVIPVLAGSYQFGFAEWAARIQ 241

Query: 255 LFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVVIASLCHLRGLLNSY 314
           L +VL   V YI GA++YG R PE+  PGKFD+ GHSHQ+FH LVV+ +LCH R +  SY
Sbjct: 242 LKYVLYEAVFYITGALVYGFRIPERFAPGKFDMVGHSHQIFHLLVVLGTLCHFRAVTGSY 301

>NCAS0I02570 Chr9 complement(480266..481210) [945 bp, 314 aa] {ON}
           Anc_3.90 YDR492W
          Length = 314

 Score =  262 bits (669), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 135/314 (42%), Positives = 197/314 (62%), Gaps = 2/314 (0%)

Query: 11  MSTLLERTKSVQELKKRAAGKTSANPAEVAEAKKVLKRLYSWDEIPEWQRDNDFILHGYV 70
           MS +    +   +++  A G ++ +       +   +RL++++E+PEWQRDND IL GYV
Sbjct: 1   MSRVTTTRRKPTKVQAVAVGSSNKHADGDKTKRNWKRRLFNFNELPEWQRDNDKILTGYV 60

Query: 71  RETSSFIETFKSLFYLHNESVNIYSHLVPALGFFT--VLLLDKSTIKVFETTTWKDHVVI 128
           RET SF +  +SL Y +NE++NIY+HL+PAL + T  V L++   +  F TT+  D+ VI
Sbjct: 61  RETKSFKQCLQSLLYWNNETINIYTHLIPALFYLTISVTLINYVVVPHFPTTSIMDYFVI 120

Query: 129 DLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILFYGYYEKFS 188
           ++F  GAF CLILSS FHCLK HS R  TL +KLDY+GI ILI  S++ ++++GY++   
Sbjct: 121 NVFLMGAFVCLILSSCFHCLKQHSSRQCTLWSKLDYMGIIILISCSLIPMIYFGYFDHLY 180

Query: 189 LFCLFALITVSFGVACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYCYSFSE 248
               F ++T SF   CSI  L +KF    +RP+RA +F+ F  S  +PI +G Y + F  
Sbjct: 181 YVNFFIILTFSFATLCSICVLNEKFNVPHYRPFRAIVFMLFSFSGFIPILTGFYLFGFHG 240

Query: 249 IWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVVIASLCHLR 308
           ++ ++ L +V    + YI GA LYG R PE   PG FD  G SHQ+FH LVV+ S+CH R
Sbjct: 241 VFERVALKFVAWEALFYITGATLYGFRIPECFKPGDFDFLGSSHQIFHILVVLGSICHFR 300

Query: 309 GLLNSYELVHIKME 322
            ++ SY L+H  M 
Sbjct: 301 AVIKSYILMHSSMN 314

>Ecym_3588 Chr3 (1117646..1118563) [918 bp, 305 aa] {ON} similar to
           Ashbya gossypii AFR337W
          Length = 305

 Score =  260 bits (665), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 127/277 (45%), Positives = 184/277 (66%), Gaps = 2/277 (0%)

Query: 40  AEAKKVLKRLYSWDEIPEWQRDNDFILHGYVRETSSFIETFKSLFYLHNESVNIYSHLVP 99
              K   +RLYS+DE+PEWQ+DN+ I  GYVRET+SF+E  KS+ Y +NESVNIY+HLVP
Sbjct: 13  GHKKNFNRRLYSFDELPEWQKDNELIRMGYVRETNSFLECLKSMTYFNNESVNIYTHLVP 72

Query: 100 ALGFF--TVLLLDKSTIKVFETTTWKDHVVIDLFYSGAFACLILSSSFHCLKSHSLRIAT 157
           ++ +F   +L +D     +F  TT +++++ID +  G F CL+ S+ FHCLK HS     
Sbjct: 73  SVTYFILLLLFVDLVVTPMFPGTTMREYIMIDFYLFGVFVCLMCSTCFHCLKQHSESHNR 132

Query: 158 LGNKLDYLGICILIVTSMVSILFYGYYEKFSLFCLFALITVSFGVACSIVSLKDKFRKRE 217
           + +K+DY+GI + I +S+VSIL+YG+Y+  S     +++T++ GV C    L D+F   +
Sbjct: 133 IWSKVDYIGIIVQITSSIVSILYYGFYDHISHIKWLSVLTLTLGVCCVTFVLNDRFNAID 192

Query: 218 WRPYRAGLFVCFGLSSIVPIFSGLYCYSFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFP 277
           +R  RA  F  FG S +VP+  G+Y +   E   +IQL +VL G + YI GA++YG R P
Sbjct: 193 YRLLRAIFFTVFGFSGVVPVLIGIYQFGLIEWLARIQLKFVLAGTIFYIFGALIYGFRIP 252

Query: 278 EKVCPGKFDIWGHSHQLFHFLVVIASLCHLRGLLNSY 314
           E + PGKFD  GHSHQ+FH LVV+ S+CH R ++ SY
Sbjct: 253 EALAPGKFDFIGHSHQIFHLLVVLGSICHFRAVIGSY 289

>KLLA0C12441g Chr3 complement(1057427..1058374) [948 bp, 315 aa]
           {ON} similar to uniprot|Q6Q557 Saccharomyces cerevisiae
           YDR492W IZH1 Membrane protein involved in zinc
           metabolism member of the four-protein IZH family
           transcription is regulated directly by Zap1p expression
           induced by zinc deficiency and fatty acids deletion
           increases sensitivity to elevated zinc
          Length = 315

 Score =  258 bits (659), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 134/310 (43%), Positives = 191/310 (61%), Gaps = 5/310 (1%)

Query: 15  LERTKSVQELKKRAAGKTSANPAEVAEAKKVLKRLYSWDEIPEWQRDNDFILHGYVRETS 74
           +  T +++  +  +       P  ++     +KRLY + E+PEWQ+DND I+ GY+RET 
Sbjct: 1   MSATTTIRHRRSISEKLEQLTPVAISST---IKRLYRYSELPEWQQDNDKIITGYIRETK 57

Query: 75  SFIETFKSLFYLHNESVNIYSHLVPALGFFTVL--LLDKSTIKVFETTTWKDHVVIDLFY 132
           S  E  KSLF  HNES+NIYSHLVP + +  +L  L D   +  F  +T    V+I  F 
Sbjct: 58  SVKECVKSLFLFHNESINIYSHLVPTITYLVLLVGLADMFLVPQFPNSTMMQSVMIHFFL 117

Query: 133 SGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILFYGYYEKFSLFCL 192
            G+  CL  SS FHCLK HS     + +K+DY+GI I+I  S++S+L+YG+++    F  
Sbjct: 118 LGSVLCLGCSSFFHCLKQHSESHCHIWSKVDYMGIIIMITCSIISLLYYGFHDHIFHFKC 177

Query: 193 FALITVSFGVACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYCYSFSEIWTQ 252
           F + TV  G  C++ +L DKF  + +RP+RA  +V FGLS IVPI +G + +   E   +
Sbjct: 178 FTVFTVILGTICTVFALHDKFNSKTFRPFRAMFYVTFGLSGIVPIVTGFWKFGAYEAIRR 237

Query: 253 IQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVVIASLCHLRGLLN 312
           +QL +VLL  + YI GAV+YG RFPE + PGKFD  GHSHQ+FH +VV+ S+CH R +L 
Sbjct: 238 VQLKYVLLEAMFYIAGAVIYGFRFPEVLAPGKFDFVGHSHQIFHIMVVLGSICHFRAILG 297

Query: 313 SYELVHIKME 322
           SY  +H  M 
Sbjct: 298 SYVFMHTGMH 307

>Kpol_1053.26 s1053 complement(40099..41073) [975 bp, 324 aa] {ON}
           complement(40099..41073) [975 nt, 325 aa]
          Length = 324

 Score =  258 bits (658), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 128/318 (40%), Positives = 200/318 (62%), Gaps = 4/318 (1%)

Query: 11  MSTLLERTKSVQELKKRAAGKTSANPAEVAEAKKVLK--RLYSWDEIPEWQRDNDFILHG 68
           M+ +    +    + KR   K++     +   ++  +  +L  + E+P+WQ+DN+FIL G
Sbjct: 1   MAHIATVEREYSSVSKRRTSKSANGTVTIEVEREEHEEIKLCHFHELPDWQKDNEFILTG 60

Query: 69  YVRETSSFIETFKSLFYLHNESVNIYSHLVPALGFFTVLLL--DKSTIKVFETTTWKDHV 126
           YVRET+S  +  +SL   +NES+NIYSHL+ A+ +F VLL   D   I  F +TT+ D++
Sbjct: 61  YVRETNSIKKCLRSLGCFNNESINIYSHLIAAISYFVVLLFYTDILCIPSFPSTTFVDYM 120

Query: 127 VIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILFYGYYEK 186
           VIDL+  GAF CLI SS FHC+K HS   + + +K+DY+GI  LI  S++S+L+YGY + 
Sbjct: 121 VIDLYLLGAFTCLIGSSLFHCMKQHSESHSDMWSKVDYIGIICLITCSLISLLYYGYMDH 180

Query: 187 FSLFCLFALITVSFGVACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYCYSF 246
           F  F +F +IT+     C+I  L  +F  + +RP RAG F+ F +S+++PI +G   + F
Sbjct: 181 FIYFKVFTVITLVLATICTICVLDQRFNSKNFRPIRAGFFILFSMSAVIPIGAGFSKFGF 240

Query: 247 SEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVVIASLCH 306
           +E+  +IQL +V      Y++GA+LYG R PE + PG FD+ G SHQ+FH +V++ S+ H
Sbjct: 241 TEVLQRIQLRFVAWETFFYVVGALLYGFRIPETLYPGNFDLVGSSHQIFHIMVILGSVFH 300

Query: 307 LRGLLNSYELVHIKMESG 324
           L+ +L SY  +H  + S 
Sbjct: 301 LKAVLGSYTFMHSNISSN 318

>KAFR0A08130 Chr1 (1638153..1639112) [960 bp, 319 aa] {ON} Anc_3.90
           YOL101C
          Length = 319

 Score =  247 bits (631), Expect = 6e-80,   Method: Compositional matrix adjust.
 Identities = 126/308 (40%), Positives = 193/308 (62%), Gaps = 7/308 (2%)

Query: 18  TKSVQELKKRAAGKTSANPAEVAEAKKVLKR-LYSWDEIPEWQRDNDFILHGYVRETSSF 76
           T++ +  K   + K++        + K+ KR LY + E+P WQ+DND IL GYVRET+SF
Sbjct: 7   TRTRKRSKSFRSAKSTITRTRSDSSIKIEKRILYHFHELPTWQQDNDKILGGYVRETNSF 66

Query: 77  IETFKSLFYLHNESVNIYSHLVPALGFFTV---LLLDKS---TIKVFETTTWKDHVVIDL 130
            +  +SLFYL+NES+NIYSHL+P+L + T+   LL++      I ++ TTT  D + I++
Sbjct: 67  TKCIESLFYLNNESINIYSHLIPSLIYLTIAVMLLIEIDQFLNIPIYPTTTKYDFIFINI 126

Query: 131 FYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILFYGYYEKFSLF 190
           F  GAF CL+ S  FH LK HS       +++DY+GI +LI  SM+ +L+YG+++   LF
Sbjct: 127 FLVGAFLCLLGSGCFHLLKQHSELQCNFWSRIDYMGIIVLISCSMMPVLYYGFFDHIVLF 186

Query: 191 CLFALITVSFGVACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYCYSFSEIW 250
             F  +T++F   CSI+ + + F   ++R  RA +F  FG S ++P+  G   +  S ++
Sbjct: 187 YCFITLTLAFASVCSIIVMSETFNLSKYRLLRACVFAAFGFSGLIPMIVGFSKFGLSGVF 246

Query: 251 TQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVVIASLCHLRGL 310
            +I L ++    V Y++GA LYG R PE + PGKFD++G SHQLFH  VVI S+ H + +
Sbjct: 247 QRISLKFIFWESVFYLVGATLYGFRIPESILPGKFDLFGSSHQLFHCFVVIGSVLHFKAV 306

Query: 311 LNSYELVH 318
           + SY L+H
Sbjct: 307 IESYILMH 314

>TBLA0B02290 Chr2 complement(534472..535452) [981 bp, 326 aa] {ON}
           Anc_3.90 YOL101C
          Length = 326

 Score =  245 bits (625), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 127/310 (40%), Positives = 189/310 (60%), Gaps = 19/310 (6%)

Query: 16  ERTKSVQELKKRAAGKTSANPAEVAEAKKVLKRLYSWDEIPEWQRDNDFILHGYVRETSS 75
            R+KS+  +  +AA        E  + K     LY+++E+P WQ+DN+ IL GY+RET+S
Sbjct: 18  HRSKSISSILSQAA--------EDVKQKITDTLLYTYEELPSWQQDNEMILTGYIRETNS 69

Query: 76  FIETFKSLFYLHNESVNIYSHLVPA-------LGFFTVLLLDKSTIKVFETTTWKDHVVI 128
           +    +SL + HNE++NIYSH + A       + FFT L+   S    F TTT  D++V+
Sbjct: 70  WKLCLRSLTFFHNETINIYSHGISAAIYLLLLVFFFTNLIYLPS----FPTTTLHDYLVL 125

Query: 129 DLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILFYGYYEKFS 188
           D++  GA  CL LSS FHCLK HS   + + +K+DY+GI  LI  S +S+L++GY + F+
Sbjct: 126 DIYLLGAATCLTLSSCFHCLKQHSQSQSDIWSKMDYIGIICLITCSTISLLYFGYRDHFN 185

Query: 189 LFCLFALITVSFGVACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYCYSFSE 248
            F  FA+ T    + C++    +KF  R+W+  RA  F+ F  S ++P+ +G+  + F E
Sbjct: 186 YFKFFAISTFILAITCTVFVTMEKFNTRDWKHVRALFFIAFAGSGLIPLITGINIFGFPE 245

Query: 249 IWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVVIASLCHLR 308
           +W ++QL  + L  + Y+IGA+LYG R PE   PGKFD  G+SHQ FH  VV+ SL HLR
Sbjct: 246 VWQRVQLPSLTLELICYVIGALLYGYRIPEVFAPGKFDNIGNSHQWFHIFVVLGSLLHLR 305

Query: 309 GLLNSYELVH 318
            L+ SY  +H
Sbjct: 306 ALVGSYYFMH 315

>KNAG0K02160 Chr11 (436744..437715) [972 bp, 323 aa] {ON} Anc_3.90
           YOL101C
          Length = 323

 Score =  233 bits (593), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 131/317 (41%), Positives = 186/317 (58%), Gaps = 20/317 (6%)

Query: 22  QELKKRAA--GKTSANPAEVAEAKK---------------VLKRLYSWDEIPEWQRDNDF 64
            EL+KRA   G+T+   A V+   +                  RL  ++E+P WQ+DND 
Sbjct: 3   SELRKRAVSLGETAIETATVSRGSRGKLLVTGTSSGAPSGQRGRLCRYEELPAWQQDNDC 62

Query: 65  ILHGYVRETSSFIETFKSLFYLHNESVNIYSHLVPALGFFT--VLLLDKSTIKVFETTTW 122
           I  GYVRET S      SL Y +NESVN+YSHLVPA+ +     L L +  +  F TTTW
Sbjct: 63  IRTGYVRETLSVRRCLGSLLYWNNESVNMYSHLVPAVLYIAGATLALSQWGVPRFPTTTW 122

Query: 123 KDHVVIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILFYG 182
            D+++I+ F  GA ACL+ SS FHCLK HS R     +++DY+GI +LI  S + ++++G
Sbjct: 123 SDYLIINTFLVGAGACLLCSSLFHCLKQHSERHCEAWSRMDYMGIILLIACSTIPMIYFG 182

Query: 183 YYEKFSLFCLFALITVSFGVACSIVSLKDK-FRKREWRPYRAGLFVCFGLSSIVPIFSGL 241
           Y++      LF  +TV+ GVACS V L +K F    ++  RA  F+ F  + ++P+ +G 
Sbjct: 183 YFDYMGHCLLFTAVTVALGVACSGVVLFNKQFNSSSFKLVRAAFFIAFAFNGLIPMATGF 242

Query: 242 YCYSFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVVI 301
             +    +  +I L +V    V YI GA+LYG R PE   PGK D+WG+SHQ+FH +VV 
Sbjct: 243 VKFGIPGVLDRISLKYVWFEAVFYIAGAMLYGFRVPEIWIPGKVDLWGNSHQMFHVMVVF 302

Query: 302 ASLCHLRGLLNSYELVH 318
            SLCHL+ +L SY L+H
Sbjct: 303 GSLCHLKAVLESYSLMH 319

>TBLA0B08255 Chr2 (1973757..1974647) [891 bp, 296 aa] {ON}
          Length = 296

 Score =  152 bits (384), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 87/284 (30%), Positives = 147/284 (51%), Gaps = 28/284 (9%)

Query: 48  RLYSWDEIPEWQRDNDFILHGYVRETSSFIETFKSLFYLHNESVNIYSHLVPALGFFTVL 107
           +L +++++P+WQ+DN  I++ YVRET+S  ++  S+F  H+ES+NI++HL+PAL      
Sbjct: 7   QLCNFNDLPDWQKDNPLIVNYYVRETNSLFKSLCSIFLFHSESMNIFTHLIPAL------ 60

Query: 108 LLDKSTIKVFETTTWKDHVVIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGI 167
           L  K T     T     + ++  +      C +LSS FH  K  S++      KLDY+GI
Sbjct: 61  LYAKFTYNAITTLEQVSYPIV-FYLISVIICFLLSSLFHLFKCTSVQSNEFWGKLDYVGI 119

Query: 168 CILIVTSMVSILFYGYYEKFSLFCLFALITVSFGVACSIVSLKDKFRKREW--------- 218
            +LI  ++VS+   G+ E          +T +  +   ++ L  K   ++          
Sbjct: 120 SLLINATIVSMALLGFNESRYTIMKNTFVTQTSCLTAYVIILAIKSHPKQGENEDDNDGT 179

Query: 219 ------------RPYRAGLFVCFGLSSIVPIFSGLYCYSFSEIWTQIQLFWVLLGGVLYI 266
                       +  RA LF   GLS ++P+ +GLY Y    ++ +I +  V+   + YI
Sbjct: 180 LSEDDDCCCDDHKGTRAKLFASLGLSGLIPVITGLYIYGPKVVYYKINIPMVIASVLCYI 239

Query: 267 IGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVVIASLCHLRGL 310
           +G ++Y  + PEK  PG+FD+ G SHQLFH  +V  ++CH   +
Sbjct: 240 VGTLIYVFKIPEKFYPGRFDLVGSSHQLFHIFIVFGTVCHYHAI 283

>NCAS0C04920 Chr3 complement(1003692..1004672) [981 bp, 326 aa] {ON}
           Anc_3.90
          Length = 326

 Score =  127 bits (318), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 94/324 (29%), Positives = 165/324 (50%), Gaps = 15/324 (4%)

Query: 11  MSTLLERTK-----SVQELKKRAAGKTSANPAEVAEAKKVLKRLYSWDEIPEWQRD--ND 63
           M+TL   TK      +Q+  K                 KVL  L    E+P+WQ+   N 
Sbjct: 1   MATLTSTTKKQTATEIQDADKLTPFNAPKYSVTFPRRPKVLPIL---KELPQWQKQYSNS 57

Query: 64  FILHGYVRETSSFIETFKSLFYLHNESVNIYSHLVPALGFFTVLLL--DKSTIKVFETTT 121
            I++GYVRET+S I+   ++ Y +N++VNI  + V +  +FT+LL   D   I     TT
Sbjct: 58  KIINGYVRETNSLIKCLHTVTYWNNQTVNIILNTVFSTVYFTLLLFFTDLYLIPSSPATT 117

Query: 122 WKDHVVIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILFY 181
             D+++++ +  GAF    L+S F+ L+SHSL    L  KL +L     I TS+++ L+Y
Sbjct: 118 MSDYIMVNFYLFGAFQYFALNSIFYLLESHSLAKCHLWFKLSHLAFINYISTSIITQLYY 177

Query: 182 GYYEKFSLFCLFALITVSFGVACSIVSLKDKFRKREWRPYRAGLFVCFGLS-SIVPIFSG 240
            +++    F    + T+      +I +L ++F ++  R  R  + + F +S  I+P  S 
Sbjct: 178 TFFDNVFYFKFLTISTLLISSIFAIFTLSEQFLRKN-RSQRNMVSITFIVSLLILPTASL 236

Query: 241 LYCYSFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVV 300
           ++ ++   I  +++   +LL   LY+    L  ++ PE+     FD  G+S  ++H  ++
Sbjct: 237 MFKFNTFRILRRVEGKAILLELSLYLFSMTLKAVQVPERFSEN-FDFIGNSENIYHICII 295

Query: 301 IASLCHLRGLLNSYELVHIKMESG 324
           + SL H + LLNSY  +H  +++ 
Sbjct: 296 LGSLLHFKMLLNSYFFMHSGLDAS 319

>NDAI0G04300 Chr7 (1035664..1036620) [957 bp, 318 aa] {ON} Anc_3.90
          Length = 318

 Score =  114 bits (285), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 80/283 (28%), Positives = 147/283 (51%), Gaps = 9/283 (3%)

Query: 42  AKKVLKRLYSWDEIPEWQR--DNDFILHGYVRETSSFIETFKSLFYLHNESVNIYSHLVP 99
           +K   +  Y   E+PEWQR  ++  ++ G+++ET+SF +   S  Y HN S+NI  + + 
Sbjct: 26  SKLSTRNHYKLKELPEWQREFNSGKVITGFLKETNSFKKCLWSTMYWHNSSINISLNGIA 85

Query: 100 ALGFFTVLLL--DKSTIKVFETTTWKDHVVIDLFYSGAFACLILSSSFHCLKSHSLRIAT 157
           A  +F +L    D   I  F +TT  D++V++L+   A    ++ + F+ +KSHS + A 
Sbjct: 86  ATVYFMLLFFFTDCYLIPSFPSTTMSDYIVLNLYLLTATQNFMVGTIFYIMKSHSKQQAF 145

Query: 158 LGNKLDYLGICILIVTSMVSILFYGYYEKFSLFCLFALITVSFGV--ACSIVSLKDKFRK 215
           L  KL+ +G+   I +S+V++L+Y Y++    F  F ++T+       CSI+S  D F K
Sbjct: 146 LWYKLNNIGLINHIASSVVTLLYYHYFDYVFYFKFFTIVTLLLITLFTCSIIS--DSFNK 203

Query: 216 REWRPYRAGLFVCFGLSSIVPIFSGLYCYSFSEIWTQIQLFWVLLGGVLYIIGAVLYGMR 275
                    L     L +++P    +  +  +++  +I L  ++L   +Y  G  +   +
Sbjct: 204 MTRIRKNFLLLAYIILLTLMPSLFAILRFGLAKVLERISLNLIILEIFIYAFGLTIRTSQ 263

Query: 276 FPEKVCPGKFDIWGHSHQLFHFLVVIASLCHLRGLLNSYELVH 318
            PE+     FD  G+S  ++   +++ S  H + L+NSY L+H
Sbjct: 264 LPERFF-NSFDFLGNSENVYQLSIIVCSFIHFKILMNSYCLMH 305

>CAGL0I07491g Chr9 complement(719539..720444) [906 bp, 301 aa] {ON}
           similar to uniprot|Q03419 Saccharomyces cerevisiae
           YDR492w
          Length = 301

 Score = 85.9 bits (211), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 78/295 (26%), Positives = 142/295 (48%), Gaps = 24/295 (8%)

Query: 41  EAKKVLKRLYSWDEIPEWQR--DNDFILHGYVRET-SSFIETFKSLFYLHNESVNIYSHL 97
           E K V  ++ + +++P W R   N  I  GY   T ++++   + L   +N+S++IY +L
Sbjct: 2   EKKTVQSKIVTLEKLPVWYRRYGNSRIKTGYFYYTNATYLGCLQKLVKFNNDSISIYMNL 61

Query: 98  VPAL--GFFTVLLLDKSTIKVFETTTWKDHVVIDLFYSGA---FACLILSSSFHCLKSHS 152
           V  L  G   +   D   I    +TT  D+++I+LF       FA + L      LK HS
Sbjct: 62  VCGLISGVMLLFYTDVRLIPSHPSTTMTDYIIINLFLMATTTYFATMTLG---QLLKGHS 118

Query: 153 LRIATLGNKLDYLGICILIVTSMVSILFYGYYEKFSLFCLFALITVSFGVACSIVSLKDK 212
                L N+   L + +L+  S+V++L+Y +++   LF LF + T       SIV + D+
Sbjct: 119 EYQGKLWNQAKQLALVLLLTCSIVTLLYYAFFDHVFLFKLFVIWTCLLMSITSIVIINDQ 178

Query: 213 FRKREWRPYRAGLFVCFGLSSI-VPIFSGLYCYSFSEIWTQIQLFWVLLGG--VLYIIGA 269
           +++ +    +    V FG+ SI +PI   +  +   + + + ++ + +L    VLY + A
Sbjct: 179 YKRVQ----KLSCVVIFGVLSISLPIAVSIIKFGLFDSYKKQRIPFQVLTWEIVLYSLSA 234

Query: 270 VLYGMRFPEKVCPGK------FDIWGHSHQLFHFLVVIASLCHLRGLLNSYELVH 318
           +L   R PE             D  G+S Q+   + + A + H   ++ +YE+VH
Sbjct: 235 MLQLTRLPELTLSTLGDSFWIVDYLGNSDQVSQLVTIFAIIVHFNTIIFAYEVVH 289

>Suva_15.64 Chr15 complement(100035..100973) [939 bp, 312 aa] {ON}
           YOL101C (REAL)
          Length = 312

 Score = 78.2 bits (191), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 80/311 (25%), Positives = 143/311 (45%), Gaps = 37/311 (11%)

Query: 19  KSVQELKKRAAGKTSANPAEVAEAKKVLKRLYSWDEIPEWQRDNDFILHGYVRETSSFIE 78
           K+  E    A G  ++N A+V E K+  K+ + + ++ +WQ+          +  SS  E
Sbjct: 15  KTATEKYSDATGAVTSN-ADV-ETKET-KKGFPFHDLAKWQKQ--------YKNKSSRSE 63

Query: 79  TFKSLFYLHNESVNIYSHLVPALGFFTVLLLDKSTIKVFETTTWKDHVVIDLFYSGAFAC 138
           +  +L YL   S++ +  L+    F+ + L          TTT  D++V + +    F  
Sbjct: 64  SLVALIYLLG-SMSSFCLLIFFTDFYLIPLFPT-------TTTMTDYIVFNFYLLNVFVF 115

Query: 139 LILSSSFHCLKSHSLRI-ATLGNKLDYLGICILIVTSMVSILFYGYYEKFSLFCLFALIT 197
            ++   +H +K+ SL+    +  K  YL    L+++S ++IL+Y +Y+    F +F L+ 
Sbjct: 116 CMIHFIYHFIKNISLQQHIEIWQKFSYLANINLLISSQITILYYLFYDYVFFFKIFTLLM 175

Query: 198 VSFGVACSIVSLKDKFRKREWRPYRAGLF------VCFGLSSIVPI--FSGLYCYSFSEI 249
              G+A   V L DK     ++ +   +F      VC  L  +  I  F GL       +
Sbjct: 176 TFIGLAAYFVILTDKL--NSYKRFNKTVFFISVSVVCCSLPLLTAIITFDGL-----ENL 228

Query: 250 WTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVC--PGKFDIWGHSHQLFHFLVVIASLCHL 307
             +I+L  +    V  ++ +++Y  RFPE +C    K + W HS   FH L+   +  H 
Sbjct: 229 KDRIKLNAITWELVTLVVASMIYVTRFPESLCRRNEKEEGWNHSEYFFHLLISGTAFYHF 288

Query: 308 RGLLNSYELVH 318
             L+ SY L+H
Sbjct: 289 FILIQSYILMH 299

>Skud_12.91 Chr12 complement(177334..178962) [1629 bp, 542 aa] {ON}
           YLR023C (REAL)
          Length = 542

 Score = 77.4 bits (189), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 61/233 (26%), Positives = 113/233 (48%), Gaps = 10/233 (4%)

Query: 54  EIPEWQRDNDFILHGY--VRETSSFIETFKSLFYLHNESVNIYSHLVPALGFFTVLLLDK 111
           ++P   R+N +I+HGY      S  + +  + +  HNE+ NI+SHL+ A+    + + D 
Sbjct: 219 QLPFPWRENRYIIHGYRFYNTHSKSLLSIINWYGWHNETSNIWSHLLGAMYIIYLAIYDF 278

Query: 112 STIKVFETTTWKDHV--VIDLFYSGAFACLILSSSFHCLKSHS-LRIATLGNKLDYLGIC 168
              +V+           ++ +F + A  C++ S  +H     S LR+ +    +DY GI 
Sbjct: 279 PQSEVWRNPNVPQQARWIVFMFLAAALKCMLSSVFWHTFNGTSFLRLRSKFACVDYSGIT 338

Query: 169 ILIVTSMVSILFYGYYEKFSLFCLFALITVSFGVACSIVSLKDKFRKREWRPYRAGLFVC 228
           ILI  S+++  F   Y  +   C +  I+++ GV    ++   +F + E RP R   F+ 
Sbjct: 339 ILITASILTTEFVTMYSCYWAMCTYMGISLALGVIGVFMNWSPRFDRPEARPLRIRFFI- 397

Query: 229 FGLSSIVPIFSGLYCYSFSEIWTQIQLFWVLL--GGVLYIIGAVLYGMRFPEK 279
             L + + + S L+    ++I+   +LF  +     V Y++G V YG   PE+
Sbjct: 398 --LLATMGVLSFLHLIFLTDIYYASRLFGPVTYKSVVWYLVGVVFYGSFIPER 448

>KLLA0F15510g Chr6 (1433494..1435362) [1869 bp, 622 aa] {ON} some
           similarities with uniprot|Q07959 Saccharomyces
           cerevisiae YLR023C IZH3 Membrane protein involved in
           zinc metabolism member of the four-protein IZH family
           expression induced by zinc deficiency deletion reduces
           sensitivity to elevated zinc and shortens lag phase
           overexpression reduces Zap1p activity
          Length = 622

 Score = 77.0 bits (188), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 83/315 (26%), Positives = 138/315 (43%), Gaps = 49/315 (15%)

Query: 38  EVAEAKKVLKRLYSWD--------------EIPEWQRDNDFILHGYVRETSSFIETFKSL 83
           E   + K   + Y+WD              E+P   R+N +I+HGY R   S +++  S+
Sbjct: 273 EDPHSIKKTIQFYNWDNACDLGRQRHLHFYELPFPWRENRYIIHGY-RFYDSHVKSVLSV 331

Query: 84  ---FYLHNESVNIYSHLVPALGFFTVLLLDKSTIKVF--ETTTWKDHVVIDLFYSGAFAC 138
              +  HNE++NI+SHL  A+    +L +   T KVF  +       ++I +F      C
Sbjct: 332 VNWYGWHNETLNIWSHLFGAVYLAYLLFIQLPTTKVFMSQDVPLFGKLIIQVFLIAGVKC 391

Query: 139 LILSSSFHCLKSH-SLRIATLGNKLDYLGICILIVTSMVSILFYGYYEKFSL-----FCL 192
           L+ SS +H L     L +      +DY GI +LI  S++S  F   Y   +        +
Sbjct: 392 LLSSSVWHTLNGTCCLPLRCKFACIDYTGITVLITASILSTEFVSVYNLATQSLSTSMTV 451

Query: 193 FALITVSFGVACSIVSLKDKFRKREWRPYRAGLFVCF-GLSSI----VPIFSGLYCYS-- 245
           +  +++  G+  S ++   +F + E RP+R   +V   GL  I    + I  G+   S  
Sbjct: 452 YMSLSLCLGIFGSFMNWSPRFDRPESRPFRIAFYVLLAGLGMISFLHLTISRGIDHSSQF 511

Query: 246 FSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVVIASLC 305
           F  +W +  L W       Y+IG V YG   PE+        W    +L + +   A LC
Sbjct: 512 FKPVWNR-SLIW-------YLIGVVFYGSFIPER--------WRTDVELDYTIPTDAELC 555

Query: 306 HLRGLLNSYELVHIK 320
               +L  ++ VH +
Sbjct: 556 SNLDILTKHKHVHFR 570

>NDAI0I02330 Chr9 (532412..534148) [1737 bp, 578 aa] {ON} Anc_5.197
          Length = 578

 Score = 75.9 bits (185), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 67/240 (27%), Positives = 113/240 (47%), Gaps = 24/240 (10%)

Query: 54  EIPEWQRDNDFILHGYVRETSSFIETFKSLFYL---HNESVNIYSHLVPALGFFTVLLLD 110
           ++P   R+N +I++ Y R   S  ++  S+F     HNES NI++HL+ A+    + + D
Sbjct: 254 QLPFPWRENRYIIYNY-RFYDSHKKSLLSIFNWYGWHNESSNIWTHLLGAIYLIYLSIYD 312

Query: 111 KSTIKVFET----TTWKDHVVIDLFYSGAFACLILSSSFHCLKSHS-LRIATLGNKLDYL 165
               ++F++    TT K  +++ LF   A  CL+ S  +H     S L++ +    +DY 
Sbjct: 313 FPNSEIFQSEKVPTTAK--LIVYLFLFAAIKCLLASVFWHTFNGTSFLKLRSKFACVDYS 370

Query: 166 GICILIVTSMVSILFYGYYEKFSLFCLFALITVSFGVACSIVSLKDKFRKREWRPYRAGL 225
           GI ILI  S+++  F   Y  F   C++  I++S G+    ++   KF + E RP R   
Sbjct: 371 GITILITASILTTEFVTMYSSFFAMCIYMTISLSLGMFGVFMNWSPKFDRPEARPLRIKF 430

Query: 226 FVCFGLSSIVPIFSGLYCYSFSEIWTQIQLFWVLLGGVL------YIIGAVLYGMRFPEK 279
           F+      ++      Y        T +Q    LL  V       Y++G V YG   PE+
Sbjct: 431 FILLASMGVLSFLHLTYL-------TNLQYATWLLTPVTNKSIVWYLVGVVFYGSFIPER 483

>Smik_12.86 Chr12 complement(172288..173916) [1629 bp, 542 aa] {ON}
           YLR023C (REAL)
          Length = 542

 Score = 71.6 bits (174), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 59/234 (25%), Positives = 115/234 (49%), Gaps = 12/234 (5%)

Query: 54  EIPEWQRDNDFILHGYVRETSSFIETFKSLFYL---HNESVNIYSHLVPALGFFTVLLLD 110
           ++P   R+N +I+HGY R  ++  ++  S+F     HNE+ NI+SHL+ A+    + + D
Sbjct: 219 QLPFPWRENRYIIHGY-RFYNTHSKSLLSIFNWYGWHNETSNIWSHLLGAMYLIYLAIYD 277

Query: 111 KSTIKVFETTTWKDHV--VIDLFYSGAFACLILSSSFHCLKSHS-LRIATLGNKLDYLGI 167
               +V++          ++ +F + A  C++ S  +H     S L++ +    +DY GI
Sbjct: 278 FPQSEVWKNPKVPPQARWIVFMFLAAALKCMLSSVFWHTFNGTSFLKLRSKFACVDYSGI 337

Query: 168 CILIVTSMVSILFYGYYEKFSLFCLFALITVSFGVACSIVSLKDKFRKREWRPYRAGLFV 227
            ILI  S+++  F   Y  +   C +  I+++ G+    ++   +F + E RP R   F+
Sbjct: 338 TILITASILTTEFVTMYSCYWAMCTYMGISLALGIFGVFMNWSPRFDRPEARPLRIRFFI 397

Query: 228 CFGLSSIVPIFSGLYCYSFSEIWTQIQLFWVLL--GGVLYIIGAVLYGMRFPEK 279
              L + + + S L+    +++    +LF  +     V Y++G   YG   PE+
Sbjct: 398 ---LLATMGVLSFLHLIFLTDLRYAARLFSPVTYKSVVWYLVGVAFYGSFIPER 448

>Suva_10.104 Chr10 complement(191663..193288) [1626 bp, 541 aa] {ON}
           YLR023C (REAL)
          Length = 541

 Score = 71.6 bits (174), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 63/238 (26%), Positives = 113/238 (47%), Gaps = 20/238 (8%)

Query: 54  EIPEWQRDNDFILHGYVRETSSFIET-FKSLFYL------HNESVNIYSHLVPALGFFTV 106
           ++P   R+N +I+HGY      F  T +KSL  +      HNE+ NI++HL+ A+    +
Sbjct: 219 QLPFPWRENRYIIHGY-----RFYNTHYKSLLSVINWYGWHNETSNIWTHLLGAMYIVYL 273

Query: 107 LLLDKSTIKVFETTTWKDHV--VIDLFYSGAFACLILSSSFHCLKSHS-LRIATLGNKLD 163
            + D    +V++          ++  F + A  C++ S  +H     S L + +    +D
Sbjct: 274 AVYDFPHSEVWQNPEVPQQARWIVFAFLAAALKCMLSSVFWHTFNGTSFLGLRSKFACVD 333

Query: 164 YLGICILIVTSMVSILFYGYYEKFSLFCLFALITVSFGVACSIVSLKDKFRKREWRPYRA 223
           Y GI ILI  S+++  F   Y  +   C +  I+++ GV    ++   +F + E RP R 
Sbjct: 334 YSGITILITASILTTEFVTMYSCYWAMCTYMTISLALGVFGVFMNWSPRFDRPEARPLRI 393

Query: 224 GLFVCFGLSSIVPIFSGLYCYSFSEIWTQIQLFWVLLGG--VLYIIGAVLYGMRFPEK 279
             F+   L + + + S L+    +++   I LF  +     V Y++G V YG   PE+
Sbjct: 394 RFFI---LLATMGVLSFLHLIFLTDLHYAIWLFSPVTNKSVVWYLVGVVFYGSFIPER 448

>KAFR0J00670 Chr10 (120378..121907) [1530 bp, 509 aa] {ON} Anc_5.197
           YLR023C
          Length = 509

 Score = 71.2 bits (173), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 67/232 (28%), Positives = 109/232 (46%), Gaps = 10/232 (4%)

Query: 54  EIPEWQRDNDFILHGYVRETSSFIETFKSLFYLHNESVNIYSHLVPALGFFTVLLLD--K 111
           ++P   R+N +I++ Y R   S  ++  S+F LHNE+ NI+SHL+ A+ F  VL  D   
Sbjct: 197 QLPFPYRENRYIINNY-RFYDSHKKSLLSIFKLHNEATNIWSHLLGAIYFLYVLFHDLPN 255

Query: 112 STIKVFETTTWKDHVVIDLFYSGAFACLILSSSFHCLKSHS-LRIATLGNKLDYLGICIL 170
           S I           + + LF   +  C++ S+ +H     S L++      +DY GI IL
Sbjct: 256 SIIVSSSMVPTTAKLFLYLFVFASLKCMLSSTFYHTFNGTSMLKLRRKFMCVDYSGISIL 315

Query: 171 IVTSMVSILFYGYYEKFSLFCLFALITVSFGVACSIVSLKDKFRKREWRPYRAGLFVCFG 230
           I +S++SI F   Y+  ++   +   +   GV    ++    F   E RP R   F+   
Sbjct: 316 ITSSILSIQFISLYDYPNILKFYMCASFMLGVLGIFMNWSPLFDSPEARPLRIKFFI--- 372

Query: 231 LSSIVPIFSGLY-CYSFSEIWTQIQLFWVLLGG--VLYIIGAVLYGMRFPEK 279
           L S    F+ L+  +    I+  I +   L     V Y++G V YG   PE+
Sbjct: 373 LLSSCGAFALLHLVFLEKSIFAAIDVLLPLTNKSIVWYLVGVVFYGSFIPER 424

>NCAS0D02600 Chr4 (499689..501320) [1632 bp, 543 aa] {ON} Anc_5.197
           YLR023C
          Length = 543

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 75/290 (25%), Positives = 132/290 (45%), Gaps = 26/290 (8%)

Query: 4   VRKESFQMSTLLER---TKSVQELKKRAAGKTSANPAEVAEAKKVLKRLYSWDEIPEWQR 60
           V  E F++  + E    TK  +E+K            E+ + + +     ++ ++P   R
Sbjct: 172 VFNEEFKLDVVTEYQPLTKPSEEVKNLICSYNHEVAYEIGKTEHL-----NYYQLPFPWR 226

Query: 61  DNDFILHGYVRETSSFIETFKSLFYL---HNESVNIYSHLVPALGFFTVLLLD--KSTIK 115
           +N +I++ Y R   S  ++  S+F     HNE+ NI++HL+  L    + + D  +S I 
Sbjct: 227 ENRYIIYNY-RFYDSHKKSLLSIFNWYGWHNETSNIWTHLIGGLYLIYMAVYDFPRSEIF 285

Query: 116 VFETTTWKDHVVIDLFYSGAFACLILSSSFHCLKSH-SLRIATLGNKLDYLGICILIVTS 174
           + +       +++ LF   A  CL  S  +H      +L++ +    +DY GI ILI  S
Sbjct: 286 LSDKIPTTAKLIVYLFLFAAIKCLFASVFWHSFNGTCTLKLRSKFACVDYSGISILITAS 345

Query: 175 MVSILFYGYYEKFSLFCLFALITVSFGVACSIVSLKDKFRKREWRPYRAGLFVCFGLSSI 234
           +++  F   Y  +   C++  I++S G+    ++   KF + E RP R   FV   L + 
Sbjct: 346 ILTTEFVTLYSSYRAMCVYMAISLSLGIFGVFMNWSPKFDRPEARPLRIKFFV---LLAS 402

Query: 235 VPIFSGLYCYSFSEIWTQIQLFWVLL-----GGVLYIIGAVLYGMRFPEK 279
           + + S L+  +F   W      W+L        V Y IG V YG   PE+
Sbjct: 403 MGVLSFLHL-TFLTDWKYAT--WLLAPVTNKSIVWYCIGVVFYGSFIPER 449

>YLR023C Chr12 complement(185498..187129) [1632 bp, 543 aa] {ON}
           IZH3Membrane protein involved in zinc ion homeostasis,
           member of the four-protein IZH family, expression
           induced by zinc deficiency; deletion reduces sensitivity
           to elevated zinc and shortens lag phase, overexpression
           reduces Zap1p activity
          Length = 543

 Score = 68.6 bits (166), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 73/319 (22%), Positives = 133/319 (41%), Gaps = 64/319 (20%)

Query: 54  EIPEWQRDNDFILHGYVRETSSFIETFKSLFYL---HNESVNIYSHLVPALGFFTVLLLD 110
           ++P   R+N +I+HGY R  ++  ++  S+F     HNE+ NI+SHL+ A+    + + D
Sbjct: 220 QLPFPWRENRYIIHGY-RFYNTHSKSLLSIFNWYGWHNETSNIWSHLLGAIYIIYLAIYD 278

Query: 111 KSTIKVFETTTWKDHV--VIDLFYSGAFACLILSSSFHCLKSHS-LRIATLGNKLDYLGI 167
               +V+  +        ++ +F + A  C++ S  +H     S L++ +    +DY GI
Sbjct: 279 FPQSEVWRNSQVPPQARWIVFMFLAAALKCMLSSVFWHTFNGTSFLKLRSKFACVDYSGI 338

Query: 168 CILIVTSMVSILFYGYYEKFSLFCLFALITVSFGVACSIVSLKDKFRKREWRPYRAGLFV 227
            ILI  S+++  F   Y  +     +  I+++ GV    ++   +F + E RP R   F+
Sbjct: 339 TILITASILTTEFVTMYSCYWAMYTYMSISLALGVFGVFMNWSPRFDRPEARPLRIRFFI 398

Query: 228 CFGLSSIVPIFSGLYCYSFSEIWTQIQLFWVLL--GGVLYIIGAVLYGMRFPEKV----- 280
              L + + + S L+    +++     LF  +     V Y++G V YG   PE+      
Sbjct: 399 ---LLATMGVLSFLHLIFLTDLHYAATLFSPVTYKSVVWYLVGVVFYGSFIPERFRSDVQ 455

Query: 281 --------------------------------------CPGK---------FDIWGHSHQ 293
                                                 CP            D +G SH 
Sbjct: 456 VDKTIPTNYELSTDLEIITKQREIHFREVPTAHSKCSSCPSHAKSFKSLWWVDYFGCSHT 515

Query: 294 LFHFLVVIASLCHLRGLLN 312
            +HF VV+  + H R +L+
Sbjct: 516 FWHFFVVLGVIGHYRAILD 534

>KNAG0B05100 Chr2 (976101..977717) [1617 bp, 538 aa] {ON} Anc_5.197
           YLR023C
          Length = 538

 Score = 68.6 bits (166), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 63/244 (25%), Positives = 112/244 (45%), Gaps = 18/244 (7%)

Query: 47  KRLYSWDEIPEWQRDNDFILHGYVRETSSFIETFKSL---FYLHNESVNIYSHLVPALGF 103
           ++L  + E+P   R+N +I+H Y R   S +++  S    +  HNE+ NI+SH    LGF
Sbjct: 214 EKLLHYYELPFPWRENRYIIHNY-RFYDSNVKSLLSAINWYGWHNETSNIWSHF---LGF 269

Query: 104 FTVLLL-----DKSTIKVFETTTWKDHVVIDLFYSGAFACLILSSSFHCLKSHS-LRIAT 157
           F V+ L      +S +   +        V+ +F   A  CLI S+ +H     + L++  
Sbjct: 270 FYVVYLAVYEFPQSVVFQSDRIPSSAKFVVYIFLFAAMKCLIASAFWHTFNGTAFLKMRR 329

Query: 158 LGNKLDYLGICILIVTSMVSILFYGYYEKFSLFCLFALITVSFGVACSIVSLKDKFRKRE 217
               +DY GI ILI  S+++  F    +   +  L+  I+++ G+    ++   +F   E
Sbjct: 330 RFACVDYSGISILITASILTAEFVTLNDHRPMMILYMTISLTLGIIGVFLNCSPQFDTPE 389

Query: 218 WRPYRAGLFVCFGLSSIVPIFSGLYCYSFSEIWTQIQLFWVLLGG--VLYIIGAVLYGMR 275
            RP R   F+      ++   +  Y  S++     + L   +     V Y++G V YG  
Sbjct: 390 ARPLRIRFFMLLAAMGVLSFINASYLESWA---YAVDLLSPITNKSIVWYLVGVVFYGSF 446

Query: 276 FPEK 279
            PE+
Sbjct: 447 IPER 450

>AAL153C Chr1 complement(75086..76345) [1260 bp, 419 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR023C
          Length = 419

 Score = 68.2 bits (165), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 80/333 (24%), Positives = 136/333 (40%), Gaps = 72/333 (21%)

Query: 40  AEAKKVLKRLYSWDEIPEWQRDNDFILHG---YVRETSSFIETFKSLFYLHNESVNIYSH 96
           + A+ + + L+ W E+P   R+N +I++G   Y     S +    + +  HNE++NI+SH
Sbjct: 96  SRARGLARHLHYW-ELPYAWRENRYIIYGHRFYHSHRKSLLSVLNA-YGWHNETINIWSH 153

Query: 97  LVPA--LGFFTVLLLDKSTI----KVFETTTWKDHVVIDLFYSGAFACLILSSSFHCLKS 150
           LV A  L +       +S +    +V     W     I  F +    C+  S ++H    
Sbjct: 154 LVGAAVLAYLLCWGWPRSDVYRAAQVPRLAKW----AIGAFLACGVKCMASSVAWHTFNG 209

Query: 151 H-SLRIATLGNKLDYLGICILIVTSM---VSILFYGYYEKFSLFCLFALITVSFGVACSI 206
              L++ +    +DY GI +L+  S+   V++  YG      L   + + ++  G A  +
Sbjct: 210 TCHLKLRSRFVCVDYTGITLLVTASVVTTVAVTLYGLSRP--LMYAYMVASIGLGTAAGV 267

Query: 207 VSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYCYSFSEIWTQIQLFWVLLGG---- 262
           ++    F + E RP R  ++V  GL+++     GL   SF  +W Q++     L      
Sbjct: 268 MNWSPHFDRPEARPLRIAVYV--GLAAL-----GL--VSFVHVWMQVRWASAHLMAPLVY 318

Query: 263 ---VLYIIGAVLYGMRFPEK--------VCPGK--------------------------- 284
              V Y IG V Y    PE+         C G                            
Sbjct: 319 KSLVWYGIGVVFYATLVPERWRSDVTLDCCSGPVHEAACRQFRDLPPVARKDRQFWSLWW 378

Query: 285 FDIWGHSHQLFHFLVVIASLCHLRGLLNSYELV 317
            D + HSH L+H  VV+  + H R +L    +V
Sbjct: 379 VDYFCHSHFLWHVFVVLGVVGHYRAVLQMSRIV 411

>Skud_15.53 Chr15 complement(86339..87277) [939 bp, 312 aa] {ON}
           YOL101C (REAL)
          Length = 312

 Score = 67.4 bits (163), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 73/318 (22%), Positives = 137/318 (43%), Gaps = 32/318 (10%)

Query: 11  MSTLLERTKSVQELKKRAAGKTSANPAEVAEAKKVLKRLYSWDEIPEWQRDNDFILHGYV 70
           ++T+ +     +   ++  G      + V    K +K+ + + ++ +WQ+          
Sbjct: 4   LTTVEQSPAKCKTTTEKGNGTGETTNSNVDAETKEIKKGFPFHDLAKWQQQ--------Y 55

Query: 71  RETSSFIETFKSLFYLHNESVNIYSHLVPALGFFTVLLLDKSTIKVFETTTWKDHVVIDL 130
           R  SS  E+  +L YL   S++ +  L+    F+ + L          TTT  D++V + 
Sbjct: 56  RNKSSRNESLVALIYLLG-SMSSFCLLIFFTDFYLIPLFPT-------TTTMTDYIVFNF 107

Query: 131 FYSGAFACLILSSSFHCLKSHSLRIATLG-NKLDYLGICILIVTSMVSILFYGYYEKFSL 189
           +    F   ++   +H +K+ SL+       K  YL    L+++S ++IL+Y +Y+    
Sbjct: 108 YLLNVFVFCMVHFVYHFIKNISLQQHLEHWQKFSYLSNINLLISSQITILYYLFYDYVFF 167

Query: 190 FCLFALITVSFGVACSIVSLKDKFRKREWRPYRAGLF-----VCFGLSSIVPI--FSGLY 242
           F +F L+    G+      L DK    + R  +   F     VC  L  +  I  F GL 
Sbjct: 168 FKIFTLLMNFIGLVAYFFILTDKLNSSK-RFNKTVFFISVSVVCCSLPLLTAIITFDGL- 225

Query: 243 CYSFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVC--PGKFDIWGHSHQLFHFLVV 300
                 +  +I++  +    V  +  +++Y  RFPE +     K + W HS  LFH ++ 
Sbjct: 226 ----ENLKERIKVKAITCELVALVAASIIYVTRFPESLFRRNKKEESWNHSEYLFHLVIS 281

Query: 301 IASLCHLRGLLNSYELVH 318
             +  H   L+ SY L+H
Sbjct: 282 GTAFYHFFILIQSYILMH 299

>TPHA0E03120 Chr5 complement(654079..655788) [1710 bp, 569 aa] {ON}
           Anc_5.197 YLR023C
          Length = 569

 Score = 68.2 bits (165), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 73/246 (29%), Positives = 112/246 (45%), Gaps = 35/246 (14%)

Query: 54  EIPEWQRDNDFILHGYVRETSSFIETFKSLFY---LHNESVNIYSHLVPALGFFTVLLLD 110
           E+P   R+N +I+HGY R    F +   S+F    +HNE+ NI++H++ A     +L +D
Sbjct: 248 ELPFPWRENKYIIHGY-RFHDKFYQLILSVFNWYGVHNETTNIWTHMLAAFYLIYLLTVD 306

Query: 111 -KSTIKVFETTTWKDHV------VIDLFYSGAFACLILSSSFHCLK-SHSLRIATLGNKL 162
            + T  V +T    +HV      +I +F      C+  S  +H    + S+R+      +
Sbjct: 307 FQKTFIVLDT----EHVPATTKYIIYMFLGAGIKCMFASVFWHTFNGTTSIRLRPKFCCV 362

Query: 163 DYLGICILIVTSMVS---ILFYGYYEKFSLFCLFALITVSFGVACSIVSLKDKFRKREWR 219
           DY GI +LI  S++S   I  Y Y +  S + + + I   FG+    ++   KF   E R
Sbjct: 363 DYTGITLLISASIMSAEYITLYDYPKAMSFYMILSGIFAVFGL---YLNWSPKFDSPEAR 419

Query: 220 PYRAGLFVCF----GLSSIVPIFSGLYCYSFSEIWTQIQLFWVLLGG--VLYIIGAVLYG 273
           P R   FV      GLS     F  L C     +   I LF  +     + YIIG   YG
Sbjct: 420 PLRIKFFVLLAAVGGLS-----FVNLVC--LEGLSRAIWLFSPVTNKSVIYYIIGVFFYG 472

Query: 274 MRFPEK 279
              PE+
Sbjct: 473 SFIPER 478

>Smik_15.56 Chr15 complement(90083..91021) [939 bp, 312 aa] {ON}
           YOL101C (REAL)
          Length = 312

 Score = 64.3 bits (155), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 70/316 (22%), Positives = 138/316 (43%), Gaps = 28/316 (8%)

Query: 11  MSTLLERTKSVQELKKRAAGKTSANPAEVAEAKKVLKRLYSWDEIPEWQRDNDFILHGYV 70
           ++T+ +         ++    T+   + V    K  K+ + + ++ +WQ         Y 
Sbjct: 4   LTTVEQSPAKCNTTPEKCNNSTAEINSTVGAKTKETKKGFPFHDLAKWQEQ-------YK 56

Query: 71  RETSSFIETFKSLFYLHNESVNIYSHLVPALGFFTVLLL--DKSTIKVFETTT-WKDHVV 127
            ++S             NESV    +L+ ++  F +L+   D   I +F TTT   D++V
Sbjct: 57  NKSS------------RNESVVALIYLLGSMLSFCLLIFFTDFYLIPLFPTTTTMTDYIV 104

Query: 128 IDLFYSGAFACLILSSSFHCLKSHSLRIATLG-NKLDYLGICILIVTSMVSILFYGYYEK 186
            + +    F   ++   +H +K+ SL+       K  YL    L+++S ++IL+Y +Y+ 
Sbjct: 105 FNFYLLNVFVFCMVHFIYHFIKNISLQQHLEHWQKFSYLSNINLLISSQITILYYLFYDY 164

Query: 187 FSLFCLFALITVSFGVACSIVSLKDKFRKREWRPYRAGLFVCFG-LSSIVPIFSGLYCYS 245
              F +F L+    G+      L DK    + R  +   F+    +   +P+ + +  + 
Sbjct: 165 VFFFKIFTLLMNFIGLVAYFFILTDKLISSK-RFNKTVFFISVSVICCSLPLLTAIITFD 223

Query: 246 -FSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPG--KFDIWGHSHQLFHFLVVIA 302
               +  +I++  +    V  +  +++Y  RFPE    G  K + W HS  LFH ++  A
Sbjct: 224 GLENLKERIKVNAITWELVALVAASIIYVTRFPELFLRGKKKEEGWNHSEYLFHLIISGA 283

Query: 303 SLCHLRGLLNSYELVH 318
           +  H   L+ SY L+H
Sbjct: 284 AFYHFFILIQSYILMH 299

>ZYRO0B10538g Chr2 complement(830311..831906) [1596 bp, 531 aa] {ON}
           some similarities with uniprot|Q07959 Saccharomyces
           cerevisiae YLR023C IZH3 Membrane protein involved in
           zinc metabolism member of the four-protein IZH family
           expression induced by zinc deficiency deletion reduces
           sensitivity to elevated zinc and shortens lag phase
           overexpression reduces Zap1p activity
          Length = 531

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 62/239 (25%), Positives = 110/239 (46%), Gaps = 22/239 (9%)

Query: 54  EIPEWQRDNDFILHGYVRETSSFIETFKSL---FYLHNESVNIYSHLVPALGFFTVLL-- 108
           ++P   R+N +I+HGY R  +S  ++F S+   +  HNE+ NI++HL+  L    +    
Sbjct: 209 QLPFPYRENKYIIHGY-RFYASHKKSFLSIINWYGWHNETSNIWTHLLGGLYLIYLAFYH 267

Query: 109 LDKSTIKVFETTTWKDHVVIDLFYSGAFACLILSSSFHCLK-SHSLRIATLGNKLDYLGI 167
              S I + +        ++ +F + A  C+  S  +H    +H LR+ +    +DY GI
Sbjct: 268 FPHSNIWLSDRVPKPAKCIVAVFLAAAIKCMFASVFWHTFNGTHLLRLRSKFACVDYTGI 327

Query: 168 CILIVTSMVSILFYGYYE-KFSLFCLFALITVSFGVACSIVSLKDKFRKREWRPYRAGLF 226
            ILI  S++++ F   Y+ K SL   + + +++ G+    ++   KF + E RP R   F
Sbjct: 328 TILITASILTVEFVTMYDYKISLL-FYMICSLALGIIGVSMNWSPKFDRPEARPLRIKFF 386

Query: 227 V------CFGLSSIVPIFSGLYCYSFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEK 279
           +      C     +V + +  Y        T   + W       Y+IG   YG   PE+
Sbjct: 387 ILLATVGCSSFIRLVFLTNWRYAADLLTPLTNKSVVW-------YLIGVFFYGSFIPER 438

>Kpol_2002.94 s2002 (229517..231250) [1734 bp, 577 aa] {ON}
           (229517..231250) [1734 nt, 578 aa]
          Length = 577

 Score = 62.8 bits (151), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 59/237 (24%), Positives = 104/237 (43%), Gaps = 18/237 (7%)

Query: 54  EIPEWQRDNDFILHGY--VRETSSFIETFKSLFYLHNESVNIYSHLVPALGFFTVLLLD- 110
           ++P   R+N +I++GY    + S  + +  + +  HNE+ NI+SHL+ A+ F  ++L + 
Sbjct: 255 QLPFPWRENRYIINGYRFYHKNSKLLLSVFNWYGFHNETANIWSHLLGAIYFAYIVLFEF 314

Query: 111 -KSTIKVFETTTWKDHVVIDLFYSGAFACLILSSSFHCLKSH-SLRIATLGNKLDYLGIC 168
            KS I            ++ LF      C++ S  +H      S+++      +DY GI 
Sbjct: 315 PKSFIVQSPEVPPSAKYIVYLFLLAGIKCMLASVFWHTFNGTCSIKLRPKYCCVDYSGIT 374

Query: 169 ILIVTSMVSILFYGYYEKFSLFCLFALITVSFGVACSIVSLKDKFRKREWRPYRAGLFVC 228
           ILI  S+++  F   Y+  S+  ++  +++ FG     ++   KF   E RP R   F+ 
Sbjct: 375 ILITASILTAEFVSLYDHRSIMTVYMSLSLLFGCFGLYLNWSPKFDSPEARPLRIKFFIL 434

Query: 229 FGLSSIVPIFSGLYCYSFS-EIW-----TQIQLFWVLLGGVLYIIGAVLYGMRFPEK 279
                 +  F   Y    +   W     T   + W       Y+IG   YG   PE+
Sbjct: 435 LAALGGLAFFHVAYLEGMAYAAWLYSPVTSKSIVW-------YLIGVFFYGSFIPER 484

>KLTH0B03498g Chr2 complement(281148..282788) [1641 bp, 546 aa] {ON}
           some similarities with uniprot|Q07959 Saccharomyces
           cerevisiae YLR023C IZH3 Membrane protein involved in
           zinc metabolism member of the four-protein IZH family
           expression induced by zinc deficiency deletion reduces
           sensitivity to elevated zinc and shortens lag phase
           overexpression reduces Zap1p activity
          Length = 546

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 74/278 (26%), Positives = 121/278 (43%), Gaps = 26/278 (9%)

Query: 19  KSVQELKKRAAGKTSANPAEVAEAKKVLKRLYSWDEIPEWQRDNDFILHGYVRETSSFIE 78
           +S+Q   +  A     +  EVA      + L+ + E+P   R+N FI+HGY R  +S+ +
Sbjct: 185 QSIQNDAEAVAASIKFHNYEVALQLGQQRHLHYY-ELPFPWRENRFIIHGY-RFYNSYSK 242

Query: 79  TFKSLFYL---HNESVNIYSHLVPALGFFTVLL---LDKSTIKVFETTTWKDHVVIDLFY 132
           +  S+F     HNE+VNI++HL  AL +F  L+     ++T+   E        +  +F 
Sbjct: 243 SLLSIFNWYGWHNETVNIWTHLCGAL-YFAFLIFKGFSQTTVYQSELVPTAAKFMAFVFL 301

Query: 133 SGAFACLILSSSFHCLKS-HSLRIATLGNKLDYLGICILIVTSMVSILFY---GYYEKFS 188
           +    C + S  +H       L+  +    +DY GI +L+  S+++  F    G  +   
Sbjct: 302 TAGLECFLFSVVWHTFNGICHLKQRSNCACVDYTGITVLVTASILTTEFVTLSGSSDATF 361

Query: 189 LFCL--FALITVSFGVACSIVSLKDKFRKREWRPYRAG---LFVCFGLSSIVPIFSGLYC 243
            + L  F   + + G     ++   KF + E RP R     L   FG       FS L+ 
Sbjct: 362 TWSLLFFTGASAALGAVGVFMNWSPKFDRPESRPLRIAFYLLLASFGF------FSYLHS 415

Query: 244 YSFSEIWTQIQLFWVLLGGVL--YIIGAVLYGMRFPEK 279
             F+       L   +    L  YIIG V YG   PE+
Sbjct: 416 RLFNTAVDSSDLIKPVFMKSLAWYIIGVVFYGTFIPER 453

>Kwal_33.15122 s33 (968885..970585) [1701 bp, 566 aa] {ON} YLR023C -
           Hypothetical ORF [contig 94] FULL
          Length = 566

 Score = 60.1 bits (144), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 73/246 (29%), Positives = 108/246 (43%), Gaps = 31/246 (12%)

Query: 54  EIPEWQRDNDFILHGYVRETSSFIETFKSLFYL---HNESVNIYSHLVPALGFFTVLLLD 110
           E+P   R+N FI+HGY R  +S+ ++  S+F     HNE+VNI++HL  AL    +L   
Sbjct: 239 ELPFPWRENRFIIHGY-RFYNSYKKSLLSIFNWYGWHNETVNIWTHLGGALYLAYLLFRG 297

Query: 111 KSTIKVFET--TTWKDHVVIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNK-----LD 163
            S   V+++         +  +F      C + S  +H        I  L  +     +D
Sbjct: 298 FSQTAVYQSELVPTAAKCMAFVFLLSGLECFLFSVVWHTFNG----ICHLQQRSNCACVD 353

Query: 164 YLGICILIVTSMVSILFY---GYYE-KFSLFCLFALITVS-FGVACSIVSLKDKFRKREW 218
           Y GI IL+  S+++  F    G  E  F+   LF   T S  GV    ++   KF + E 
Sbjct: 354 YTGITILVTASILTTEFVTLSGAAEAPFTWSLLFFTTTSSILGVIGVYMNWSPKFDRPES 413

Query: 219 RPYRAG---LFVCFGLSSIVPIFSGLYCYSFSEIWTQIQLFWVLLGGVL--YIIGAVLYG 273
           RP R     L   FG       FS L+   F    +  +L   +L   L  Y+IG V YG
Sbjct: 414 RPLRIAFYLLLASFGF------FSYLHSRIFHTSISSSELIKPVLSKSLAWYLIGVVFYG 467

Query: 274 MRFPEK 279
              PE+
Sbjct: 468 TFIPER 473

>YOL101C Chr15 complement(126982..127920) [939 bp, 312 aa] {ON}
           IZH4Membrane protein involved in zinc ion homeostasis,
           member of the four-protein IZH family, expression
           induced by fatty acids and altered zinc levels; deletion
           reduces sensitivity to excess zinc; possible role in
           sterol metabolism
          Length = 312

 Score = 59.3 bits (142), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 76/305 (24%), Positives = 132/305 (43%), Gaps = 35/305 (11%)

Query: 25  KKRAAGKTSANPAEVAEAKKVLKRLYSWDEIPEWQRDNDFILHGYVRETSSFIETFKSLF 84
           +K +      +  E AE K+  K+ + + ++ + Q+          +  SS  E+  +L 
Sbjct: 19  EKESNDTRGTDSNENAETKET-KKGFPFHDLAKLQKQ--------YKNKSSRNESLVALI 69

Query: 85  YLHNESVNIYSHLVPALGFFTVLLLDKSTIKVFETTT-WKDHVVIDLFYSGAFACLILSS 143
           YL    ++        L FFT    D   I +F TTT   D++V + +    F   ++  
Sbjct: 70  YLLGSMLSF-----CLLIFFT----DFYLIPLFPTTTTMTDYIVFNFYLLNVFVFCMVHF 120

Query: 144 SFHCLKSHSLRIATLG-NKLDYLGICILIVTSMVSILFYGYYEKFSLFCLFALITVSFGV 202
            +H +K+ SL+       K  YL    L+++S ++IL+Y +Y+    F +F L+    G+
Sbjct: 121 IYHFVKNISLQQHLEHWQKFSYLSNINLLISSQITILYYLFYDYVFFFKIFTLLMNFIGL 180

Query: 203 ACSIVSLKDKFRKREWRPYRAGLF-----VCFGLSSIVPI--FSGLYCYSFSEIWTQIQL 255
                 L DK    + R  +   F     VC  L  +  I  F GL       +  +I++
Sbjct: 181 VAYFFILTDKLISSK-RFNKTVFFISVSVVCCSLPLLTAIITFDGL-----ENLKERIKV 234

Query: 256 FWVLLGGVLYIIGAVLYGMRFPEKVC--PGKFDIWGHSHQLFHFLVVIASLCHLRGLLNS 313
             +    V  +  +++Y  RFPE +     K + W HS  LFH L+   +  H   L+ S
Sbjct: 235 NAITWELVALVAASIIYVTRFPESLFRRNKKEEGWNHSEYLFHLLISGTAFYHFFILIQS 294

Query: 314 YELVH 318
           Y L+H
Sbjct: 295 YILMH 299

>TDEL0E04320 Chr5 complement(804655..806007) [1353 bp, 450 aa] {ON}
           Anc_5.197 YLR023C
          Length = 450

 Score = 59.3 bits (142), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 64/238 (26%), Positives = 106/238 (44%), Gaps = 20/238 (8%)

Query: 54  EIPEWQRDNDFILHGYVRETSSF--IETFKSLFYLHNESVNIYSHLVPALGFFTVLLLDK 111
           ++P   R+N FI+HGY    S +  + +  + +  HNE+ NI++HL  AL    + + D 
Sbjct: 136 QLPFPWRENRFIIHGYRFYDSHYKSLLSIVNWYGWHNETANIWTHLGGALYVLWLAVYDF 195

Query: 112 STIKVFETTTWK--DHVVIDLFYSGAFACLILSSSFHCLKSH-SLRIATLGNKLDYLGIC 168
               V+E+         ++ +F + A  C++ S   H       L + +    +DY GI 
Sbjct: 196 PRTSVWESEQVPMVAKCIVYVFLAAALKCMLASVFGHTFNGTCCLALRSKFACVDYSGIT 255

Query: 169 ILIVTSMVSILFYGYYE-KFSLFCLFALITVSFGVACSIVSLKDKFRKREWRPYRAGLFV 227
           +LI  S+++  F   Y   +SL    A+ TV  G+   I++   KF + E RP R   F+
Sbjct: 256 MLITASILTTEFVTMYNYPWSLRFYLAVSTV-LGIFGVIMNWSPKFDRPEARPLRIKFFI 314

Query: 228 CF----GLSSIVPIFSGLYCYS--FSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEK 279
                 GLS +     G + Y+       T   L W       Y++G   YG   PE+
Sbjct: 315 LLAAMGGLSFMQLGLLGGWKYASWLMAPVTHKSLVW-------YLLGVAFYGSFVPER 365

>SAKL0G12980g Chr7 complement(1108751..1110442) [1692 bp, 563 aa]
           {ON} some similarities with uniprot|Q07959 Saccharomyces
           cerevisiae YLR023C IZH3 Membrane protein involved in
           zinc metabolism member of the four-protein IZH family
           expression induced by zinc deficiency deletion reduces
           sensitivity to elevated zinc and shortens lag phase
           overexpression reduces Zap1p activity
          Length = 563

 Score = 56.2 bits (134), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 65/252 (25%), Positives = 111/252 (44%), Gaps = 18/252 (7%)

Query: 43  KKVLKRLYSWDEIPEWQRDNDFILHGYVRETSSFIETFKSL---FYLHNESVNIYSHLVP 99
           K  L R   + E+P   R+N FI+HGY R   S  ++  S+   +  HNE+ NI++HL  
Sbjct: 225 KTGLSRHLHYYELPFPWRENRFIIHGY-RFYHSHTKSLLSILNWYGWHNETTNIWTHLFG 283

Query: 100 AL--GFFTVLLLDKSTIKVFETTTWKDHVVIDLFYSGAFACLILSSSFHCLKSH-SLRIA 156
           +L   +       +S++ +          ++ LF    F CL+ S ++H       L + 
Sbjct: 284 SLYIAYLAFYEFPQSSVYLSGDVPQFAKYMVYLFLGAGFKCLVSSVTWHTFNGTCKLHLR 343

Query: 157 TLGNKLDYLGICILIVTSMVSILF---YGYYEKFSLFCLFALI---TVSFGVAC--SIVS 208
           +    +DY GI +LI  S+++  F   YG  +  +    F+LI    VS  + C    ++
Sbjct: 344 SKFACMDYTGITVLITASIMTAEFVSLYGNGDNPNSPVTFSLIFYMAVSSVLCCFGVFMN 403

Query: 209 LKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYCYSFSEIWTQIQLFWVLLGGVL-YII 267
              +F + E RP R   ++       +         +F+     I+   VL   V  Y+I
Sbjct: 404 WSPRFDRPESRPLRIAFYLLLAGMGFLAFLHLTLITNFAHSSWLIRP--VLDKSVCWYLI 461

Query: 268 GAVLYGMRFPEK 279
           G + YG   PE+
Sbjct: 462 GVIFYGSFIPER 473

>Ecym_7109 Chr7 complement(210829..212535) [1707 bp, 568 aa] {ON}
           similar to Ashbya gossypii AAL153C
          Length = 568

 Score = 55.5 bits (132), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 61/241 (25%), Positives = 103/241 (42%), Gaps = 25/241 (10%)

Query: 54  EIPEWQRDNDFILHG---YVRETSSFIETFKSLFYLHNESVNIYSHLVPALGFFTVLLLD 110
           E+P+  R+N +I++G   Y     S +    +++  HNE++NI+SH+  A+    ++L  
Sbjct: 244 ELPQPWRENPYIIYGHRFYHSHKKSLLSIL-NVYGWHNETINIWSHIAGAIILLYIMLRG 302

Query: 111 KSTIKVFETTTWKD--HVVIDLFYSGAFACLILSSSFHCLKSH-SLRIATLGNKLDYLGI 167
                VF +T         I +F      C++ S  +H       L + +  + +DY GI
Sbjct: 303 FPNSDVFNSTQVPKVAKGAIYVFLLCGIKCMVSSVMWHTFSGTCHLPLRSRFSCVDYTGI 362

Query: 168 CILIVTS-MVSILFYGYYEKFSLFCLFALITVSFGVACSIVSLKDKFRKREWRPYRAGLF 226
            ILI  S M +  F  Y        L+  I++  GV  +  +   +F   + R +R   +
Sbjct: 363 TILITASVMTTEAFTLYRLAPKAMYLYMGISLCLGVFAAFTNWSRRFDGPDSRIFRVAFY 422

Query: 227 VCFGLSSIVPIFSGLYCYSFSEI-----WTQIQLFWVLLGG---VLYIIGAVLYGMRFPE 278
           V         I +GL   SF  +     W+  +L    L     V Y+IG V Y    PE
Sbjct: 423 V---------ILAGLGLISFVHLTVHSDWSSSRLMITPLINKSIVWYLIGVVFYATLVPE 473

Query: 279 K 279
           +
Sbjct: 474 R 474

>CAGL0D03322g Chr4 complement(340949..342586) [1638 bp, 545 aa] {ON}
           similar to uniprot|Q07959 Saccharomyces cerevisiae
           YLR023c
          Length = 545

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 61/238 (25%), Positives = 104/238 (43%), Gaps = 20/238 (8%)

Query: 54  EIPEWQRDNDFILHGYVRETSSFIETFKSL---FYLHNESVNIYSHLVPALGFFTVLLLD 110
           E+P   R+N  I++GY R  +S  ++  S+   +  HNE+ NI++HL+  L    ++   
Sbjct: 218 ELPFPWRENRCIINGY-RFYNSHKKSLLSIVNWYGWHNETSNIWTHLLGGLYILYLMFYQ 276

Query: 111 KSTIKVF--ETTTWKDHVVIDLFYSGAFACLILSSSFHCLKSHSL-RIATLGNKLDYLGI 167
             + +VF  E       ++  +F   A  CL  S  +H     SL R+      +DY GI
Sbjct: 277 FPSSEVFMSEQVPKAAKLITYVFLIAAAKCLFSSVFWHTFNGTSLLRLRCKFACVDYSGI 336

Query: 168 CILIVTSMVSILFYGYYEKFSLFCLFALITVSFGVACSIVSLKDKFRKREWRPYRAGLFV 227
            ILI  S+++  F   Y+       +  ++ + G+    ++   KF + E RP R   F+
Sbjct: 337 SILITASILTTEFVTMYQCPWAMVSYMALSTALGIFGVFMNWSPKFDRPEARPLRIKFFI 396

Query: 228 CFGLSSIVPIFSGLYCYSFSE-IW-----TQIQLFWVLLGGVLYIIGAVLYGMRFPEK 279
                 I+      +  S S   W     T+  + W       Y++G V YG   PE+
Sbjct: 397 LLASMGILSFLHLTFITSLSHSTWLLSPITKKSVVW-------YLVGVVFYGSFIPER 447

>TBLA0C06050 Chr3 (1468152..1469465) [1314 bp, 437 aa] {ON}
           Anc_5.197 YLR023C
          Length = 437

 Score = 52.0 bits (123), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 67/297 (22%), Positives = 121/297 (40%), Gaps = 39/297 (13%)

Query: 1   MMHVRKESFQMSTLLERTKSVQELKKRAAGKTSANPAEVAEAKKVLKRLYSWDEIPEWQR 60
           ++  +K   Q    +   KS+++       +T+ N           +  + W       R
Sbjct: 72  LLSTKKSEEQDPDFIASGKSIRDYINTFNWQTAYNLGRSNNTLHYYQLPFPW-------R 124

Query: 61  DNDFILHGYVRETSSFIETFKSL---FYLHNESVNIYSHLVPALGFFTVLLLDKSTIKVF 117
           +N +I+ GY R   S ++   S+   +  HNE++NI+SHL   L    + +      +V+
Sbjct: 125 ENRYIIKGY-RFYDSNVKCLLSVVNYYGWHNETLNIWSHLGGFLTLLYIAVFVYPNTEVY 183

Query: 118 ET----TTWKDHVVIDLFYSGAFACLILSSSFHCLK---SHSLRIATLGNKLDYLGICIL 170
           ++    TT K  +++ +F      C++ S  +H      S++LR       +DY GI IL
Sbjct: 184 QSELIPTTAK--MLLFVFLIAGMKCMLASVFWHTFDGTCSYTLRPKFCC--VDYTGITIL 239

Query: 171 IVTSMVSILFYGYYEKFSLFCLFALITVSFGVACSIVSLKDKFRKREWRPYRAGLFVCFG 230
           I  S+++  +           ++  ++++ G     ++   KF   E RP R   FV   
Sbjct: 240 ITASILTAEYVSLSHAPIWMFIYMSLSLALGTFGVYINWSPKFDGPEARPLRIKFFVT-- 297

Query: 231 LSSIVPIFSGLYCYSFSEIWTQIQLF---WVLL-----GGVLYIIGAVLYGMRFPEK 279
                   S + C SF  +     L    W+L        + Y+IG   YG   PEK
Sbjct: 298 -------LSAMGCLSFVHLIFTTSLRHACWLLAPIISKSTIWYVIGVFFYGSFIPEK 347

>KNAG0K00670 Chr11 complement(119419..120384) [966 bp, 321 aa] {ON} 
          Length = 321

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 52/204 (25%), Positives = 95/204 (46%), Gaps = 24/204 (11%)

Query: 119 TTTWKDHVVIDLFYSGAFACLILSSSFHCLKSHSLR--IATLGNKLDYLGICILIVTSMV 176
           +TT  D+V++++F         L+++F C   H ++    T G+ L  + +      S V
Sbjct: 124 STTMTDYVLLNVF---------LATAFQCAACHMVQCFTTTAGSVLSTITMLNHWACSAV 174

Query: 177 SILFYGYYEKFSLFCLFALITVSFGV---ACSIVSLKDKFRKREWRPYRAGLFVCFGLSS 233
           ++L+Y YY+    F L AL T ++ +   A ++ S      KR+W   R  L V   +  
Sbjct: 175 TLLYYSYYDNVFYFKLLALFTANWTLVVAAVTVTSTASNSPKRQWWSRRTLLLVYVVVLV 234

Query: 234 IVPIFSGLYCYSFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQ 293
            VP+  GL  +  +++  ++    +L    +Y+I  V YG    + +    F +  H+  
Sbjct: 235 SVPLVVGLLRFGTAKVLRRLDWRLLLAELAVYLISGVFYGGTEKDTLPKLPFYVAFHT-- 292

Query: 294 LFHFLVVIASLCHLRGLLNSYELV 317
                   ASL HL+ LLN++ L+
Sbjct: 293 --------ASLIHLQLLLNAFHLM 308

>Skud_5.169 Chr5 complement(262759..264360) [1602 bp, 533 aa] {ON}
           YER056C (REAL)
          Length = 533

 Score = 35.0 bits (79), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 43/91 (47%), Gaps = 21/91 (23%)

Query: 168 CILIVTSMVSILFYGY-----YEKFSLFCLFALITVSFGVACSIVSLKDKFRKREW--RP 220
           C++I+   V + F+GY     YEK+S    FA+    F V  + +S   KF+  EW   P
Sbjct: 206 CVIIIGGTVLVTFFGYRVIHTYEKWSWVPNFAV----FLVIIAQLSRSGKFKGGEWIGGP 261

Query: 221 YRAGLFVCFGLSSIVPIFSGLYCYSFSEIWT 251
             AG  + FG SSI         Y F+  WT
Sbjct: 262 TTAGSVLSFG-SSI---------YGFAAGWT 282

>KLTH0D09174g Chr4 (762443..765796) [3354 bp, 1117 aa] {ON} similar
           to uniprot|Q12271 YOR109w Saccharomyces cerevisiae INP53
           Phosphatidylinositol 4,5-bisphosphate 5- phosphatase
          Length = 1117

 Score = 34.7 bits (78), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 26/107 (24%), Positives = 50/107 (46%), Gaps = 11/107 (10%)

Query: 155 IATLGNKLDYLGICILIVTSMVSILFYGYYEKFSLFCLFALITVSFGVACSIVSLKDKFR 214
           + T  N+LD LG  +L     ++ +  G+ E F  +           V+ +++S K  ++
Sbjct: 193 VITFRNRLDDLGRQVLDDEGFLTTVIRGFAETFVTYIK------QLKVSLTVIS-KQSWK 245

Query: 215 KREWRPYRAGLFVCFGLSSIVP----IFSGLYCYSFSEIWTQIQLFW 257
           +   R    G+     +++ V     +FS  YCY+F++I   I +FW
Sbjct: 246 RAGTRYNARGVDDEGNVANFVETELLMFSKEYCYAFTQIRGSIPIFW 292

>NDAI0E04780 Chr5 (1074922..1076529) [1608 bp, 535 aa] {ON} 
          Length = 535

 Score = 33.9 bits (76), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 42/85 (49%), Gaps = 12/85 (14%)

Query: 168 CILIVTSMVSILFYGY-----YEKFSLFCLFALITVSFGVACSIVSLKDKFRKREWR--P 220
           CI+I+ + V + F+GY     YEK+S    FA+    F V  + + +   F+  EW   P
Sbjct: 208 CIIIIGATVLVTFFGYRVIHTYEKWSWVPNFAV----FLVIIARLKMSGNFKGGEWTSGP 263

Query: 221 YRAGLFVCFGLSSIVPIFSGLYCYS 245
             AG  + FG SS+    SG   Y+
Sbjct: 264 TTAGEVLSFG-SSVFGFASGWTTYA 287

>Suva_14.232 Chr14 complement(417816..421373) [3558 bp, 1185 aa]
           {ON} YNL106C (REAL)
          Length = 1185

 Score = 33.9 bits (76), Expect = 0.64,   Method: Composition-based stats.
 Identities = 24/81 (29%), Positives = 38/81 (46%), Gaps = 20/81 (24%)

Query: 195 LITVSFGVACSIVSLKDKFR-------KREWRPYRAGL-----------FVCFGLSSIVP 236
           L TV  G A ++ S  DK R       ++ W+  RAG            +V   + + + 
Sbjct: 238 LTTVIRGFAETVFSYIDKLRVGLTIISRQSWK--RAGTRFNARGIDDEGYVANFVETEMI 295

Query: 237 IFSGLYCYSFSEIWTQIQLFW 257
           +FS  YCY+F++I   I +FW
Sbjct: 296 MFSSQYCYAFTQIRGSIPIFW 316

>KLLA0B02541g Chr2 complement(221104..222636) [1533 bp, 510 aa] {ON}
           similar to uniprot|Q06696 Saccharomyces cerevisiae
           YLR417W VPS36 Component of the ESCRT-II complex which is
           involved in ubiquitin-dependent sorting of proteins into
           the endosome
          Length = 510

 Score = 33.5 bits (75), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 48/106 (45%), Gaps = 13/106 (12%)

Query: 66  LHGYV----RETSSFIETFKSLFYLHNESVNIYSHLVPALGFFTVLLLDKSTIKVFETTT 121
           L+G+V    R  S  I T   LF L+N+SV I + L+            +   + FE   
Sbjct: 365 LYGFVDSELRGDSGIIVTLVDLFALYNKSVRIGTGLISPEEM-------REACEKFEKLG 417

Query: 122 WKDHVVIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGI 167
             D  +I +  +G   CL    SF  +++  L++AT+   +D L I
Sbjct: 418 LNDLKLIKI--NGRVLCLAFQDSFDHIRTKVLQLATMRPGVDILQI 461

>KAFR0L00890 Chr12 (165185..166768) [1584 bp, 527 aa] {ON}  YER060W
          Length = 527

 Score = 32.0 bits (71), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 38/79 (48%), Gaps = 11/79 (13%)

Query: 159 GNKLDYLGICILIVTSMVSILFYGY-----YEKFSLFCLFALITVSFGVACSIVSLKDKF 213
           G+ L   G C++I+ + V + F+GY     YEK+S    FA+    F V  + +    KF
Sbjct: 190 GDNLPLWGGCLIIIGATVIVTFFGYSVIHTYEKYSWIPNFAV----FLVIIARLHTSGKF 245

Query: 214 RKREWRPYR--AGLFVCFG 230
              EW   +  AG  + FG
Sbjct: 246 TAGEWTTGQTTAGDVLSFG 264

>Suva_5.169 Chr5 (251694..253274) [1581 bp, 526 aa] {ON} YER060W-A
           (REAL)
          Length = 526

 Score = 32.0 bits (71), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 47/110 (42%), Gaps = 21/110 (19%)

Query: 149 KSHSLRIATLGNKLDYLGICILIVTSMVSILFYGY-----YEKFSLFCLFALITVSFGVA 203
            S  L +   G++      CI+I+ + V + F+GY     YEK++    FA+    F V 
Sbjct: 180 SSQVLNMVNPGHQCPLWAGCIVIIGATVIVTFFGYNVIHSYEKWAWVPNFAV----FLVI 235

Query: 204 CSIVSLKDKFRKREWR--PYRAGLFVCFGLSSIVPIFSGLYCYSFSEIWT 251
            + ++   KF   EW   P  AG  + FG +           Y F+  WT
Sbjct: 236 IARLARSGKFVLGEWTSGPTTAGNVLSFGST----------VYGFAAGWT 275

>YER060W Chr5 (274567..276153) [1587 bp, 528 aa] {ON}  FCY21Putative
           purine-cytosine permease, very similar to Fcy2p but
           cannot substitute for its function
          Length = 528

 Score = 31.6 bits (70), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 47/110 (42%), Gaps = 21/110 (19%)

Query: 149 KSHSLRIATLGNKLDYLGICILIVTSMVSILFYGY-----YEKFSLFCLFALITVSFGVA 203
            S  L +   G++      CI+I+ + V + F+GY     YEK++    FA+    F V 
Sbjct: 182 SSQVLNMVNPGHQCPLWAGCIVIIGATVIVTFFGYGVIHAYEKWAWVPNFAV----FLVI 237

Query: 204 CSIVSLKDKFRKREWR--PYRAGLFVCFGLSSIVPIFSGLYCYSFSEIWT 251
            + ++   KF   EW   P  AG  + FG +           Y F+  WT
Sbjct: 238 IARLARSKKFVLGEWTSGPTTAGNVLSFGST----------VYGFAAGWT 277

>CAGL0J02948g Chr10 (285162..286709) [1548 bp, 515 aa] {ON} highly
           similar to uniprot|P40039 Saccharomyces cerevisiae
           YER060w or uniprot|P17064 Saccharomyces cerevisiae
           YER056c FCY2
          Length = 515

 Score = 31.2 bits (69), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 44/92 (47%), Gaps = 12/92 (13%)

Query: 161 KLDYLGICILIVTSMVSILFYGY-----YEKFSLFCLFALITVSFGVACSIVSLKDKFRK 215
           +L   G C++I+ + + + F+GY     YEK+S    FA+    F V  + + +  KF  
Sbjct: 180 QLPLWGGCLVIIGATILVSFFGYKVIHTYEKYSWVPNFAV----FLVLIARLKISGKFHN 235

Query: 216 REW--RPYRAGLFVCFGLSSIVPIFSGLYCYS 245
             W   P  AG  + FG S++    SG   Y+
Sbjct: 236 GAWGSGPTTAGSVLSFG-SAVFGFASGWTTYA 266

>Smik_5.185 Chr5 complement(270718..272211) [1494 bp, 497 aa] {ON}
           YER060W (REAL)
          Length = 497

 Score = 31.2 bits (69), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 41/85 (48%), Gaps = 12/85 (14%)

Query: 168 CILIVTSMVSILFYGY-----YEKFSLFCLFALITVSFGVACSIVSLKDKFRKREW--RP 220
           C++IV   V + F+GY     YEK+S    FA+    F V  + +S   KF+  EW    
Sbjct: 206 CLIIVGGTVLVTFFGYGVIHAYEKWSWVPNFAV----FLVIIAQLSRSGKFKGGEWVGGS 261

Query: 221 YRAGLFVCFGLSSIVPIFSGLYCYS 245
             AG  + FG SSI    +G   Y+
Sbjct: 262 TTAGGVLSFG-SSIFGFAAGWTTYA 285

>NDAI0A02570 Chr1 (573728..575047) [1320 bp, 439 aa] {ON} 
          Length = 439

 Score = 30.8 bits (68), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 38/89 (42%), Gaps = 11/89 (12%)

Query: 149 KSHSLRIATLGNKLDYLGICILIVTSMVSILFYGY-----YEKFSLFCLFALITVSFGVA 203
            +  L +   GN       C++IV   V + F+GY     YEK+S    FA+    F V 
Sbjct: 93  SAQLLNMVNQGNSCPLWAGCLVIVGCTVLVTFFGYNIIHAYEKWSWIPNFAV----FLVI 148

Query: 204 CSIVSLKDKFRKREWR--PYRAGLFVCFG 230
            + + +   F   EW   P  AG  + FG
Sbjct: 149 IARLKMSGNFSGGEWTSGPTTAGGVLSFG 177

>Smik_5.184 Chr5 complement(270545..270777,270843..272211) [1602 bp,
           533 aa] {ON} YER056C (REAL)
          Length = 533

 Score = 30.8 bits (68), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 41/85 (48%), Gaps = 12/85 (14%)

Query: 168 CILIVTSMVSILFYGY-----YEKFSLFCLFALITVSFGVACSIVSLKDKFRKREW--RP 220
           C++IV   V + F+GY     YEK+S    FA+    F V  + +S   KF+  EW    
Sbjct: 206 CLIIVGGTVLVTFFGYGVIHAYEKWSWVPNFAV----FLVIIAQLSRSGKFKGGEWVGGS 261

Query: 221 YRAGLFVCFGLSSIVPIFSGLYCYS 245
             AG  + FG SSI    +G   Y+
Sbjct: 262 TTAGGVLSFG-SSIFGFAAGWTTYA 285

>Kpol_1066.48 s1066 (91933..92886,92889..93536) [1602 bp, 533 aa]
           {ON} (91933..92886,92889..93536) [1602 nt, 534 aa]
          Length = 533

 Score = 30.8 bits (68), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 42/100 (42%), Gaps = 21/100 (21%)

Query: 159 GNKLDYLGICILIVTSMVSILFYGY-----YEKFSLFCLFALITVSFGVACSIVSLKDKF 213
           G+ L     C++I+   V + F+GY     YEK+S    FA+    F V  + ++  D F
Sbjct: 197 GHNLPLWAGCLVIIIITVMVTFFGYSVIHTYEKYSWIPNFAI----FLVIIARLAKSDHF 252

Query: 214 RKREW--RPYRAGLFVCFGLSSIVPIFSGLYCYSFSEIWT 251
              EW      AG  + FG +           Y F+  WT
Sbjct: 253 SNGEWGSGATTAGSILSFGTT----------VYGFAAGWT 282

>Smik_5.190 Chr5 (278724..280310) [1587 bp, 528 aa] {ON} YER056C
           (REAL)
          Length = 528

 Score = 30.4 bits (67), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 49/110 (44%), Gaps = 21/110 (19%)

Query: 149 KSHSLRIATLGNKLDYLGICILIVTSMVSILFYGY-----YEKFSLFCLFALITVSFGVA 203
            S  L +   G++      C++I+ + V + F+GY     YEK++    FA+    F V 
Sbjct: 182 SSQVLNMVNPGHQCPLWAGCLVIIGATVIVTFFGYGVIHSYEKWAWVPNFAV----FLVI 237

Query: 204 CSIVSLKDKFRKREWR--PYRAGLFVCFGLSSIVPIFSGLYCYSFSEIWT 251
            + ++   KF   EW   P  AG  + FG S+I         Y F+  WT
Sbjct: 238 IARLAKSKKFVLGEWTSGPTTAGNVLSFG-STI---------YGFAAGWT 277

>KNAG0L01490 Chr12 (264062..265666) [1605 bp, 534 aa] {ON} 
          Length = 534

 Score = 30.0 bits (66), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 43/94 (45%), Gaps = 12/94 (12%)

Query: 159 GNKLDYLGICILIVTSMVSILFYGY-----YEKFSLFCLFALITVSFGVACSIVSLKDKF 213
           GNK      CI+I+ + + + F+GY     YEK+S    FA+    F V  + + +  KF
Sbjct: 198 GNKCPLWAGCIVIIGATLLVTFFGYRIIHTYEKYSWIPNFAV----FLVIIARLKISGKF 253

Query: 214 RKREW--RPYRAGLFVCFGLSSIVPIFSGLYCYS 245
               W      AG  + FG SS+    +G   Y+
Sbjct: 254 SDGGWGSGATTAGSVLSFG-SSVFGFAAGWTTYA 286

>NCAS0E03160 Chr5 complement(625452..627053) [1602 bp, 533 aa] {ON} 
          Length = 533

 Score = 30.0 bits (66), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 27/108 (25%), Positives = 51/108 (47%), Gaps = 16/108 (14%)

Query: 168 CILIVTSMVSILFYGY-----YEKFSLFCLFALITVSFGVACSIVSLKDKFRKREWR--P 220
           C++I+ + + + F+GY     YE++S    FA+    F V  + + +   F   EW   P
Sbjct: 206 CVIIIGATILVTFFGYSYIHAYERWSWVPNFAV----FLVIIARLHMSGNFSGGEWTSGP 261

Query: 221 YRAG---LFVC--FGLSSIVPIFSGLYCYSFSEIWTQIQLFWVLLGGV 263
             AG    F C  FG ++   +++  Y         + ++F+ L+GG+
Sbjct: 262 TTAGNVLSFGCAIFGFATGWTVYAADYTVYMPRDTNKFKIFFSLVGGL 309

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.328    0.141    0.443 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 33,460,724
Number of extensions: 1413672
Number of successful extensions: 5514
Number of sequences better than 10.0: 103
Number of HSP's gapped: 5572
Number of HSP's successfully gapped: 103
Length of query: 327
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 217
Effective length of database: 40,868,139
Effective search space: 8868386163
Effective search space used: 8868386163
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 66 (30.0 bits)