Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_15.1676.28ON37837819440.0
Suva_15.1726.28ON39837816040.0
Skud_15.1596.28ON37937915910.0
YOL003C (PFA4)6.28ON37837815830.0
Kpol_1037.236.28ON37837911351e-154
TDEL0G044106.28ON38137811291e-153
TPHA0J003906.28ON38037911281e-153
ZYRO0C07546g6.28ON37737811231e-153
SAKL0E01518g6.28ON37938011031e-149
CAGL0E02497g6.28ON37637810951e-148
NCAS0D021406.28ON37637910701e-145
NDAI0C026506.28ON38938910701e-144
Ecym_30326.28ON37737810511e-142
KLTH0C10978g6.28ON3773799901e-132
KLLA0C06204g6.28ON3773799401e-125
Kwal_56.224596.28ON3833799401e-125
KAFR0A051306.28ON3963979371e-124
ACL003C6.28ON3753789241e-122
KNAG0F029306.28ON3863879171e-121
TBLA0B004806.28ON3774114511e-51
TPHA0P015603.12ON331531974e-16
CAGL0D02508g3.12ON3321281965e-16
KLTH0F19580g3.12ON3421631966e-16
NDAI0G013403.12ON335541931e-15
KAFR0A085903.12ON331501921e-15
NCAS0E013003.12ON327521912e-15
Kpol_1014.293.12ON3261141912e-15
TDEL0A003103.12ON329551894e-15
TBLA0H001503.12ON3451401885e-15
SAKL0C13596g3.12ON333501885e-15
Kwal_55.221263.12ON360601861e-14
NCAS0B035908.286ON329481851e-14
SAKL0H16434g8.286ON555921871e-14
KLLA0E02069g3.12ON325541842e-14
KNAG0K025703.12ON328501832e-14
ZYRO0C03410g3.12ON3271201823e-14
ZYRO0D06600g8.286ON330531823e-14
Ecym_20143.12ON339761814e-14
KAFR0B053708.286ON329531805e-14
NCAS0C029208.389ON374721781e-13
KLLA0D18370g8.389ON355901762e-13
KNAG0A027108.389ON354731752e-13
Smik_12.3068.389ON359621753e-13
CAGL0B01991g8.286ON330481743e-13
Skud_14.153.12ON3361101743e-13
Skud_4.3878.286ON336691744e-13
YNL326C (PFA3)3.12ON3361131734e-13
ADL197C3.12ON3901201744e-13
TPHA0C010708.286ON333611726e-13
TBLA0D040408.286ON329491726e-13
Suva_2.2898.286ON335591726e-13
Smik_14.63.12ON334501718e-13
Suva_14.153.12ON330501718e-13
YLR246W (ERF2)8.389ON359611711e-12
Ecym_41788.389ON368721711e-12
NDAI0J010008.286ON339641691e-12
TDEL0F041308.286ON328611682e-12
Skud_12.3218.389ON356611664e-12
SAKL0H13860g8.389ON352941655e-12
YDR126W (SWF1)8.286ON336481655e-12
Suva_10.3428.389ON356611655e-12
KLTH0F08668g8.389ON358971648e-12
TDEL0F051308.389ON359731639e-12
Kpol_1033.168.286ON321481621e-11
Smik_4.3728.286ON335481621e-11
KLLA0F19690g8.286ON3241081621e-11
TPHA0C023608.389ON404731631e-11
ZYRO0C04092g8.389ON366791622e-11
NDAI0G022508.389ON389781603e-11
TBLA0H009208.389ON360901575e-11
Ecym_42828.286ON340491566e-11
AGL125C8.389ON367791568e-11
Kwal_23.33028.389ON353641568e-11
TBLA0E028305.579ON3861051551e-10
CAGL0G08217g8.389ON326601531e-10
KLTH0G13112g8.286ON3491341522e-10
KAFR0H019808.389ON361541514e-10
AGR065W8.286ON326441461e-09
Kwal_56.236978.286ON338481442e-09
KAFR0I011105.579ON370971433e-09
Ecym_41145.579ON372801417e-09
KNAG0H031108.286ON331931407e-09
Skud_4.7345.579ON380961391e-08
KLTH0G04972g5.579ON367701363e-08
KNAG0C028305.579ON354741354e-08
Kwal_47.183665.579ON356701344e-08
NDAI0H018905.579ON406661354e-08
NCAS0F013905.579ON374661345e-08
TDEL0A044405.579ON365801337e-08
ZYRO0D13860g5.579ON3651501329e-08
SAKL0G06160g5.579ON364801311e-07
YDR459C (PFA5)5.579ON374841301e-07
CAGL0K06347g5.579ON352721292e-07
Smik_4.7375.579ON378621273e-07
Kpol_1004.575.579ON362991221e-06
Suva_2.6345.579ON388611221e-06
KLLA0D06149g5.579ON349621175e-06
KAFR0H005705.626ON757711133e-05
ABR203W5.579ON359741113e-05
NDAI0H008505.626ON7861061071e-04
TPHA0C003705.626ON759511071e-04
ZYRO0C11132g5.626ON7591541053e-04
KLTH0E02420g5.626ON734661053e-04
Kpol_526.325.626ON777551043e-04
TBLA0J008305.626ON7391141043e-04
Skud_4.5275.626ON764611043e-04
Suva_2.4325.626ON763501034e-04
Smik_4.5155.626ON764501026e-04
Ecym_13305.626ON739731018e-04
YDR264C (AKR1)5.626ON76461990.001
NCAS0C052805.626ON75759990.001
Suva_8.875.626ON73092970.002
YOR034C (AKR2)5.626ON74949940.006
CAGL0M08712g5.626ON76353930.007
TDEL0A049205.626ON75066930.007
KNAG0C062305.626ON75253920.008
Smik_15.2135.626ON74453900.015
AER388C5.626ON72449870.039
KNAG0B031405.626ON68252830.100
SAKL0G07326g5.626ON73751830.10
Skud_15.1995.626ON74149810.17
KLLA0E16721g5.626ON75259750.91
Suva_2.7031.24ON485107712.7
KLTH0B09724g5.10ON148621713.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_15.167
         (378 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_15.167 Chr15 complement(289180..290316) [1137 bp, 378 aa] {...   753   0.0  
Suva_15.172 Chr15 complement(296325..297521) [1197 bp, 398 aa] {...   622   0.0  
Skud_15.159 Chr15 complement(281485..282624) [1140 bp, 379 aa] {...   617   0.0  
YOL003C Chr15 complement(321858..322994) [1137 bp, 378 aa] {ON} ...   614   0.0  
Kpol_1037.23 s1037 complement(51397..52533) [1137 bp, 378 aa] {O...   441   e-154
TDEL0G04410 Chr7 complement(800085..801230) [1146 bp, 381 aa] {O...   439   e-153
TPHA0J00390 Chr10 (88587..89729) [1143 bp, 380 aa] {ON} Anc_6.28...   439   e-153
ZYRO0C07546g Chr3 complement(574411..575544) [1134 bp, 377 aa] {...   437   e-153
SAKL0E01518g Chr5 (113669..114808) [1140 bp, 379 aa] {ON} simila...   429   e-149
CAGL0E02497g Chr5 complement(241355..242485) [1131 bp, 376 aa] {...   426   e-148
NCAS0D02140 Chr4 complement(398924..400054) [1131 bp, 376 aa] {O...   416   e-145
NDAI0C02650 Chr3 (614101..615270) [1170 bp, 389 aa] {ON} Anc_6.28     416   e-144
Ecym_3032 Chr3 (63354..64487) [1134 bp, 377 aa] {ON} similar to ...   409   e-142
KLTH0C10978g Chr3 complement(905760..906893) [1134 bp, 377 aa] {...   385   e-132
KLLA0C06204g Chr3 complement(548912..550045) [1134 bp, 377 aa] {...   366   e-125
Kwal_56.22459 s56 (138563..139714) [1152 bp, 383 aa] {ON} YOL003...   366   e-125
KAFR0A05130 Chr1 complement(1019919..1021109) [1191 bp, 396 aa] ...   365   e-124
ACL003C Chr3 complement(352024..353151) [1128 bp, 375 aa] {ON} S...   360   e-122
KNAG0F02930 Chr6 complement(557052..558212) [1161 bp, 386 aa] {O...   357   e-121
TBLA0B00480 Chr2 (93291..94424) [1134 bp, 377 aa] {ON} Anc_6.28 ...   178   1e-51
TPHA0P01560 Chr16 (318550..319545) [996 bp, 331 aa] {ON} Anc_3.1...    80   4e-16
CAGL0D02508g Chr4 (256760..257758) [999 bp, 332 aa] {ON} similar...    80   5e-16
KLTH0F19580g Chr6 (1586776..1587804) [1029 bp, 342 aa] {ON} simi...    80   6e-16
NDAI0G01340 Chr7 (301254..302261) [1008 bp, 335 aa] {ON} Anc_3.12      79   1e-15
KAFR0A08590 Chr1 (1722408..1723403) [996 bp, 331 aa] {ON} Anc_3....    79   1e-15
NCAS0E01300 Chr5 complement(250120..251103) [984 bp, 327 aa] {ON...    78   2e-15
Kpol_1014.29 s1014 (48992..49972) [981 bp, 326 aa] {ON} (48992.....    78   2e-15
TDEL0A00310 Chr1 complement(54006..54995) [990 bp, 329 aa] {ON} ...    77   4e-15
TBLA0H00150 Chr8 complement(13169..14206) [1038 bp, 345 aa] {ON}...    77   5e-15
SAKL0C13596g Chr3 (1198957..1199958) [1002 bp, 333 aa] {ON} simi...    77   5e-15
Kwal_55.22126 s55 (1121936..1123018) [1083 bp, 360 aa] {ON} YNL3...    76   1e-14
NCAS0B03590 Chr2 complement(636400..637389) [990 bp, 329 aa] {ON}      76   1e-14
SAKL0H16434g Chr8 complement(1447419..1449086) [1668 bp, 555 aa]...    77   1e-14
KLLA0E02069g Chr5 complement(195185..196162) [978 bp, 325 aa] {O...    75   2e-14
KNAG0K02570 Chr11 (511867..512853) [987 bp, 328 aa] {ON} Anc_3.1...    75   2e-14
ZYRO0C03410g Chr3 (265684..266667) [984 bp, 327 aa] {ON} similar...    75   3e-14
ZYRO0D06600g Chr4 complement(573724..574716) [993 bp, 330 aa] {O...    75   3e-14
Ecym_2014 Chr2 complement(19723..20742) [1020 bp, 339 aa] {ON} s...    74   4e-14
KAFR0B05370 Chr2 complement(1105534..1106523) [990 bp, 329 aa] {...    74   5e-14
NCAS0C02920 Chr3 (549815..550939) [1125 bp, 374 aa] {ON} Anc_8.389     73   1e-13
KLLA0D18370g Chr4 complement(1549382..1550449) [1068 bp, 355 aa]...    72   2e-13
KNAG0A02710 Chr1 (294783..295847) [1065 bp, 354 aa] {ON} Anc_8.3...    72   2e-13
Smik_12.306 Chr12 (568353..569432) [1080 bp, 359 aa] {ON} YLR246...    72   3e-13
CAGL0B01991g Chr2 (182894..183886) [993 bp, 330 aa] {ON} similar...    72   3e-13
Skud_14.15 Chr14 complement(20841..21851) [1011 bp, 336 aa] {ON}...    72   3e-13
Skud_4.387 Chr4 (675002..676012) [1011 bp, 336 aa] {ON} YDR126W ...    72   4e-13
YNL326C Chr14 complement(27337..28347) [1011 bp, 336 aa] {ON}  P...    71   4e-13
ADL197C Chr4 complement(350991..352163) [1173 bp, 390 aa] {ON} S...    72   4e-13
TPHA0C01070 Chr3 complement(244556..245557) [1002 bp, 333 aa] {O...    71   6e-13
TBLA0D04040 Chr4 complement(1006179..1007168) [990 bp, 329 aa] {...    71   6e-13
Suva_2.289 Chr2 (498420..499427) [1008 bp, 335 aa] {ON} YDR126W ...    71   6e-13
Smik_14.6 Chr14 complement(11864..12868) [1005 bp, 334 aa] {ON} ...    70   8e-13
Suva_14.15 Chr14 complement(23560..24552) [993 bp, 330 aa] {ON} ...    70   8e-13
YLR246W Chr12 (627118..628197) [1080 bp, 359 aa] {ON}  ERF2Subun...    70   1e-12
Ecym_4178 Chr4 (375346..376452) [1107 bp, 368 aa] {ON} similar t...    70   1e-12
NDAI0J01000 Chr10 (229188..230207) [1020 bp, 339 aa] {ON} Anc_8....    70   1e-12
TDEL0F04130 Chr6 (759451..760437) [987 bp, 328 aa] {ON} Anc_8.28...    69   2e-12
Skud_12.321 Chr12 (571368..572438) [1071 bp, 356 aa] {ON} YLR246...    69   4e-12
SAKL0H13860g Chr8 (1185970..1187028) [1059 bp, 352 aa] {ON} simi...    68   5e-12
YDR126W Chr4 (703234..704244) [1011 bp, 336 aa] {ON}  SWF1Palmit...    68   5e-12
Suva_10.342 Chr10 (593959..595029) [1071 bp, 356 aa] {ON} YLR246...    68   5e-12
KLTH0F08668g Chr6 (750644..751720) [1077 bp, 358 aa] {ON} simila...    68   8e-12
TDEL0F05130 Chr6 complement(961887..962966) [1080 bp, 359 aa] {O...    67   9e-12
Kpol_1033.16 s1033 (35544..36509) [966 bp, 321 aa] {ON} (35544.....    67   1e-11
Smik_4.372 Chr4 (664437..665444) [1008 bp, 335 aa] {ON} YDR126W ...    67   1e-11
KLLA0F19690g Chr6 (1820355..1821329) [975 bp, 324 aa] {ON} simil...    67   1e-11
TPHA0C02360 Chr3 (531446..532660) [1215 bp, 404 aa] {ON} Anc_8.3...    67   1e-11
ZYRO0C04092g Chr3 complement(320634..321734) [1101 bp, 366 aa] {...    67   2e-11
NDAI0G02250 Chr7 (503564..504733) [1170 bp, 389 aa] {ON} Anc_8.389     66   3e-11
TBLA0H00920 Chr8 (203681..204763) [1083 bp, 360 aa] {ON} Anc_8.3...    65   5e-11
Ecym_4282 Chr4 complement(608898..609920) [1023 bp, 340 aa] {ON}...    65   6e-11
AGL125C Chr7 complement(473496..474599) [1104 bp, 367 aa] {ON} S...    65   8e-11
Kwal_23.3302 s23 (234749..235810) [1062 bp, 353 aa] {ON} YLR246W...    65   8e-11
TBLA0E02830 Chr5 (700364..701524) [1161 bp, 386 aa] {ON} Anc_5.5...    64   1e-10
CAGL0G08217g Chr7 complement(778823..779803) [981 bp, 326 aa] {O...    64   1e-10
KLTH0G13112g Chr7 complement(1129318..1130367) [1050 bp, 349 aa]...    63   2e-10
KAFR0H01980 Chr8 (367846..368931) [1086 bp, 361 aa] {ON} Anc_8.3...    63   4e-10
AGR065W Chr7 (835871..836851) [981 bp, 326 aa] {ON} Syntenic hom...    61   1e-09
Kwal_56.23697 s56 complement(665965..666981) [1017 bp, 338 aa] {...    60   2e-09
KAFR0I01110 Chr9 (214426..215538) [1113 bp, 370 aa] {ON} Anc_5.5...    60   3e-09
Ecym_4114 Chr4 complement(238112..239230) [1119 bp, 372 aa] {ON}...    59   7e-09
KNAG0H03110 Chr8 complement(584877..585872) [996 bp, 331 aa] {ON...    59   7e-09
Skud_4.734 Chr4 complement(1302386..1303528) [1143 bp, 380 aa] {...    58   1e-08
KLTH0G04972g Chr7 complement(404787..405890) [1104 bp, 367 aa] {...    57   3e-08
KNAG0C02830 Chr3 complement(563740..564804) [1065 bp, 354 aa] {O...    57   4e-08
Kwal_47.18366 s47 (796220..797290) [1071 bp, 356 aa] {ON} YDR459...    56   4e-08
NDAI0H01890 Chr8 complement(458111..459331) [1221 bp, 406 aa] {O...    57   4e-08
NCAS0F01390 Chr6 complement(275879..277003) [1125 bp, 374 aa] {O...    56   5e-08
TDEL0A04440 Chr1 complement(795121..796218) [1098 bp, 365 aa] {O...    56   7e-08
ZYRO0D13860g Chr4 complement(1171732..1172829) [1098 bp, 365 aa]...    55   9e-08
SAKL0G06160g Chr7 complement(514850..515944) [1095 bp, 364 aa] {...    55   1e-07
YDR459C Chr4 complement(1382319..1383443) [1125 bp, 374 aa] {ON}...    55   1e-07
CAGL0K06347g Chr11 complement(624046..625104) [1059 bp, 352 aa] ...    54   2e-07
Smik_4.737 Chr4 complement(1303557..1304693) [1137 bp, 378 aa] {...    54   3e-07
Kpol_1004.57 s1004 complement(123368..124456) [1089 bp, 362 aa] ...    52   1e-06
Suva_2.634 Chr2 complement(1134492..1135658) [1167 bp, 388 aa] {...    52   1e-06
KLLA0D06149g Chr4 (527705..528754) [1050 bp, 349 aa] {ON} simila...    50   5e-06
KAFR0H00570 Chr8 (100639..102912) [2274 bp, 757 aa] {ON} Anc_5.6...    48   3e-05
ABR203W Chr2 (782704..783783) [1080 bp, 359 aa] {ON} Syntenic ho...    47   3e-05
NDAI0H00850 Chr8 (190934..193294) [2361 bp, 786 aa] {ON} Anc_5.6...    46   1e-04
TPHA0C00370 Chr3 (62796..65075) [2280 bp, 759 aa] {ON} Anc_5.626...    46   1e-04
ZYRO0C11132g Chr3 complement(861388..863667) [2280 bp, 759 aa] {...    45   3e-04
KLTH0E02420g Chr5 complement(211548..213752) [2205 bp, 734 aa] {...    45   3e-04
Kpol_526.32 s526 complement(77926..80259) [2334 bp, 777 aa] {ON}...    45   3e-04
TBLA0J00830 Chr10 complement(187815..190034) [2220 bp, 739 aa] {...    45   3e-04
Skud_4.527 Chr4 complement(938779..941073) [2295 bp, 764 aa] {ON...    45   3e-04
Suva_2.432 Chr2 complement(762658..764949) [2292 bp, 763 aa] {ON...    44   4e-04
Smik_4.515 Chr4 complement(928882..931176) [2295 bp, 764 aa] {ON...    44   6e-04
Ecym_1330 Chr1 (684758..686977) [2220 bp, 739 aa] {ON} similar t...    44   8e-04
YDR264C Chr4 complement(996029..998323) [2295 bp, 764 aa] {ON}  ...    43   0.001
NCAS0C05280 Chr3 complement(1073710..1075983) [2274 bp, 757 aa] ...    43   0.001
Suva_8.87 Chr8 complement(157531..159723) [2193 bp, 730 aa] {ON}...    42   0.002
YOR034C Chr15 complement(394837..397086) [2250 bp, 749 aa] {ON} ...    41   0.006
CAGL0M08712g Chr13 (866454..868745) [2292 bp, 763 aa] {ON} simil...    40   0.007
TDEL0A04920 Chr1 complement(867970..870222) [2253 bp, 750 aa] {O...    40   0.007
KNAG0C06230 Chr3 complement(1208896..1211154) [2259 bp, 752 aa] ...    40   0.008
Smik_15.213 Chr15 complement(360836..363070) [2235 bp, 744 aa] {...    39   0.015
AER388C Chr5 complement(1365604..1367778) [2175 bp, 724 aa] {ON}...    38   0.039
KNAG0B03140 Chr2 (604028..606076) [2049 bp, 682 aa] {ON} Anc_5.6...    37   0.100
SAKL0G07326g Chr7 complement(599477..601690) [2214 bp, 737 aa] {...    37   0.10 
Skud_15.199 Chr15 complement(354702..356927) [2226 bp, 741 aa] {...    36   0.17 
KLLA0E16721g Chr5 (1484752..1487010) [2259 bp, 752 aa] {ON} simi...    33   0.91 
Suva_2.703 Chr2 complement(1238496..1239953) [1458 bp, 485 aa] {...    32   2.7  
KLTH0B09724g Chr2 complement(796023..800483) [4461 bp, 1486 aa] ...    32   3.0  

>Smik_15.167 Chr15 complement(289180..290316) [1137 bp, 378 aa] {ON}
           YOL003C (REAL)
          Length = 378

 Score =  753 bits (1944), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/378 (96%), Positives = 364/378 (96%)

Query: 1   MAVKLRWPWLGIAIPTLLISFIGYGAHYFILSNFLPIAKQIGFEFSLSMIWFSYYLAIYT 60
           MAVKLRWPWLGIAIPTLLISFIGYGAHYFILSNFLPIAKQIGFEFSLSMIWFSYYLAIYT
Sbjct: 1   MAVKLRWPWLGIAIPTLLISFIGYGAHYFILSNFLPIAKQIGFEFSLSMIWFSYYLAIYT 60

Query: 61  NPGRPLPNYQPTPGIWPNFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNY 120
           NPGRPLPNYQPTPGIWPNFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNY
Sbjct: 61  NPGRPLPNYQPTPGIWPNFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNY 120

Query: 121 PHFLRFLFWIIITTSILFCIQVKRICFIWQRRNFPGYLFKKSELTFLTILSPXXXXXXXX 180
           PHFLRFLFWIIITTSILFCIQVKRICFIWQRRNFPGYLFKKSELTFLTILSP        
Sbjct: 121 PHFLRFLFWIIITTSILFCIQVKRICFIWQRRNFPGYLFKKSELTFLTILSPLNFFVLLT 180

Query: 181 XXXXXXRCLFNQIVNGRSQIESWDMDRLESLFDSRRLIQKLIYNTWRIYPESKTLQHERD 240
                 RCLFNQIVNGRSQIESWDMDRLESLFDSRRLIQKLIYNTWRIYPESKTLQHERD
Sbjct: 181 ITVLFLRCLFNQIVNGRSQIESWDMDRLESLFDSRRLIQKLIYNTWRIYPESKTLQHERD 240

Query: 241 AEGLLKQQRSSFEGLVNFPYNFDLHTNAILYLGPVHLWLWPYGIPTGNGNNFPKNDISNY 300
           AEGLLKQQRSSFEGLVNFPYNFDLHTNAILYLGPVHLWLWPYGIPTGNGNNFPKNDISNY
Sbjct: 241 AEGLLKQQRSSFEGLVNFPYNFDLHTNAILYLGPVHLWLWPYGIPTGNGNNFPKNDISNY 300

Query: 301 EVDSPLEDIILSLPWPPDGGETTTVSNPKTSTIETCNEGGEQVVRSRVAQNGRSASREKW 360
           EVDSPLEDIILSLPWPPDGGETTTVSNPKTSTIETCNEGGEQVVRSRVAQNGRSASREKW
Sbjct: 301 EVDSPLEDIILSLPWPPDGGETTTVSNPKTSTIETCNEGGEQVVRSRVAQNGRSASREKW 360

Query: 361 FNDWGESLDDFGVDVDME 378
           FNDWGESLDDFGVDVDME
Sbjct: 361 FNDWGESLDDFGVDVDME 378

>Suva_15.172 Chr15 complement(296325..297521) [1197 bp, 398 aa] {ON}
           YOL003C (REAL)
          Length = 398

 Score =  622 bits (1604), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/378 (76%), Positives = 320/378 (84%)

Query: 1   MAVKLRWPWLGIAIPTLLISFIGYGAHYFILSNFLPIAKQIGFEFSLSMIWFSYYLAIYT 60
           MAVKL+WPWLGIAIPT LISFIGYGAHYFILSNFL ++KQI FE SLSMIW SYYLAIYT
Sbjct: 21  MAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSVSKQIAFESSLSMIWVSYYLAIYT 80

Query: 61  NPGRPLPNYQPTPGIWPNFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNY 120
           NPG+P P YQP P  WPN+CKKCQNYKPERSHHCK CNQCVLMMDHHCPWTMNCVGF NY
Sbjct: 81  NPGKPSPTYQPNPNTWPNYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNY 140

Query: 121 PHFLRFLFWIIITTSILFCIQVKRICFIWQRRNFPGYLFKKSELTFLTILSPXXXXXXXX 180
           PHFLRF+FW+I TT  LFCIQ+KR+ FIWQ+R+ PGYLFKKSEL FLTIL+P        
Sbjct: 141 PHFLRFIFWVIATTGFLFCIQLKRVSFIWQQRHLPGYLFKKSELVFLTILTPLNFFVLLT 200

Query: 181 XXXXXXRCLFNQIVNGRSQIESWDMDRLESLFDSRRLIQKLIYNTWRIYPESKTLQHERD 240
                 RCLFNQI+NGRSQIESWDMDRLESLFDS+RLI+KLI NTWRIYPE+++ Q ERD
Sbjct: 201 IVILFLRCLFNQIINGRSQIESWDMDRLESLFDSQRLIKKLIENTWRIYPEARSPQLERD 260

Query: 241 AEGLLKQQRSSFEGLVNFPYNFDLHTNAILYLGPVHLWLWPYGIPTGNGNNFPKNDISNY 300
           AE LL Q +  FE +VNFPYN DL TNA +YLGP+HLWLWP G P G+GN+F KNDIS Y
Sbjct: 261 AEKLLTQHKIRFEEVVNFPYNIDLFTNATIYLGPLHLWLWPCGAPAGDGNSFQKNDISKY 320

Query: 301 EVDSPLEDIILSLPWPPDGGETTTVSNPKTSTIETCNEGGEQVVRSRVAQNGRSASREKW 360
           EV+S LEDI+LSLPWPPDGG+  T SN     IETCNEGGEQVVRSR+AQ+GRSA+REKW
Sbjct: 321 EVNSSLEDIMLSLPWPPDGGKIKTASNHSNLAIETCNEGGEQVVRSRIAQHGRSATREKW 380

Query: 361 FNDWGESLDDFGVDVDME 378
           +NDWGESLDDFGVDVDME
Sbjct: 381 YNDWGESLDDFGVDVDME 398

>Skud_15.159 Chr15 complement(281485..282624) [1140 bp, 379 aa] {ON}
           YOL003C (REAL)
          Length = 379

 Score =  617 bits (1591), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/379 (77%), Positives = 326/379 (86%), Gaps = 1/379 (0%)

Query: 1   MAVKLRWPWLGIAIPTLLISFIGYGAHYFILSNFLPIAKQIGFEFSLSMIWFSYYLAIYT 60
           MAVKL+WPWLGIAIPT LISFIGYGAHYFILSNFL I+KQ+ FE SLSMIW SYYLAIYT
Sbjct: 1   MAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSISKQLLFELSLSMIWVSYYLAIYT 60

Query: 61  NPGRPLPNYQPTPGIWPNFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNY 120
           N GRPLPNY+P+P IWPNFCKKCQ+YKPERSHHCK CNQCVLMMDHHCPWTMNCVGF NY
Sbjct: 61  NAGRPLPNYRPSPLIWPNFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNY 120

Query: 121 PHFLRFLFWIIITTSILFCIQVKRICFIWQRRNFPGYLFKKSELTFLTILSPXXXXXXXX 180
           PHFLRFLFW+I+TTSILFC+QVKRICFIWQ+R+ PGYLF+KSEL FLTILSP        
Sbjct: 121 PHFLRFLFWVIVTTSILFCMQVKRICFIWQQRSLPGYLFEKSELIFLTILSPLDFFVLLT 180

Query: 181 XXXXXXRCLFNQIVNGRSQIESWDMDRLESLFDSRRLIQKLIYNTWRIYPESKTLQHERD 240
                 RCL NQI+NGRSQIESWDMDRLESL DS +LI KLI NTWRIYPE+++ QHERD
Sbjct: 181 IAILFLRCLSNQIINGRSQIESWDMDRLESLCDSGKLIPKLIDNTWRIYPEARSSQHERD 240

Query: 241 AEGLLKQQ-RSSFEGLVNFPYNFDLHTNAILYLGPVHLWLWPYGIPTGNGNNFPKNDISN 299
           A+ LL Q+ R+ F+ LV+FPYNF+  TNAILYLGP+ LWLWPYG P G+GN+FPKNDIS 
Sbjct: 241 ADKLLTQRGRARFDELVSFPYNFNPCTNAILYLGPIRLWLWPYGTPAGDGNSFPKNDISQ 300

Query: 300 YEVDSPLEDIILSLPWPPDGGETTTVSNPKTSTIETCNEGGEQVVRSRVAQNGRSASREK 359
           YEV+SPLEDIILSLPWPPDG +T  VSN   STIET NEGGEQ+VRSR AQ+G  A REK
Sbjct: 301 YEVNSPLEDIILSLPWPPDGNKTKAVSNHNNSTIETYNEGGEQIVRSRNAQHGSDAIREK 360

Query: 360 WFNDWGESLDDFGVDVDME 378
           W+NDWGESLDDFGVDVDME
Sbjct: 361 WYNDWGESLDDFGVDVDME 379

>YOL003C Chr15 complement(321858..322994) [1137 bp, 378 aa] {ON}
           PFA4Palmitoyltransferase with autoacylation activity,
           required for palmitoylation of amino acid permeases
           containing a C-terminal Phe-Trp-Cys site; required for
           modification of Chs3p; member of the DHHC family of
           putative palmitoyltransferases
          Length = 378

 Score =  614 bits (1583), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/378 (76%), Positives = 322/378 (85%)

Query: 1   MAVKLRWPWLGIAIPTLLISFIGYGAHYFILSNFLPIAKQIGFEFSLSMIWFSYYLAIYT 60
           M VKLRWPWLGIAIPT LISFIGYGAHYFILSNFL + KQI FEF LSMIW SYYLAI T
Sbjct: 1   MPVKLRWPWLGIAIPTFLISFIGYGAHYFILSNFLSVPKQITFEFCLSMIWLSYYLAICT 60

Query: 61  NPGRPLPNYQPTPGIWPNFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNY 120
           NPGRPLPNY+P P IW NFCKKCQ+YKPERSHHCKTCNQCVLMMDHHCPWTMNCVGF NY
Sbjct: 61  NPGRPLPNYKPPPDIWRNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANY 120

Query: 121 PHFLRFLFWIIITTSILFCIQVKRICFIWQRRNFPGYLFKKSELTFLTILSPXXXXXXXX 180
           PHFLRFLFWII+TTS+LFCIQ KRI FIWQ+R+ PGY FKKSEL FLTI SP        
Sbjct: 121 PHFLRFLFWIIVTTSVLFCIQAKRIYFIWQQRHLPGYFFKKSELIFLTISSPLNSFVLLT 180

Query: 181 XXXXXXRCLFNQIVNGRSQIESWDMDRLESLFDSRRLIQKLIYNTWRIYPESKTLQHERD 240
                 RCLFNQI+NGRSQIESWDMDRLESLF+S RL QKLI NTWRIYPES++ Q+++D
Sbjct: 181 ITILFLRCLFNQILNGRSQIESWDMDRLESLFNSGRLTQKLIDNTWRIYPESRSFQNKKD 240

Query: 241 AEGLLKQQRSSFEGLVNFPYNFDLHTNAILYLGPVHLWLWPYGIPTGNGNNFPKNDISNY 300
           AE  L ++R  F+ LVNFPY+FDL+TNA+LYLGP+HLWLWPYG+PTG+GNNFPKN IS Y
Sbjct: 241 AEEHLTKKRPRFDELVNFPYDFDLYTNALLYLGPIHLWLWPYGVPTGDGNNFPKNGISKY 300

Query: 301 EVDSPLEDIILSLPWPPDGGETTTVSNPKTSTIETCNEGGEQVVRSRVAQNGRSASREKW 360
           E +S LED ILSLPWPPDGG+T TV N  +STIE  NE GEQ++R+R+ QNGR ASREKW
Sbjct: 301 EANSSLEDHILSLPWPPDGGKTNTVFNHGSSTIEMRNESGEQLIRTRLPQNGRHASREKW 360

Query: 361 FNDWGESLDDFGVDVDME 378
           +NDWGESLDDFGVDVDME
Sbjct: 361 YNDWGESLDDFGVDVDME 378

>Kpol_1037.23 s1037 complement(51397..52533) [1137 bp, 378 aa] {ON}
           complement(51397..52533) [1137 nt, 379 aa]
          Length = 378

 Score =  441 bits (1135), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 214/379 (56%), Positives = 265/379 (69%), Gaps = 2/379 (0%)

Query: 1   MAVKLRWPWLGIAIPTLLISFIGYGAHYFILSNFLPIAKQIGFEFSLSMIWFSYYLAIYT 60
           M VKL++PW+GIAIP  LISFI Y AHYFIL NFL I KQI FE S++MIW SYYLAIYT
Sbjct: 1   MPVKLKYPWMGIAIPCFLISFIAYTAHYFILLNFLSIGKQIWFEISVTMIWISYYLAIYT 60

Query: 61  NPGRPLPNYQPTPGIWPNFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNY 120
           NPG+P  NY P    W N+CKKC  YKPER+HHCKTC QCVLMMDHHCPWTMNCVG+ N+
Sbjct: 61  NPGKPGSNYIPPSNQWKNYCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNF 120

Query: 121 PHFLRFLFWIIITTSILFCIQVKRICFIWQRRNFPGYLFKKSELTFLTILSPXXXXXXXX 180
           PHFLRFLFW+I+TT+ L    + RI F+W+ RN P YLF KSE+ FLTI +P        
Sbjct: 121 PHFLRFLFWVIVTTTYLLYFLISRIVFLWKSRNLPSYLFNKSEIIFLTITTPMDGFVLLT 180

Query: 181 XXXXXXRCLFNQIVNGRSQIESWDMDRLESLFDSRRLIQKLIYNTWRIYPESKTLQHERD 240
                 RC  NQ+++GR+QIE+W+ +RLESLF  RRL  +LI N W  +PE KT  +E  
Sbjct: 181 ISLLFIRCTVNQLLSGRTQIETWENERLESLFYLRRLKPQLISNLWEFHPELKTPDNEAK 240

Query: 241 AEGLLKQQRSSFEGLVNFPYNFDLHTNAILYLGPVHLWLWPYGIPTGNGNNFPKNDISNY 300
           AE ++  +R  F+ LV+FPY+  L  N    LG    WLW YG P+G+G  F KN+ S +
Sbjct: 241 AEKIV-SKRIRFDLLVSFPYDLGLINNITTVLGSPVTWLWFYGEPSGDGMLFKKNEYSLF 299

Query: 301 EVDSPLEDIILSLPWPPDGGETT-TVSNPKTSTIETCNEGGEQVVRSRVAQNGRSASREK 359
           E DS LED ILSLPWPPDGG+    + N  T++IET  + GE V+R R   +    SR +
Sbjct: 300 EEDSILEDQILSLPWPPDGGKHGFNIENSSTNSIETSTKDGEHVIRKRSPVSKLLESRTQ 359

Query: 360 WFNDWGESLDDFGVDVDME 378
           W+NDWGE+L+DFGVD+D+E
Sbjct: 360 WYNDWGENLEDFGVDIDVE 378

>TDEL0G04410 Chr7 complement(800085..801230) [1146 bp, 381 aa] {ON}
           Anc_6.28 YOL003C
          Length = 381

 Score =  439 bits (1129), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 207/378 (54%), Positives = 262/378 (69%)

Query: 1   MAVKLRWPWLGIAIPTLLISFIGYGAHYFILSNFLPIAKQIGFEFSLSMIWFSYYLAIYT 60
           M VKL+WPWLGIAIP +L+SFIGY  H+FILSNFL  +KQ+ F+ +L++IW SYY AIYT
Sbjct: 1   MPVKLKWPWLGIAIPCVLVSFIGYCGHFFILSNFLSPSKQLWFQCNLALIWLSYYYAIYT 60

Query: 61  NPGRPLPNYQPTPGIWPNFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNY 120
           NPGRP PN++     W N+CKKCQNYKPER+HHCKTCNQCVLMMDHHCPWTMNCVG  N+
Sbjct: 61  NPGRPRPNFEVPKYEWKNYCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNF 120

Query: 121 PHFLRFLFWIIITTSILFCIQVKRICFIWQRRNFPGYLFKKSELTFLTILSPXXXXXXXX 180
           PHFLRFL W+I+ T+ L    V RI  +W+ RN P Y+F +SEL FLTIL+P        
Sbjct: 121 PHFLRFLVWVIVATAFLLYQLVSRIIVLWRDRNLPDYMFHRSELVFLTILTPLDAFVLLT 180

Query: 181 XXXXXXRCLFNQIVNGRSQIESWDMDRLESLFDSRRLIQKLIYNTWRIYPESKTLQHERD 240
                 RCL NQI NG SQIE+W+++RL++LFDS+RL+  LI   W I+P ++   +E  
Sbjct: 181 ITILLCRCLANQIFNGMSQIETWELERLQALFDSKRLVPLLIEAAWDIFPGTREQINEST 240

Query: 241 AEGLLKQQRSSFEGLVNFPYNFDLHTNAILYLGPVHLWLWPYGIPTGNGNNFPKNDISNY 300
           A  L   +    E +VNFPY+ D  +NA   LG   LWLWP+G P G+G +F KN+IS Y
Sbjct: 241 AAELSMNKELRLEDVVNFPYDLDPWSNAEQLLGNPLLWLWPFGRPKGDGMSFVKNEISEY 300

Query: 301 EVDSPLEDIILSLPWPPDGGETTTVSNPKTSTIETCNEGGEQVVRSRVAQNGRSASREKW 360
              +  ED++LSLPWPPDGG T       +S+IE+  + GEQ++R R         R +W
Sbjct: 301 SSRASYEDLLLSLPWPPDGGRTRAGPGSLSSSIESITKQGEQLIRRRPNDTSDLIGRRQW 360

Query: 361 FNDWGESLDDFGVDVDME 378
            NDWGE+L+DFGVDVD E
Sbjct: 361 QNDWGENLEDFGVDVDTE 378

>TPHA0J00390 Chr10 (88587..89729) [1143 bp, 380 aa] {ON} Anc_6.28
           YOL003C
          Length = 380

 Score =  439 bits (1128), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 203/379 (53%), Positives = 264/379 (69%), Gaps = 1/379 (0%)

Query: 1   MAVKLRWPWLGIAIPTLLISFIGYGAHYFILSNFLPIAKQIGFEFSLSMIWFSYYLAIYT 60
           M VK +WPW+GIAIP +LISFIGY +HY+IL   L + KQ  FEFSL+MIW SYY+AI  
Sbjct: 1   MPVKFKWPWMGIAIPCVLISFIGYLSHYYILRQHLSLIKQCYFEFSLTMIWVSYYMAIII 60

Query: 61  NPGRPLPNYQPTPGIWPNFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNY 120
           NPG+P  N++P P  W NFCKKC NYKPERSHHCKTCNQCVLMMDHHCPWTMNC+GF N+
Sbjct: 61  NPGKPGKNFKPLPHEWRNFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNF 120

Query: 121 PHFLRFLFWIIITTSILFCIQVKRICFIWQRRNFPGYLFKKSELTFLTILSPXXXXXXXX 180
           PHF+RFL WI+ TT  L   Q+KRI ++W  RN P YLF++SE+  L + +P        
Sbjct: 121 PHFMRFLLWIMATTGFLLFYQIKRIIYMWNNRNLPSYLFERSEVIALFVCTPLNLFILLT 180

Query: 181 XXXXXXRCLFNQIVNGRSQIESWDMDRLESLFDSRRLIQKLIYNTWRIYPESKTLQHERD 240
                 RCLFNQI+NG++QIE W+MDRLE+ F  ++L+ +LI N W +YPE K+ +H+ +
Sbjct: 181 ITLLFCRCLFNQIINGKTQIEDWEMDRLENRFYLKKLLPQLILNLWELYPELKSAKHDEE 240

Query: 241 AEGLLKQQRSSFEGLVNFPYNFDLHTNAILYLGPVHLWLWPYGIPTGNGNNFPKNDISNY 300
           AE L++++   ++ +VNFPY+  +  N    +G    WLWP+G P+GNG NF KN+I+ +
Sbjct: 241 AERLIEKKGIRYDSIVNFPYDLGIFKNITALVGQPLYWLWPFGGPSGNGMNFEKNEIALF 300

Query: 301 EVDSPLEDIILSLPWPPDGGETTTVSNPKT-STIETCNEGGEQVVRSRVAQNGRSASREK 359
           + DS L    L+LPWPPD G         T S +E     GEQVVR+R        SRE+
Sbjct: 301 DPDSSLPVFTLALPWPPDKGRHNNSKTLNTDSNVEFITTDGEQVVRNRTHAKNPILSREE 360

Query: 360 WFNDWGESLDDFGVDVDME 378
           WFN+WGE+L+DFGVDV+ME
Sbjct: 361 WFNEWGENLEDFGVDVEME 379

>ZYRO0C07546g Chr3 complement(574411..575544) [1134 bp, 377 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003C DHHC-CRD protein
          Length = 377

 Score =  437 bits (1123), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 213/378 (56%), Positives = 265/378 (70%), Gaps = 1/378 (0%)

Query: 1   MAVKLRWPWLGIAIPTLLISFIGYGAHYFILSNFLPIAKQIGFEFSLSMIWFSYYLAIYT 60
           M V+L+WP+LGIAIP  LISFIGY AHYFILSNFL   KQI FEFSL+MIWFSYYLAIYT
Sbjct: 1   MPVQLKWPFLGIAIPCFLISFIGYNAHYFILSNFLSTQKQIWFEFSLTMIWFSYYLAIYT 60

Query: 61  NPGRPLPNYQPTPGIWPNFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNY 120
            PG+PLPN+QP+   W ++CKKC+NYKPER+HHCKTCNQCVL MDHHCPWT NCVG+ N+
Sbjct: 61  LPGQPLPNFQPSKNSWKSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNF 120

Query: 121 PHFLRFLFWIIITTSILFCIQVKRICFIWQRRNFPGYLFKKSELTFLTILSPXXXXXXXX 180
           PHF+RFLFW+I TT  L      R  FI    N P YL+ KSEL FLTIL P        
Sbjct: 121 PHFMRFLFWVIATTGYLLYELCLRAYFILSNHNSPTYLWNKSELIFLTILIPMDGFILLT 180

Query: 181 XXXXXXRCLFNQIVNGRSQIESWDMDRLESLFDSRRLIQKLIYNTWRIYPESKTLQHERD 240
                 RCL NQI  GR+QIE+W+ +RLE L+ S+RL+  L+ N W +YPE +T + E +
Sbjct: 181 ISILFIRCLSNQIFCGRTQIETWEYERLEGLYYSKRLLPHLLANFWELYPELRTRELEDE 240

Query: 241 AEGLLKQQRSSFEGLVNFPYNFDLHTNAILYLGPVHLWLWPYGIPTGNGNNFPKNDISNY 300
           A  L  ++R   + LVNFPY+ D  +N I +LG    WLWP+G P G+G  FPKNDIS +
Sbjct: 241 ASRLSTRRRIGLDHLVNFPYDIDPWSNTIEFLGSPLFWLWPFGKPKGDGMFFPKNDISEF 300

Query: 301 EVDSPLEDIILSLPWPPDGGETTTVSNPKTSTIETCNEGGEQVVRSRVAQNGRSASREKW 360
           E ++ L D++L+LPWPPDGG+   +S    + +ET    GEQV+R R+      +SR +W
Sbjct: 301 E-ETNLTDMLLALPWPPDGGKDKVISIDGPNAVETTVRDGEQVIRKRLVDPRDPSSRTQW 359

Query: 361 FNDWGESLDDFGVDVDME 378
            N WGE+L+DFGVDVD E
Sbjct: 360 QNTWGENLEDFGVDVDAE 377

>SAKL0E01518g Chr5 (113669..114808) [1140 bp, 379 aa] {ON} similar
           to uniprot|Q12006 Saccharomyces cerevisiae YOL003C
           DHHC-CRD protein
          Length = 379

 Score =  429 bits (1103), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 210/380 (55%), Positives = 259/380 (68%), Gaps = 3/380 (0%)

Query: 1   MAVKLRWPWLGIAIPTLLISFIGYGAHYFILSNFLPIAKQIGFEFSLSMIWFSYYLAIYT 60
           MAVKL+WPWLGIAIP  LISFIGY AHYFILSNFLP  KQ+ FEFSL MIW SYYLAIYT
Sbjct: 1   MAVKLKWPWLGIAIPLFLISFIGYCAHYFILSNFLPTKKQLWFEFSLGMIWISYYLAIYT 60

Query: 61  NPGRPLPNYQPTPGIWPNFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNY 120
           NPG+P P ++P+   W NFC KC NYKPER+HHCK CNQCVL MDHHCPWTMNCVG  N+
Sbjct: 61  NPGKPTPGFRPSKFEWENFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNF 120

Query: 121 PHFLRFLFWIIITTSILFCIQVKRICFIWQRRNFPGYLFKKSELTFLTILSPXXXXXXXX 180
            HF+RFLFW+I TTS L    VKRI F+W RR+ P Y   +SEL FLTIL+P        
Sbjct: 121 AHFIRFLFWVIETTSFLLTYLVKRILFLWNRRHMPNYFVHRSELIFLTILTPMDAFVLLT 180

Query: 181 XXXXXXRCLFNQIVNGRSQIESWDMDRLESLFDSRRLIQKLIYNTWRIYPESKTLQHERD 240
                 RC  NQI+ G +QIESW+MDR+E++F S +LI +++ N   I P S + Q + D
Sbjct: 181 ISLLLLRCAKNQILKGMTQIESWEMDRIENMFHSGQLIPRMLENLKEIRPGSLSNQDD-D 239

Query: 241 AEGLLKQQRSSFEGLVNFPYNFDLHTNAILYLGPVHLWLWPYGIPTGNGNNFPKNDISNY 300
              LL Q R S + +VNFPY+ +   NA+  LG ++ W+ P+G   GNG  F KN++S Y
Sbjct: 240 IRKLLSQNRLSLDEIVNFPYDLNPWANAVNSLGDMYSWILPWGTAKGNGMIFEKNELSVY 299

Query: 301 EVDSPLEDIILSLPWPPDGGETTTVSNPK--TSTIETCNEGGEQVVRSRVAQNGRSASRE 358
           E + P+ED +LSLPWPPDGG            + +E+    GE+VVR R      +  R+
Sbjct: 300 EPEIPIEDKLLSLPWPPDGGRHKVPGGGANDVNIVESSTRDGERVVRKRWVDPRTTMPRK 359

Query: 359 KWFNDWGESLDDFGVDVDME 378
           KW+NDWGE+L DFGVD+D E
Sbjct: 360 KWYNDWGENLADFGVDLDEE 379

>CAGL0E02497g Chr5 complement(241355..242485) [1131 bp, 376 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003c
          Length = 376

 Score =  426 bits (1095), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 208/378 (55%), Positives = 259/378 (68%), Gaps = 2/378 (0%)

Query: 1   MAVKLRWPWLGIAIPTLLISFIGYGAHYFILSNFLPIAKQIGFEFSLSMIWFSYYLAIYT 60
           M VKL+WPWLGIAIP+ LI+ IGY AHYFIL NFL + KQ+ ++F  +MIW SYYLAIYT
Sbjct: 1   MPVKLKWPWLGIAIPSFLIASIGYCAHYFILLNFLSLRKQLWYQFCQTMIWLSYYLAIYT 60

Query: 61  NPGRPLPNYQPTPGIWPNFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNY 120
            PG+P  N++P+   W  +CKKC+ YKPERSHHCKTCNQCVLMMDHHCPWTMNCVG+ N+
Sbjct: 61  PPGKPPTNFKPSKNEWKVYCKKCKCYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNF 120

Query: 121 PHFLRFLFWIIITTSILFCIQVKRICFIWQRRNFPGYLFKKSELTFLTILSPXXXXXXXX 180
           PHF+RFLFW+I+ T+ L      RI  IW  R+ P YL+ KSEL FLTIL+P        
Sbjct: 121 PHFIRFLFWVIVGTTSLAIFLTTRIHSIWVHRSSPSYLYYKSELIFLTILTPLNAFILLT 180

Query: 181 XXXXXXRCLFNQIVNGRSQIESWDMDRLESLFDSRRLIQKLIYNTWRIYPESKTLQHERD 240
                 RCLFNQI NGRSQIESW+MDRLE+L    +L+  LI N W I+P  +    E  
Sbjct: 181 ISILMIRCLFNQIFNGRSQIESWEMDRLETLARMSKLLPILIENVWYIFPNLRNEHVESQ 240

Query: 241 AEGLLKQQRSSFEGLVNFPYNFDLHTNAILYLGPVHLWLWPYGIPTGNGNNFPKNDISNY 300
           AE LL ++R S + LVNFPY+     NAI  LG   LWL+P+  P  +G +F KN+ S  
Sbjct: 241 AEALLNKKRLSLDELVNFPYDLGPFRNAIQLLGTPPLWLYPFSGPQDDGLHFQKNEESMI 300

Query: 301 EVDSPLEDIILSLPWPPDGGETTTVSNPKTSTIETCNEGGEQVVRSRVAQNGRSASREKW 360
           E  + L DIIL LPWPPD  +    ++  TS ++  +E GEQV+R R  +  +  SR +W
Sbjct: 301 EDPNSLNDIILCLPWPPDSTKHLNSTSEHTSNVQIISEEGEQVIRIRTPE--KKLSRSEW 358

Query: 361 FNDWGESLDDFGVDVDME 378
            NDWGESL+DFGVDVD+E
Sbjct: 359 LNDWGESLEDFGVDVDVE 376

>NCAS0D02140 Chr4 complement(398924..400054) [1131 bp, 376 aa] {ON}
           Anc_6.28
          Length = 376

 Score =  416 bits (1070), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 194/379 (51%), Positives = 267/379 (70%), Gaps = 4/379 (1%)

Query: 1   MAVKLRWPWLGIAIPTLLISFIGYGAHYFILSNFLPIAKQIGFEFSLSMIWFSYYLAIYT 60
           M VKL++PW+G+ IP LL SFIGY AH F+L+NF+    Q+ F+ SL+M+W SY LAI+T
Sbjct: 1   MPVKLKYPWMGVVIPCLLTSFIGYSAHIFVLANFMSWKLQLWFQSSLTMLWISYALAIFT 60

Query: 61  NPGRPLPNYQPTPGIWPNFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNY 120
           NPGRP  +++P    W +FCKKCQ +KPER+HHCKTCNQCVLMMDHHCPWTMNCVGF N+
Sbjct: 61  NPGRPAKSFKPLKKEWTHFCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNF 120

Query: 121 PHFLRFLFWIIITTSILFCIQVKRICFIWQRRNFPGYLFKKSELTFLTILSPXXXXXXXX 180
           PHFLRFLFW+++TT  L    +KR  ++W  ++ P YLF+K+E+TFL IL P        
Sbjct: 121 PHFLRFLFWVVVTTGFLLYQLLKRTIYLWGVKDLPSYLFEKTEITFLIILIPMDGFVLIT 180

Query: 181 XXXXXXRCLFNQIVNGRSQIESWDMDRLESLFDSRRLIQKLIYNTWRIYPESKTLQHERD 240
                 RCL NQI+ G++QIESW+++RLE+L+  ++L+ +L+ N W IYP  KT +++  
Sbjct: 181 VALLFIRCLSNQIIGGKTQIESWELERLENLYYRKKLLPQLLVNLWEIYPNEKTPENKVL 240

Query: 241 AEGLLKQQRS-SFEGLVNFPYNFDLHTNAILYLGPVHLWLWPYGIPTGNGNNFPKNDISN 299
           A+ L ++ R   FE +V FPY+ D+ +NA+  LG    WLW +G P  +G +F KN+++ 
Sbjct: 241 AKKLQERGRKVRFENIVTFPYDLDIWSNALTVLGSPVQWLWLFGGPDSDGMHFKKNELAL 300

Query: 300 YEVDSPLEDIILSLPWPPDGGETTTVSNPKTSTIETCNEGGEQVVRSRVAQNGRSASREK 359
           YE  + +ED++LSLPWPPDGG        K + +E+  E GEQV+R R  +N  S  R+ 
Sbjct: 301 YEEGAAIEDLLLSLPWPPDGGRNFI--QQKGTNVESITENGEQVIRQRNFENDNSY-RKT 357

Query: 360 WFNDWGESLDDFGVDVDME 378
           W NDWGE+L+DFGVDVD+E
Sbjct: 358 WNNDWGENLEDFGVDVDVE 376

>NDAI0C02650 Chr3 (614101..615270) [1170 bp, 389 aa] {ON} Anc_6.28
          Length = 389

 Score =  416 bits (1070), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 205/389 (52%), Positives = 265/389 (68%), Gaps = 13/389 (3%)

Query: 1   MAVKLRWPWLGIAIPTLLISFIGYGAHYFILSNFLPIAKQIGFEFSLSMIWFSYYLAIYT 60
           MA+KL++PWLG+AIP+ +ISFIGY +HYFILSNFL I KQI F+FSLSMIW SY LAI+T
Sbjct: 1   MAIKLKYPWLGVAIPSFIISFIGYNSHYFILSNFLSIKKQIWFQFSLSMIWVSYLLAIFT 60

Query: 61  NPGRPLPNYQPTP----GIWPNFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVG 116
           NPG+P  N +P        W   CKKC NYKPERSHHCKTCNQCVLMMDHHCPWTMNCVG
Sbjct: 61  NPGKPPKNCKPIDFNDQRKWNTHCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVG 120

Query: 117 FGNYPHFLRFLFWIIITTSILFCIQVKRICFIWQRRNFPGYLFKKSELTFLTILSPXXXX 176
           + N+PHF+RFL WIIITT  L    +KR   +W  R+ P Y+F ++E+ FLTIL P    
Sbjct: 121 YKNFPHFIRFLMWIIITTGFLLVHLLKRTMTMWNLRHLPSYIFDRNEIIFLTILIPMDAF 180

Query: 177 XXXXXXXXXXRCLFNQIVNGRSQIESWDMDRLESLFDSRRLIQKLIYNTWRIYPESKTLQ 236
                     RC  NQIV G +QIE W+++RLE+LF +++L+  +I   W +YP  +T  
Sbjct: 181 ILLTISLLFIRCFNNQIVRGMTQIEFWELERLENLFYNKKLLPMIIATLWEVYPNERTKV 240

Query: 237 HERDAEGLL-KQQRSSFEGLVNFPYNFDLHTNAILYLGPVHLWLWPYGIPTGNGNNFPKN 295
            +  A+ LL ++++  FE +VNFPY+ D+ TN    +G    W+W +G+P  NG  F KN
Sbjct: 241 ADNYADDLLSRRKKVRFENIVNFPYDIDIWTNMNTVMGSAFNWIWIFGVPDRNGLKFEKN 300

Query: 296 DISNYEVDSPLEDIILSLPWPPDGGETTTVSNPKTSTIETCNEGGEQVVRSRVAQN---- 351
           +IS YE  S +ED++LSLPWPPD G    +SN  TS +E+    GEQVVR+R + +    
Sbjct: 301 EISLYEPGSSVEDLLLSLPWPPDKGR-NFISNKDTS-VESLVYDGEQVVRNRASNDTNIS 358

Query: 352 --GRSASREKWFNDWGESLDDFGVDVDME 378
              +  SRE+W NDWGESL DFGVD++ E
Sbjct: 359 TINKDISREEWNNDWGESLVDFGVDIEAE 387

>Ecym_3032 Chr3 (63354..64487) [1134 bp, 377 aa] {ON} similar to
           Ashbya gossypii ACL003C
          Length = 377

 Score =  409 bits (1051), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 197/378 (52%), Positives = 256/378 (67%), Gaps = 2/378 (0%)

Query: 1   MAVKLRWPWLGIAIPTLLISFIGYGAHYFILSNFLPIAKQIGFEFSLSMIWFSYYLAIYT 60
           M VKL+WPWLGIAIP  LI+FIGY A  F+L  FL + +QI F+FSL+MIW SYY AIYT
Sbjct: 1   MPVKLKWPWLGIAIPCFLIAFIGYSAQLFVLQGFLSVKQQIWFQFSLTMIWLSYYKAIYT 60

Query: 61  NPGRPLPNYQPTPGIWPNFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNY 120
           NPG P+P +QP    W N+CKKCQN+KPER+HHCKTC QCVL+MDHHCP+TMNCVG+ N+
Sbjct: 61  NPGSPVPGFQPLKHEWKNYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNF 120

Query: 121 PHFLRFLFWIIITTSILFCIQVKRICFIWQRRNFPGYLFKKSELTFLTILSPXXXXXXXX 180
           PHF+RFLFWII TT+ L     KR  F+W  R+    L  K E+ FLTIL+P        
Sbjct: 121 PHFMRFLFWIITTTTYLSIQFFKRTWFVWNIRHSTAQLVTKKEIIFLTILTPANAFVLLT 180

Query: 181 XXXXXXRCLFNQIVNGRSQIESWDMDRLESLFDSRRLIQKLIYNTWRIYPESKTLQHERD 240
                 RC+ NQ++NG +QIE+W+MDR+ES+F +RRL+ +L+ N   +YP S    H+ +
Sbjct: 181 ISILFGRCIKNQVLNGMTQIEAWEMDRIESMFYNRRLVPQLLSNLEELYPNSLD-GHKGE 239

Query: 241 AEGLLKQQRSSFEGLVNFPYNFDLHTNAILYLGPVHLWLWPYGIPTGNGNNFPKNDISNY 300
            + +L  ++ SFE LVNFPY+ D   N I  +GP+  WL P+G P GNG  F KN++S Y
Sbjct: 240 IDRILNNRKISFEDLVNFPYDSDPWRNLINCMGPMLTWLNPFGKPNGNGMVFEKNELSAY 299

Query: 301 EVDSPLEDIILSLPWPPDGGETTTVSNPKTSTIETCNEGGEQVVRSRVAQNGRSASREKW 360
           E  S L D +LSLPWPPDG      SN +   +E+    GE ++R R  +   + SR +W
Sbjct: 300 EHGSTLTDKLLSLPWPPDGERAPNSSNSRLK-VESSTRNGEHIIRKRSPEPRLNLSRTEW 358

Query: 361 FNDWGESLDDFGVDVDME 378
           +NDWGE+L  FGVDVD +
Sbjct: 359 YNDWGENLAHFGVDVDAD 376

>KLTH0C10978g Chr3 complement(905760..906893) [1134 bp, 377 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003C DHHC-CRD protein
          Length = 377

 Score =  385 bits (990), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 185/379 (48%), Positives = 249/379 (65%), Gaps = 4/379 (1%)

Query: 1   MAVKLRWPWLGIAIPTLLISFIGYGAHYFILSNFLPIAKQIGFEFSLSMIWFSYYLAIYT 60
           M V+L+WPWLGIA+P+ LI++IGY +HYFIL NF    +Q+ FEFSL++IW SY  AI+ 
Sbjct: 1   MPVELKWPWLGIAVPSFLIAYIGYSSHYFILQNFASTYQQLWFEFSLTLIWVSYAFAIFK 60

Query: 61  NPGRPLPNYQPTPGIWPNFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNY 120
           NPGRP PN++P    W N+CKKC NYKPER+HHCKTC QCVL MDHHCPWTMNCVG  N+
Sbjct: 61  NPGRPPPNFEPPIHQWKNYCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNF 120

Query: 121 PHFLRFLFWIIITTSILFCIQVKRICFIWQRRNFPGYLFKKSELTFLTILSPXXXXXXXX 180
           PHF+RFL W+++TTS L  +  +R    W  RN   ++   SEL FL + +P        
Sbjct: 121 PHFVRFLTWVVLTTSYLGLLLTQRAFDHWASRNTRKFV-HTSELCFLFVNAPLNAFILLT 179

Query: 181 XXXXXXRCLFNQIVNGRSQIESWDMDRLESLFDSRRLIQKLIYNTWRIYPESKTLQHERD 240
                 RC+ NQ +NG +QIESW+ DR+E+LF + RL+ +LI N   ++PE      E  
Sbjct: 180 VSLLVFRCVKNQFLNGMTQIESWEKDRIENLFFNERLVPQLIDNLKELFPEDTF--DEGA 237

Query: 241 AEGLLKQQRSSFEGLVNFPYNFDLHTNAILYLGPVHLWLWPYGIPTGNGNNFPKNDISNY 300
           A+ LL  ++   E ++NFPY+ D+  N    +GP++ W  P G P   G  F  ND+S+Y
Sbjct: 238 AQKLLSSKQLELEDIINFPYDVDILENMKSSMGPIYSWCLPCGRPRDEGTRFVTNDLSDY 297

Query: 301 EVDSPLEDIILSLPWPPDGG-ETTTVSNPKTSTIETCNEGGEQVVRSRVAQNGRSASREK 359
           ++ + +ED +LSLPWPPDGG + +  S    ST+ET + GGE  +R+R   +  S  R +
Sbjct: 298 DIKASIEDKLLSLPWPPDGGRQKSQRSADIASTLETFSSGGEATLRNRSFDSRISVPRTE 357

Query: 360 WFNDWGESLDDFGVDVDME 378
           W NDWGE+L DFGVDVD E
Sbjct: 358 WHNDWGENLSDFGVDVDAE 376

>KLLA0C06204g Chr3 complement(548912..550045) [1134 bp, 377 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003C DHHC- CRD protein
          Length = 377

 Score =  366 bits (940), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 177/379 (46%), Positives = 246/379 (64%), Gaps = 3/379 (0%)

Query: 1   MAVKLRWPWLGIAIPTLLISFIGYGAHYFILSNFLPIAKQIGFEFSLSMIWFSYYLAIYT 60
           MA+KL+  WLG+AIP  L++ IGYG+HYFILSNFL   +QI ++   +MIW SYYLAIYT
Sbjct: 1   MAIKLKNRWLGVAIPAFLVALIGYGSHYFILSNFLSWNEQIFYQTCQTMIWVSYYLAIYT 60

Query: 61  NPGRPLPNYQPTPGIWPNFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNY 120
           NPG P  +++P+   W N+CKKC+ YKPER+HHCKTCNQCVL MDHHCPWT+NCVG  N+
Sbjct: 61  NPGIPPKDFKPSAEEWHNYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNF 120

Query: 121 PHFLRFLFWIIITTSILFCIQVKRICFIWQRRNFPGYLFKKSELTFLTILSPXXXXXXXX 180
           PHF+RFLFW+I +T+ L  + + RI  +W  R+   +    SE+ F+ I++P        
Sbjct: 121 PHFMRFLFWVIFSTAYLLFLLIGRIYLLWSIRHTAFHHRSTSEIIFICIMTPMDAFVLLT 180

Query: 181 XXXXXXRCLFNQIVNGRSQIESWDMDRLESLFDSRRLIQKLIYNTWRIYPES-KTLQHER 239
                 RC++NQ ++G +QIESW+MDR++SL    RL+ ++I       PE     QHE 
Sbjct: 181 VSSLLGRCIYNQCLHGMTQIESWEMDRIQSLHYKNRLLAQVIDRLVERRPEILPAKQHEI 240

Query: 240 DAEGLLKQQRSSFEGLVNFPYNFDLHTNAILYLGPVHLWLWPYGIPTGNGNNFPKNDISN 299
           +   LL ++  + E   NFPY+ +  TN    +GP +LWLWP+  P   G +F KN++  
Sbjct: 241 NK--LLSKRYVNQEDFTNFPYDVNPWTNINNAMGPWYLWLWPWSKPPTIGTSFAKNELFF 298

Query: 300 YEVDSPLEDIILSLPWPPDGGETTTVSNPKTSTIETCNEGGEQVVRSRVAQNGRSASREK 359
           Y+ +S +ED+++SLPWPPDG    + +    S+IET   GGEQV+R +         R  
Sbjct: 299 YDPNSSIEDMLMSLPWPPDGLTHHSRALGSGSSIETIVSGGEQVIRDKSVDLRDRLGRNS 358

Query: 360 WFNDWGESLDDFGVDVDME 378
           W+NDWGE L DFGVD ++E
Sbjct: 359 WYNDWGEDLSDFGVDTELE 377

>Kwal_56.22459 s56 (138563..139714) [1152 bp, 383 aa] {ON} YOL003C -
           Hypothetical ORF [contig 185] FULL
          Length = 383

 Score =  366 bits (940), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 183/379 (48%), Positives = 249/379 (65%), Gaps = 4/379 (1%)

Query: 1   MAVKLRWPWLGIAIPTLLISFIGYGAHYFILSNFLPIAKQIGFEFSLSMIWFSYYLAIYT 60
           M VKL+WPWLGIAIP+ LI+FIGYG+HYFIL NFL + +Q+ F+  LSMIW SY LAI+T
Sbjct: 1   MPVKLKWPWLGIAIPSSLIAFIGYGSHYFILGNFLSLGQQVWFQICLSMIWISYALAIFT 60

Query: 61  NPGRPLPNYQPTPGIWPNFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNY 120
           NPG+P   +QP P  W N C+KC+ YKPER+HHCKTC+QCVL+MDHHCPWTMNCVG  N+
Sbjct: 61  NPGKPPTGFQPLPHQWKNICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNF 120

Query: 121 PHFLRFLFWIIITTSILFCIQVKRICFIWQRRNFPGYLFKKSELTFLTILSPXXXXXXXX 180
           PHF+RFL W+IITTS L  +  KRI   WQ R+   Y+ +K EL F+ I +P        
Sbjct: 121 PHFVRFLVWVIITTSYLGFMLWKRIFMHWQLRHTRIYV-QKIELVFIFINTPLNAFVWLT 179

Query: 181 XXXXXXRCLFNQIVNGRSQIESWDMDRLESLFDSRRLIQKLIYNTWRIYPESKTLQHERD 240
                 RC  NQ + G +QIE W+ +R+E+ F++ RLI +L+ N   IY +   + +  +
Sbjct: 180 IILLLLRCSKNQFLCGMTQIERWEWERIENQFNNGRLIPQLLENLAEIYGDD--ILNSPN 237

Query: 241 AEGLLKQQRSSFEGLVNFPYNFDLHTNAILYLGPVHLWLWPYGIPTGNGNNFPKNDISNY 300
           A+ L+  +    E +VNFPY+ ++  N    +G +   + P+  P GNG  F KND+S+Y
Sbjct: 238 AKKLINARDLQLEEIVNFPYDLNIVANTRHAIGNLLTCILPWSSPVGNGLKFTKNDLSSY 297

Query: 301 EVDSPLEDIILSLPWPPDGGETTTVSNPKTST-IETCNEGGEQVVRSRVAQNGRSASREK 359
           +    +ED +LSLPWPPDGG      + + S+ IE  +  GE V+R R+     +  R +
Sbjct: 298 DTCHTIEDKLLSLPWPPDGGRQQPTGDSQVSSRIEMHSSRGEPVLRKRLRDPRINMQRTE 357

Query: 360 WFNDWGESLDDFGVDVDME 378
           W+NDWGE+L DFGVDV+ E
Sbjct: 358 WYNDWGENLSDFGVDVESE 376

>KAFR0A05130 Chr1 complement(1019919..1021109) [1191 bp, 396 aa]
           {ON} Anc_6.28 YOL003C
          Length = 396

 Score =  365 bits (937), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 190/397 (47%), Positives = 246/397 (61%), Gaps = 20/397 (5%)

Query: 1   MAVKLRWPWLGIAIPTLLISFIGYGAHYFILSNFLPIAKQIGFEFSLSMIWFSYYLAIYT 60
           MA++L+WPWLGIAIPT LISFIGY AHYFIL + L    Q+ F+FSLSMIW SYYLAI  
Sbjct: 1   MAIQLKWPWLGIAIPTFLISFIGYSAHYFILLDHLSWKLQLWFQFSLSMIWLSYYLAIKA 60

Query: 61  NPGRP-LPNYQPTPGIWPNFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGN 119
           +PG P + +          +CKKC  YKP R+HHCKTCN+C+LMMDHHCPWTMNCVGF N
Sbjct: 61  DPGSPSIADKNEDIKTIRTYCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKN 120

Query: 120 YPHFLRFLFWIIITTSILFCIQVKRICFIWQRRNFPGYLFKKSELTFLTILSPXXXXXXX 179
           YPHFLRFLFW+I+TT+ L     +RI FIW        L ++ E+  LTIL+P       
Sbjct: 121 YPHFLRFLFWVIVTTAFLLAQLFRRIGFIWTNWYSSSALVQRQEIVMLTILTPMDAFILL 180

Query: 180 XXXXXXXRCLFNQIVNGRSQIESWDMDRLESLFDSRR-----LIQKLIYNTWRIYPESKT 234
                  RC  NQI +G SQIE W+M+RLES F SR+      +  LI N + I+     
Sbjct: 181 TITLLLIRCTMNQIFSGMSQIEKWEMERLESSFYSRKEKSRDFLMILINNVFTIFSIESP 240

Query: 235 LQHERDAEGLLKQ---QRSSFEGLVNFPYNFDLHTNAILYLGPVHLWLWPYGIPTGNGNN 291
             ++ +  GLL+Q   +R +F  ++NFPY+ D+ TNA   LGP   WL P+G P G+G +
Sbjct: 241 EDYQEEVNGLLRQHDKRRLAFHSIINFPYDIDILTNATCVLGPFFSWLNPFGAPEGDGMH 300

Query: 292 FPKNDISNYEVDSPLEDIILSLPWPPDGGETT--TVSNPKTSTIETCNEGGEQVVRSRVA 349
           F  N+I++ E  S L D++LSLPWPPD   +      +  T  +ET  EGGE V+R+R  
Sbjct: 301 FELNEIAS-EKASTLADLLLSLPWPPDTCTSKYGKSIDEGTKYVETHIEGGECVLRNRTV 359

Query: 350 Q--------NGRSASREKWFNDWGESLDDFGVDVDME 378
                    N    SR+ W N+WGE+L  FGVD++ E
Sbjct: 360 SPSFDLPTANENQLSRKSWTNEWGENLQAFGVDIEGE 396

>ACL003C Chr3 complement(352024..353151) [1128 bp, 375 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL003C
          Length = 375

 Score =  360 bits (924), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 183/378 (48%), Positives = 239/378 (63%), Gaps = 3/378 (0%)

Query: 1   MAVKLRWPWLGIAIPTLLISFIGYGAHYFILSNFLPIAKQIGFEFSLSMIWFSYYLAIYT 60
           MAV ++WPWLG+AIP  LISF GY AH+F+L+NFL   + + F+ SLSMIW SY+ AIY 
Sbjct: 1   MAVLVKWPWLGVAIPCFLISFTGYFAHFFVLTNFLSFKELLWFQVSLSMIWISYWKAIYK 60

Query: 61  NPGRPLPNYQPTPGIWPNFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNY 120
           NPGRP   ++P    W N+C KC+ YKPER+HHCK CNQCVL+MDHHCPWTMNC+G    
Sbjct: 61  NPGRPTKGFRPLRYEWQNYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGLQYL 120

Query: 121 PHFLRFLFWIIITTSILFCIQVKRICFIWQRRNFPGYLFKKSELTFLTILSPXXXXXXXX 180
                   WII TT IL    VKRI F W  R     L  K EL FLTIL+P        
Sbjct: 121 APQHSIFCWIIATTGILLHYFVKRIKFTWVNRYATANLVSKQELIFLTILTPLDAFILLT 180

Query: 181 XXXXXXRCLFNQIVNGRSQIESWDMDRLESLFDSRRLIQKLIYNTWRIYPESKTLQHERD 240
                 RC+ NQIVNGR+QIE+W+MDR+E+LF  +RL+ +L+ N   IYP S   Q E++
Sbjct: 181 ISLLFVRCVKNQIVNGRTQIEAWEMDRIENLFYHQRLLPQLLTNLKEIYPGSLEGQ-EKE 239

Query: 241 AEGLLKQQRSSFEGLVNFPYNFDLHTNAILYLGPVHLWLWPYGIPTGNGNNFPKNDISNY 300
            E  L     SF+ ++NFPY+ +   N +  +G    WL P+G P  +G  F KN+IS+Y
Sbjct: 240 VEEFLSSSTCSFDEVINFPYDINPWVNLLNCMGSPLNWLNPFGGPKADGMVFQKNEISDY 299

Query: 301 EVDSPLEDIILSLPWPPDGGETTTVSNPKTSTIETCNEGGEQVVRSRVAQNGRSASREKW 360
           +  + ++D +L+LPWPPD      ++ P  S +E   +GGEQVVR R         R +W
Sbjct: 300 DEATSIQDKLLALPWPPDDTR-HGIAFPSVSHVEKDTQGGEQVVRRRHVPIA-VPPRNEW 357

Query: 361 FNDWGESLDDFGVDVDME 378
           +NDWGESL+ FGVDV++E
Sbjct: 358 YNDWGESLEHFGVDVEVE 375

>KNAG0F02930 Chr6 complement(557052..558212) [1161 bp, 386 aa] {ON}
           Anc_6.28 YOL003C
          Length = 386

 Score =  357 bits (917), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 189/387 (48%), Positives = 241/387 (62%), Gaps = 18/387 (4%)

Query: 1   MAVKLRWPWLGIAIPTLLISFIGYGAHYFILSNFLPIAKQIGFEFSLSMIWFSYYLAIYT 60
           M V+L+ PW GIAIP  LI FIGY AH+FIL N L   +QI F+F L+MIW SYY+AIYT
Sbjct: 1   MPVQLKQPWHGIAIPCSLIFFIGYPAHWFILRNSLSNKRQIIFQFCLTMIWISYYMAIYT 60

Query: 61  NPGRPL--PNYQPTPGIWPNFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFG 118
           NPG+P      Q T G    +C KC  +KPERSHHCKTC QCVLMMDHHCPWTMNC+GFG
Sbjct: 61  NPGKPPHGSAQQHTDGDMNRYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFG 120

Query: 119 NYPHFLRFLFWIIITTSILFCIQVKRICFIWQRRNFP--GYLFKKS--ELTFLTILSPXX 174
           N+P F+RFL W+IITTS LF   + RI  IWQ RN P  G +   +  EL  L +L+P  
Sbjct: 121 NFPQFMRFLIWVIITTSQLFWYLLLRIAAIWQARNMPIKGGVVSTTTKELVSLVVLTPMD 180

Query: 175 XXXXXXXXXXXXRCLFNQIVNGRSQIESWDMDRLESLFDSRRLIQKLIYNTWRIYPESKT 234
                       RC+ NQ++ G +QIESW+M+RL+++F S++L+  +I   W  +P  +T
Sbjct: 181 LFVLFTITALFVRCVTNQVIGGMTQIESWEMERLQNMFYSKKLLPIMIERVWEKFPHEQT 240

Query: 235 LQHERDAEGLL---KQQRSSFEGLVNFPYNFDLHTNAILYLGPVHLWLWPYGIPTGNGNN 291
            +HE +AE LL   +Q    F  +VNFPY+ DL TN    LG   L LWP+    GNG  
Sbjct: 241 PEHELEAEKLLEMNEQGLLKFSSVVNFPYDVDLLTNIHQSLGSPMLLLWPFSTAQGNGVT 300

Query: 292 FPKNDISNYEVDSPLEDIILSLPWPPDGGETTTVSNPK----TSTIETCNEGGEQVVRSR 347
           F KNDIS YE +  + D++L L WPPDGG    + +P+       I+   E GE ++R R
Sbjct: 301 FQKNDISTYEDNLSISDLLLCLSWPPDGGR--RIPHPQREDGAHMIDQTVEDGEFMIRKR 358

Query: 348 VAQNGRSASREKWFNDWGESLDDFGVD 374
              N    SR  W N WGE+L+ FGVD
Sbjct: 359 ---NSPIESRTTWENQWGETLEGFGVD 382

>TBLA0B00480 Chr2 (93291..94424) [1134 bp, 377 aa] {ON} Anc_6.28
           YOL003C
          Length = 377

 Score =  178 bits (451), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 128/411 (31%), Positives = 197/411 (47%), Gaps = 70/411 (17%)

Query: 1   MAVKLRWPWLGIAIPTLLISFIGYGAHYFILSNFLPIAKQIGFEFSLSMIWFSYYLAIYT 60
           M ++   PW G+AIP+ +I  +   +++ IL + L   + I +  +  MI +SYYLAI T
Sbjct: 1   MVIEFSRPWYGVAIPSCIIFTLTTVSYFGILQDVLTTNQTIWYFTTAIMISYSYYLAIVT 60

Query: 61  NPGRPLPNYQPTPGIWPNFCKKCQNYKPE----------------RSHHCKTCNQCVLMM 104
            P  P P+      +  +F     N + +                R+HHCKTCN CV+MM
Sbjct: 61  -PPTPAPS-----TLTQSFISDVMNNENDIFPTTTCKKCKKIKLPRAHHCKTCNTCVVMM 114

Query: 105 DHHCPWTMNCVGFGNYPHFLRFLFWIIITTSILFCIQVKRICFIWQRRNFPGYLFK--KS 162
           DHHCPWTMNCVG+ NYPHF+RFL W+II+T+ L    +K+   ++  RN P +L++  K 
Sbjct: 115 DHHCPWTMNCVGYTNYPHFIRFLAWVIISTTNLLSQLIKQAYKLYIYRNSPFHLYQNVKY 174

Query: 163 ELTFLTILSPXXXXXXXXXXXXXXRCLFNQIVNGRSQIESWDMDRLES-LFDSRRLIQKL 221
           ++  LT+L P              + L NQI NG +QIE W  + +E+  F S+    K+
Sbjct: 175 KIIILTLLIPGTIFVWLTVLLLLLKTLQNQIWNGMTQIEYWQFEMIENKYFQSKS--SKV 232

Query: 222 IYNTWRIYPESKTLQHERDAEGLLKQQR------------SSFEGLVNFPYNFDLHTNAI 269
                 +         +   + + K Q+            +SF  ++NFPY+  L  N  
Sbjct: 233 ALQLQLLENLLNFYNKKLSTDSITKIQKLISSLQNGARWNTSFHSIINFPYDLGLSNNIT 292

Query: 270 LYLGPVH--LWLWPYGIP-TGNGNNFPKNDI-SNYEVDSPLEDIILSLPWPPDGGETTTV 325
             +G ++   W  P+  P T + N   +  I  + E    ++D++L LPWP +    +T 
Sbjct: 293 TTMGSLNPLSWFNPWYTPLTASYNKINEFAIWDDNETHDNIKDMLLCLPWPLNYSNNSTF 352

Query: 326 SNPKTSTIETCNEGGEQVVRSRVAQNGRSASREKWFNDWGESLDDFGVDVD 376
                       + GE VV+S               ND+GE+L DFGVD D
Sbjct: 353 ------------QDGELVVKS---------------NDYGETLQDFGVDYD 376

>TPHA0P01560 Chr16 (318550..319545) [996 bp, 331 aa] {ON} Anc_3.12
           YNL326C
          Length = 331

 Score = 80.5 bits (197), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 30/53 (56%), Positives = 38/53 (71%)

Query: 77  PNFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLRFLFW 129
           P  C+ C  +KP+RSHHC TCN+CVL MDHHCPW   C+GF N   F++FL +
Sbjct: 107 PRVCRTCNVWKPDRSHHCSTCNRCVLKMDHHCPWFSECIGFKNQKFFIQFLIY 159

>CAGL0D02508g Chr4 (256760..257758) [999 bp, 332 aa] {ON} similar to
           uniprot|P42836 Saccharomyces cerevisiae YNL326c
          Length = 332

 Score = 80.1 bits (196), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 42/128 (32%), Positives = 60/128 (46%), Gaps = 5/128 (3%)

Query: 80  CKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLRFLFWIIITTSILFC 139
           CK C ++KP+R HHC TCN CVL MDHHCPW   CVG+ N   F++FL +  +  SIL  
Sbjct: 106 CKSCSSWKPDRCHHCSTCNVCVLKMDHHCPWFAGCVGYRNQKFFIQFLIYCTV-YSILVL 164

Query: 140 IQVKRICFIWQRRNFPGYLFKKSELTFLTILSPXXXXXXXXXXXXXXRCLFNQIVNGRSQ 199
           I      + W    F G  F+   + F  +                     +Q+   ++ 
Sbjct: 165 ILSSMEIYTW----FKGEFFEVELINFTLLSLWLLALVVSISITIFTVFSISQVCQNQTT 220

Query: 200 IESWDMDR 207
           IE + + R
Sbjct: 221 IELYSLRR 228

>KLTH0F19580g Chr6 (1586776..1587804) [1029 bp, 342 aa] {ON} similar
           to uniprot|P42836 Saccharomyces cerevisiae YNL326C PFA3
           Palmitoyltransferase for Vac8p one of three yeast
           DHHC-cysteine rich domain proteins (Pfa3p Erf2p Akr1p)
           with palmitoyltransferase activity required for vacuolar
           integrity under stress conditions
          Length = 342

 Score = 80.1 bits (196), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 48/163 (29%), Positives = 74/163 (45%), Gaps = 29/163 (17%)

Query: 7   WPWLGIAIPTLLISF--IGYGAHYFILSNFLPIAKQIGFE-FSLSMIWFSYYLAIYTNPG 63
           W  +  A P  L  F  I  G+   +    LPI+  I      +S+  ++Y+  I T  G
Sbjct: 4   WSIITSAFPKCLTVFLFIYTGSVTVLDVRVLPISLTIAMAGLCMSLSLYTYFKVIRTGAG 63

Query: 64  RPL--PNYQ-------------PTPGIWPN-----------FCKKCQNYKPERSHHCKTC 97
            PL  P  +             P P +              FC+ C  +KP+R HHC  C
Sbjct: 64  SPLDFPELRIDNVDAADEGVELPPPFLSKRSVTLKRNGRFRFCRVCAVWKPDRCHHCSAC 123

Query: 98  NQCVLMMDHHCPWTMNCVGFGNYPHFLRFLFWIIITTSILFCI 140
            +C L MDHHCPW  +CVG+ N  +F++FL +  + + ++F +
Sbjct: 124 KKCFLKMDHHCPWFASCVGYANQKYFVQFLIYGTVFSILIFLL 166

>NDAI0G01340 Chr7 (301254..302261) [1008 bp, 335 aa] {ON} Anc_3.12
          Length = 335

 Score = 79.0 bits (193), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 29/54 (53%), Positives = 38/54 (70%)

Query: 79  FCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLRFLFWIII 132
            C+ CQ +KP+R HHC TCN+C+L MDHHCPW   C+GF N   F++FL +  I
Sbjct: 108 LCQTCQVWKPDRCHHCSTCNKCILKMDHHCPWFAECIGFKNQKFFIQFLIYCTI 161

>KAFR0A08590 Chr1 (1722408..1723403) [996 bp, 331 aa] {ON} Anc_3.12
           YNL326C
          Length = 331

 Score = 78.6 bits (192), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 38/50 (76%)

Query: 80  CKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLRFLFW 129
           C+ C  +KP+R HHC +CN+C+L MDHHCPW   C+GF N  +F++FLF+
Sbjct: 106 CQTCMFWKPDRCHHCSSCNRCILKMDHHCPWFAECIGFKNQKYFIQFLFY 155

>NCAS0E01300 Chr5 complement(250120..251103) [984 bp, 327 aa] {ON}
           Anc_3.12
          Length = 327

 Score = 78.2 bits (191), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 27/52 (51%), Positives = 38/52 (73%)

Query: 78  NFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLRFLFW 129
             C+ CQ +KP+R HHC TC++C+L MDHHCPW   C+GF N  +F++FL +
Sbjct: 99  RLCQTCQVWKPDRCHHCSTCDKCILKMDHHCPWFAECIGFENQKYFVQFLIY 150

>Kpol_1014.29 s1014 (48992..49972) [981 bp, 326 aa] {ON}
           (48992..49972) [981 nt, 327 aa]
          Length = 326

 Score = 78.2 bits (191), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 42/114 (36%), Positives = 57/114 (50%), Gaps = 28/114 (24%)

Query: 45  FSLSMIWFSYYLAIYTNPGRPLPNYQPT--------PGIW--PNF--------------- 79
           F LS+  ++YY  I   PG PL   Q T         GI   P+F               
Sbjct: 47  FVLSI--YTYYKVIIVGPGSPLDFGQLTVRNIKDAEDGIELPPDFLAQRSFTLKHDGRFR 104

Query: 80  -CKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLRFLFWIII 132
            C+ C  +KP+R HHC  C++C+L MDHHCPW   CVGF N  +F++FL +  +
Sbjct: 105 VCRTCNVWKPDRCHHCSACDKCILKMDHHCPWFAECVGFKNQKYFVQFLIYTTV 158

>TDEL0A00310 Chr1 complement(54006..54995) [990 bp, 329 aa] {ON}
           Anc_3.12 YNL326C
          Length = 329

 Score = 77.4 bits (189), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 38/55 (69%)

Query: 78  NFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLRFLFWIII 132
             C+ C  +KP+R HHC  CN+C+L MDHHCPW  +CVGF N  +F++FL +  +
Sbjct: 106 RLCRTCHVWKPDRCHHCSACNRCILRMDHHCPWLPDCVGFRNQKYFIQFLMYATL 160

>TBLA0H00150 Chr8 complement(13169..14206) [1038 bp, 345 aa] {ON}
           Anc_3.12 YNL326C
          Length = 345

 Score = 77.0 bits (188), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 40/140 (28%), Positives = 62/140 (44%), Gaps = 33/140 (23%)

Query: 39  KQIGFEFSLSMIW-------FSYYLAIYTNPGRPL--------------------PNYQP 71
           K I + F ++M+W       ++Y  A    PG P                     P Y  
Sbjct: 32  KWINYTFMITMLWSLYLIGYYAYVQAFMVGPGSPSDFPELRVNSIEAAEAGTEFPPEYLS 91

Query: 72  TPGIW------PNFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLR 125
              I          C+ C  +KP+R HHC +C++C+L MDHHCPW   C+GF N+ +F+ 
Sbjct: 92  QKSITLKHDGRARVCRTCLVWKPDRCHHCSSCDRCILKMDHHCPWFAECIGFKNHKYFIN 151

Query: 126 FLFWIIITTSILFCIQVKRI 145
           FL +  +  + +  I  K +
Sbjct: 152 FLIYNSLYATFVCLISSKEL 171

>SAKL0C13596g Chr3 (1198957..1199958) [1002 bp, 333 aa] {ON} similar
           to uniprot|P42836 Saccharomyces cerevisiae YNL326C PFA3
           Palmitoyltransferase for Vac8p one of three yeast
           DHHC-cysteine rich domain proteins (Pfa3p Erf2p Akr1p)
           with palmitoyltransferase activity required for vacuolar
           integrity under stress conditions
          Length = 333

 Score = 77.0 bits (188), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 38/50 (76%)

Query: 80  CKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLRFLFW 129
           C+ C+ +KP+RSHHC +CN+C L MDHHCPW  +C+GF N   F++FL +
Sbjct: 105 CRNCKVWKPDRSHHCSSCNKCFLKMDHHCPWFASCIGFKNQKLFIQFLLY 154

>Kwal_55.22126 s55 (1121936..1123018) [1083 bp, 360 aa] {ON} YNL326C
           - Hypothetical ORF [contig 124] FULL
          Length = 360

 Score = 76.3 bits (186), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 28/60 (46%), Positives = 40/60 (66%)

Query: 79  FCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLRFLFWIIITTSILF 138
           FC+ C  +KP+R HHC  CN+C L MDHHCPW  +CVG+ N  +F+ FL +    + ++F
Sbjct: 132 FCRTCVVWKPDRCHHCSGCNKCYLKMDHHCPWFASCVGYRNQKYFIHFLLYTTAYSILVF 191

>NCAS0B03590 Chr2 complement(636400..637389) [990 bp, 329 aa] {ON} 
          Length = 329

 Score = 75.9 bits (185), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 35/48 (72%)

Query: 80  CKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLRFL 127
           C+ CQ+YKP RS HC  C++CVL+ DHHC W  NCVG GNY +F  FL
Sbjct: 137 CRTCQSYKPARSKHCSICDRCVLVADHHCIWVNNCVGKGNYTYFYMFL 184

>SAKL0H16434g Chr8 complement(1447419..1449086) [1668 bp, 555 aa]
           {ON} similar to uniprot|Q04629 Saccharomyces cerevisiae
           YDR126W SWF1 Spore Wall Formation
          Length = 555

 Score = 76.6 bits (187), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 50/92 (54%), Gaps = 6/92 (6%)

Query: 80  CKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLRFLFWIIITTSILFC 139
           C+ C   KP RS HC  CN+C+LM+DHHC W  NC+G GNY +F  FL   +   S  F 
Sbjct: 132 CQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNVTLLSYSF- 190

Query: 140 IQVKRICFIWQRRNFPGYLFKKSELTFLTILS 171
           +++  I  + Q  N      K   +  LTIL+
Sbjct: 191 LRLTSIQLMSQTEN-----IKTKPMLVLTILT 217

>KLLA0E02069g Chr5 complement(195185..196162) [978 bp, 325 aa] {ON}
           weakly similar to uniprot|P42836 Saccharomyces
           cerevisiae YNL326C PFA3 Palmitoyltransferase for Vac8p
           one of three yeast DHHC-cysteine rich domain proteins
           (Pfa3p Erf2p Akr1p) with palmitoyltransferase activity
           required for vacuolar integrity under stress conditions
          Length = 325

 Score = 75.5 bits (184), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 28/54 (51%), Positives = 38/54 (70%)

Query: 79  FCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLRFLFWIII 132
           FC+ C+ +KP+R HHC  CN+C L MDHHCPW  +CVGF N   F++FL +  +
Sbjct: 104 FCQTCEIWKPDRCHHCSKCNKCFLKMDHHCPWFASCVGFRNQKFFVQFLAYTTV 157

>KNAG0K02570 Chr11 (511867..512853) [987 bp, 328 aa] {ON} Anc_3.12
           YNL326C
          Length = 328

 Score = 75.1 bits (183), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 37/50 (74%)

Query: 80  CKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLRFLFW 129
           C+ C+ +KP+R HHC +C++C+L MDHHCPW   CVGF N   F++FL +
Sbjct: 103 CQSCRYWKPDRCHHCSSCDRCILKMDHHCPWIAGCVGFRNQKLFIQFLLY 152

>ZYRO0C03410g Chr3 (265684..266667) [984 bp, 327 aa] {ON} similar to
           uniprot|P42836 Saccharomyces cerevisiae YNL326C PFA3
           Palmitoyltransferase for Vac8p one of three yeast
           DHHC-cysteine rich domain proteins (Pfa3p Erf2p Akr1p)
           with palmitoyltransferase activity required for vacuolar
           integrity under stress conditions
          Length = 327

 Score = 74.7 bits (182), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 56/120 (46%), Gaps = 26/120 (21%)

Query: 45  FSLSMIWFSYYLAIYTNPGRPL--------------------PNYQPTPGIWPN------ 78
           F +++  ++YY  I T PG PL                    P +     I         
Sbjct: 46  FLVAIGLYTYYKVIITGPGSPLDYDTIKVYDMQAVESGAELPPEFLSRRSITTKRDGRFR 105

Query: 79  FCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLRFLFWIIITTSILF 138
            C+ C  +KP+R HHC  C++C+L MDHHCPW   C+GF N   F+++L +    + ++F
Sbjct: 106 VCRTCHVWKPDRCHHCSRCDKCILKMDHHCPWFPGCIGFNNQRFFIQYLLYATTYSIVIF 165

>ZYRO0D06600g Chr4 complement(573724..574716) [993 bp, 330 aa] {ON}
           similar to uniprot|Q04629 Saccharomyces cerevisiae
           YDR126W SWF1 Spore Wall Formation
          Length = 330

 Score = 74.7 bits (182), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 36/53 (67%), Gaps = 1/53 (1%)

Query: 76  WPNF-CKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLRFL 127
           +PN  C+ CQ  KP RS HC  CNQCVL +DHHC W  NCVG GNY +F  FL
Sbjct: 130 YPNINCRTCQLPKPARSKHCNVCNQCVLAVDHHCIWINNCVGLGNYLYFYLFL 182

>Ecym_2014 Chr2 complement(19723..20742) [1020 bp, 339 aa] {ON}
           similar to Ashbya gossypii ADL197C
          Length = 339

 Score = 74.3 bits (181), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 47/76 (61%)

Query: 79  FCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLRFLFWIIITTSILF 138
           +C  C  +KP+RSHHC +CN+C L  DHHCPW  +C+GF N   F++FL +  + +  +F
Sbjct: 109 YCATCGVWKPDRSHHCSSCNKCYLKRDHHCPWFSSCIGFNNQKFFVQFLMYSTLYSISIF 168

Query: 139 CIQVKRICFIWQRRNF 154
                +I   ++ +N+
Sbjct: 169 IAATLQIVSWFRNQNY 184

>KAFR0B05370 Chr2 complement(1105534..1106523) [990 bp, 329 aa] {ON}
           Anc_8.286 YDR126W
          Length = 329

 Score = 73.9 bits (180), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 30/53 (56%), Positives = 36/53 (67%), Gaps = 1/53 (1%)

Query: 76  WPN-FCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLRFL 127
           +PN FC  C+  KP RS HC  CN+CVL+ DHHC W  NC+G GNY +F  FL
Sbjct: 132 YPNTFCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFL 184

>NCAS0C02920 Chr3 (549815..550939) [1125 bp, 374 aa] {ON} Anc_8.389
          Length = 374

 Score = 73.2 bits (178), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 33/72 (45%), Positives = 41/72 (56%)

Query: 66  LPNYQPTPGIWPNFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLR 125
           LP +     I   +CK C+ ++P RS HC  C  CVLM DHHC W  NCVG  NY +FL 
Sbjct: 170 LPTFHTDCNIVLKYCKTCRIWRPPRSSHCSICETCVLMHDHHCVWVNNCVGQRNYRYFLT 229

Query: 126 FLFWIIITTSIL 137
           FL    +T+  L
Sbjct: 230 FLTSSTLTSIFL 241

>KLLA0D18370g Chr4 complement(1549382..1550449) [1068 bp, 355 aa]
           {ON} similar to uniprot|Q6B217 Saccharomyces cerevisiae
           YLR246W ERF2 Subunit of a palmitoyltransferase composed
           of Erf2p and Shr5p that adds a palmitoyl lipid moiety to
           Ras2p through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 355

 Score = 72.4 bits (176), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 34/90 (37%), Positives = 47/90 (52%)

Query: 66  LPNYQPTPGIWPNFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLR 125
           LP   P   +   +C+ C+ ++P RS HC  C+ CVL  DHHC W  NC+G  NY  FL 
Sbjct: 160 LPTKNPNASVSMKYCQTCRIWRPPRSAHCSVCDVCVLSHDHHCKWLNNCIGKRNYRFFLE 219

Query: 126 FLFWIIITTSILFCIQVKRICFIWQRRNFP 155
           FL    I+  +L  +   R+ +  Q R  P
Sbjct: 220 FLMASTISCILLILLSSFRLSYSPQVRYTP 249

>KNAG0A02710 Chr1 (294783..295847) [1065 bp, 354 aa] {ON} Anc_8.389
           YLR246W
          Length = 354

 Score = 72.0 bits (175), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 41/73 (56%)

Query: 66  LPNYQPTPGIWPNFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLR 125
           LP  Q +  +   +C  C+ ++P R+ HC+ C  CV   DHHC W  NCVG  NY +FL 
Sbjct: 172 LPTAQRSAHVEVKYCTACKIWRPPRASHCRICQVCVQTQDHHCAWINNCVGQRNYRYFLT 231

Query: 126 FLFWIIITTSILF 138
           FL     T ++LF
Sbjct: 232 FLTATCATCTVLF 244

>Smik_12.306 Chr12 (568353..569432) [1080 bp, 359 aa] {ON} YLR246W
           (REAL)
          Length = 359

 Score = 72.0 bits (175), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 29/62 (46%), Positives = 40/62 (64%)

Query: 78  NFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLRFLFWIIITTSIL 137
            +C+ C+ ++P RS HC TCN CV++ DHHC W  NC+G  NY  FL FL   +I++ IL
Sbjct: 173 KYCQSCRIWRPPRSSHCSTCNVCVMVHDHHCIWVNNCIGKRNYRFFLVFLLSAVISSIIL 232

Query: 138 FC 139
             
Sbjct: 233 LA 234

>CAGL0B01991g Chr2 (182894..183886) [993 bp, 330 aa] {ON} similar to
           uniprot|Q04629 Saccharomyces cerevisiae YDR126w
          Length = 330

 Score = 71.6 bits (174), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 31/48 (64%)

Query: 80  CKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLRFL 127
           C+ C+  KP RS HC  CN C+ + DHHC W  NCVG GNY +F  FL
Sbjct: 136 CRTCKQVKPARSKHCTVCNSCIYLADHHCVWINNCVGMGNYMYFYSFL 183

>Skud_14.15 Chr14 complement(20841..21851) [1011 bp, 336 aa] {ON}
           YNL326C (REAL)
          Length = 336

 Score = 71.6 bits (174), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 36/110 (32%), Positives = 50/110 (45%), Gaps = 26/110 (23%)

Query: 46  SLSMIWFSYYLAIYTNPGRPL--------------------PNYQPTPGIWPN------F 79
           +L +  ++YY  I T PG PL                    P Y     +          
Sbjct: 46  TLMVALYTYYKVISTGPGSPLDFPDLLVHDLKAAENGLELPPEYMSKRCMTLKRDGRFRV 105

Query: 80  CKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLRFLFW 129
           C+ C  +KP+R HHC +C+ C+L MDHHCPW   C GF N   F++FL +
Sbjct: 106 CQICHVWKPDRCHHCSSCDICILKMDHHCPWFAECTGFKNQKFFIQFLMY 155

>Skud_4.387 Chr4 (675002..676012) [1011 bp, 336 aa] {ON} YDR126W
           (REAL)
          Length = 336

 Score = 71.6 bits (174), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 40/69 (57%), Gaps = 4/69 (5%)

Query: 80  CKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLRFLFWIIITTSILFC 139
           C  C+  KP RS HC  CN+C+L+ DHHC W  NC+G GNY  F  FL   I++ S  F 
Sbjct: 136 CSTCRITKPARSRHCSICNRCILVADHHCIWVNNCIGKGNYIQFYLFLISNIVSMSYAFL 195

Query: 140 IQVKRICFI 148
               R+C I
Sbjct: 196 ----RLCSI 200

>YNL326C Chr14 complement(27337..28347) [1011 bp, 336 aa] {ON}
           PFA3Palmitoyltransferase for Vac8p, required for
           vacuolar membrane fusion; contains an
           Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain;
           autoacylates; required for vacuolar integrity under
           stress conditions
          Length = 336

 Score = 71.2 bits (173), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 35/113 (30%), Positives = 51/113 (45%), Gaps = 26/113 (23%)

Query: 46  SLSMIWFSYYLAIYTNPGRPL--------------------PNYQPTPGIWPN------F 79
           +L++  ++YY  I   PG PL                    P Y     +          
Sbjct: 46  TLAVALYTYYKVIARGPGSPLDFPDLLVHDLKAAENGLELPPEYMSKRCLTLKHDGRFRV 105

Query: 80  CKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLRFLFWIII 132
           C+ C  +KP+R HHC +C+ C+L MDHHCPW   C GF N   F++FL +  +
Sbjct: 106 CQVCHVWKPDRCHHCSSCDVCILKMDHHCPWFAECTGFRNQKFFIQFLMYTTL 158

>ADL197C Chr4 complement(350991..352163) [1173 bp, 390 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL326C
          Length = 390

 Score = 71.6 bits (174), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 37/120 (30%), Positives = 55/120 (45%), Gaps = 33/120 (27%)

Query: 49  MIWFSYYLAIYTNPGRPL--------------------PNYQPTPGIWPN------FCKK 82
           +I ++Y+  I   PG PL                    P++     +  +      +C K
Sbjct: 114 LILYAYFSTIAVGPGSPLDFEELRIRDLNDVETGMEFPPDFLAAKTVTLDSTGRHRYCVK 173

Query: 83  CQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLRFL-------FWIIITTS 135
           C+ +KP+R HHC  C++C L  DHHC W   C+G+ N+  FL FL       FWI I T+
Sbjct: 174 CKVWKPDRCHHCSACDKCYLRRDHHCVWFPGCIGYNNHKFFLHFLLYASVYAFWICIITT 233

>TPHA0C01070 Chr3 complement(244556..245557) [1002 bp, 333 aa] {ON}
           Anc_8.286 YDR126W
          Length = 333

 Score = 70.9 bits (172), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 29/61 (47%), Positives = 34/61 (55%)

Query: 78  NFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLRFLFWIIITTSIL 137
           N C  C   KP RS HC  C  C+L+ DHHC W  NC+G GNY +F  FL    I+ S  
Sbjct: 137 NVCSTCNIEKPARSKHCNICGTCILLQDHHCIWVNNCIGLGNYKYFFMFLLLNTISLSYA 196

Query: 138 F 138
           F
Sbjct: 197 F 197

>TBLA0D04040 Chr4 complement(1006179..1007168) [990 bp, 329 aa] {ON}
           Anc_8.286 YDR126W
          Length = 329

 Score = 70.9 bits (172), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 34/49 (69%)

Query: 80  CKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLRFLF 128
           CK C+  KP RS HC  C+QC+L+ DHHC W  NC+G GN+ +F  FLF
Sbjct: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGNFLYFYLFLF 185

>Suva_2.289 Chr2 (498420..499427) [1008 bp, 335 aa] {ON} YDR126W
           (REAL)
          Length = 335

 Score = 70.9 bits (172), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 30/59 (50%), Positives = 35/59 (59%)

Query: 80  CKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLRFLFWIIITTSILF 138
           C  C+  K  RS HC  CN+CVL+ DHHC W  NC+G GNY  F  FLF  I + S  F
Sbjct: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFSMSYAF 194

>Smik_14.6 Chr14 complement(11864..12868) [1005 bp, 334 aa] {ON}
           YNL326C (REAL)
          Length = 334

 Score = 70.5 bits (171), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 34/50 (68%)

Query: 80  CKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLRFLFW 129
           C+ C  +KP+R HHC +C+ CVL MDHHCPW   C GF N   F++FL +
Sbjct: 106 CQVCHVWKPDRCHHCSSCDICVLKMDHHCPWFAECTGFKNQKFFIQFLMY 155

>Suva_14.15 Chr14 complement(23560..24552) [993 bp, 330 aa] {ON}
           YNL326C (REAL)
          Length = 330

 Score = 70.5 bits (171), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 34/50 (68%)

Query: 80  CKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLRFLFW 129
           C+ C  +KP+R HHC +C+ C+L MDHHCPW   C GF N   F++FL +
Sbjct: 106 CQICHVWKPDRCHHCSSCDMCILKMDHHCPWFAECTGFKNQKLFIQFLMY 155

>YLR246W Chr12 (627118..628197) [1080 bp, 359 aa] {ON}  ERF2Subunit
           of a palmitoyltransferase, composed of Erf2p and Shr5p,
           that adds a palmitoyl lipid moiety to heterolipidated
           substrates such as Ras1p and Ras2p through a thioester
           linkage; mutants partially mislocalize Ras2p to the
           vacuole
          Length = 359

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 29/61 (47%), Positives = 39/61 (63%)

Query: 78  NFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLRFLFWIIITTSIL 137
            +C  C+ ++P RS HC TCN CV++ DHHC W  NC+G  NY  FL FL   I+++ IL
Sbjct: 173 KYCPSCRIWRPPRSSHCSTCNVCVMVHDHHCIWVNNCIGKRNYRFFLIFLLGAILSSVIL 232

Query: 138 F 138
            
Sbjct: 233 L 233

>Ecym_4178 Chr4 (375346..376452) [1107 bp, 368 aa] {ON} similar to
           Ashbya gossypii AGL125C
          Length = 368

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 43/72 (59%)

Query: 66  LPNYQPTPGIWPNFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLR 125
           LP+      I   +C  C+ ++P R+ HC TCN C++  DHHC W  NCVG  NY +FL 
Sbjct: 175 LPSSSTNSPIQLKYCTTCRIWRPLRASHCSTCNSCIMTFDHHCIWVNNCVGQRNYRYFLT 234

Query: 126 FLFWIIITTSIL 137
           F++  ++T  +L
Sbjct: 235 FIYSAVLTIILL 246

>NDAI0J01000 Chr10 (229188..230207) [1020 bp, 339 aa] {ON} Anc_8.286
           YDR126W
          Length = 339

 Score = 69.7 bits (169), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 39/64 (60%), Gaps = 1/64 (1%)

Query: 76  WPNF-CKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLRFLFWIIITT 134
           +PN  C+ C   KP RS HC+ CN C+L+ DHHC W  NC+G GNY +F  FL    IT 
Sbjct: 134 YPNIECRTCGIVKPARSKHCEICNSCILLCDHHCLWVNNCIGEGNYLYFYSFLLCNCITM 193

Query: 135 SILF 138
           +  F
Sbjct: 194 TYSF 197

>TDEL0F04130 Chr6 (759451..760437) [987 bp, 328 aa] {ON} Anc_8.286
           YDR126W
          Length = 328

 Score = 69.3 bits (168), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 37/61 (60%), Gaps = 1/61 (1%)

Query: 76  WPNF-CKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLRFLFWIIITT 134
           +PN  C+ C   KP RS HC  C +CVL+ DHHC W  NC+G GNY  F  FL   +I+ 
Sbjct: 133 YPNVQCRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVISL 192

Query: 135 S 135
           S
Sbjct: 193 S 193

>Skud_12.321 Chr12 (571368..572438) [1071 bp, 356 aa] {ON} YLR246W
           (REAL)
          Length = 356

 Score = 68.6 bits (166), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 28/61 (45%), Positives = 38/61 (62%)

Query: 78  NFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLRFLFWIIITTSIL 137
            +C+ C+ ++P R+ HC TCN CV++ DHHC W  NCVG  NY  FL FL   I ++  L
Sbjct: 173 KYCQSCRIWRPPRTSHCSTCNVCVMVHDHHCVWVNNCVGKRNYRFFLIFLLSAIFSSVFL 232

Query: 138 F 138
            
Sbjct: 233 L 233

>SAKL0H13860g Chr8 (1185970..1187028) [1059 bp, 352 aa] {ON} similar
           to uniprot|Q6B217 Saccharomyces cerevisiae YLR246W ERF2
           Subunit of a palmitoyltransferase composed of Erf2p and
           Shr5p that adds a palmitoyl lipid moiety to Ras2p
           through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 352

 Score = 68.2 bits (165), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 47/94 (50%), Gaps = 8/94 (8%)

Query: 54  YYLAIYTNPGRPLPNYQPTPGIWPNFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMN 113
           YY  I    G PL        I   +C  C+ ++P R+ HC TC  C++  DHHC W  N
Sbjct: 151 YYNMITLPTGNPL-----IANIEVKYCTTCRIWRPPRASHCSTCEACIITHDHHCKWVNN 205

Query: 114 CVGFGNYPHFLRFLFWIIITTSILF---CIQVKR 144
           C+G  NY +F  FL   +I T+ +     I+V R
Sbjct: 206 CIGQRNYHYFFTFLVSCVIATAFIIANCAIRVSR 239

>YDR126W Chr4 (703234..704244) [1011 bp, 336 aa] {ON}
           SWF1Palmitoyltransferase that acts on transmembrane
           proteins, including the SNAREs Snc1p, Syn8p, Tlg1p and
           likely all SNAREs; contains an Asp-His-His-Cys-cysteine
           rich (DHHC-CRD) domain; may have a role in vacuole
           fusion
          Length = 336

 Score = 68.2 bits (165), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 31/48 (64%)

Query: 80  CKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLRFL 127
           C  C+  KP RS HC  CN+CVL+ DHHC W  NC+G GNY  F  FL
Sbjct: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFL 183

>Suva_10.342 Chr10 (593959..595029) [1071 bp, 356 aa] {ON} YLR246W
           (REAL)
          Length = 356

 Score = 68.2 bits (165), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 28/61 (45%), Positives = 38/61 (62%)

Query: 78  NFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLRFLFWIIITTSIL 137
            +C  C+ ++P RS HC TCN CV++ DHHC W  NC+G  NY  FL FL   I ++ +L
Sbjct: 173 KYCTSCRIWRPPRSSHCSTCNICVMVHDHHCIWVNNCIGKRNYRFFLIFLLSAIFSSILL 232

Query: 138 F 138
            
Sbjct: 233 L 233

>KLTH0F08668g Chr6 (750644..751720) [1077 bp, 358 aa] {ON} similar
           to uniprot|Q6B217 Saccharomyces cerevisiae YLR246W ERF2
           Subunit of a palmitoyltransferase composed of Erf2p and
           Shr5p that adds a palmitoyl lipid moiety to Ras2p
           through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 358

 Score = 67.8 bits (164), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 50/97 (51%), Gaps = 10/97 (10%)

Query: 41  IGFEFSLSMIWFSYYLAIYTNPGRPLPNYQPT-PGIWPNFCKKCQNYKPERSHHCKTCNQ 99
           +G EF L     SYY  I       LP+  P    +   +C  C+ ++P R+ HC TC  
Sbjct: 147 VGEEFQLPR---SYYNII------TLPSAHPEGKTVDVKYCATCRIWRPPRASHCSTCEA 197

Query: 100 CVLMMDHHCPWTMNCVGFGNYPHFLRFLFWIIITTSI 136
           CVL  DHHC W  NC+G  NY +FL FL    + T++
Sbjct: 198 CVLTHDHHCTWVNNCIGQRNYRYFLTFLASCCLATTL 234

>TDEL0F05130 Chr6 complement(961887..962966) [1080 bp, 359 aa] {ON}
           Anc_8.389 YLR246W
          Length = 359

 Score = 67.4 bits (163), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 39/73 (53%)

Query: 65  PLPNYQPTPGIWPNFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFL 124
           P  N  P   I   +C  C+ ++P R+ HC TC  CV+  DHHC W  NCVG  NY +F+
Sbjct: 166 PKSNVDPLSKIDIRYCTSCRIWRPPRASHCSTCGVCVMTHDHHCIWVNNCVGQRNYRYFI 225

Query: 125 RFLFWIIITTSIL 137
            FL   ++    L
Sbjct: 226 IFLIGTVLAELFL 238

>Kpol_1033.16 s1033 (35544..36509) [966 bp, 321 aa] {ON}
           (35544..36509) [966 nt, 322 aa]
          Length = 321

 Score = 67.0 bits (162), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 32/48 (66%)

Query: 80  CKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLRFL 127
           CK C+  KP RS HC  C++C+L+ DHHC W  NC+G GNY  F  F+
Sbjct: 135 CKTCRKPKPARSKHCSICDKCILLQDHHCIWVNNCIGMGNYKWFYLFI 182

>Smik_4.372 Chr4 (664437..665444) [1008 bp, 335 aa] {ON} YDR126W
           (REAL)
          Length = 335

 Score = 67.0 bits (162), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 30/48 (62%)

Query: 80  CKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLRFL 127
           C  C   KP RS HC  CN+C+L+ DHHC W  NC+G GNY  F  FL
Sbjct: 136 CSTCHIIKPARSKHCSICNRCILVADHHCIWVNNCIGKGNYLQFYLFL 183

>KLLA0F19690g Chr6 (1820355..1821329) [975 bp, 324 aa] {ON} similar
           to uniprot|Q04629 Saccharomyces cerevisiae YDR126W SWF1
           Spore Wall Formation
          Length = 324

 Score = 67.0 bits (162), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 55/108 (50%), Gaps = 4/108 (3%)

Query: 67  PNYQPTPGIW--PNFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFL 124
           P +QP   I+     C+ C+  K  RS HC  C +C+ + DHHC W  NCVG+GNY +F 
Sbjct: 114 PQFQPDYIIFHPSAVCQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFY 173

Query: 125 RFLF--WIIITTSILFCIQVKRICFIWQRRNFPGYLFKKSELTFLTIL 170
            FL    +++T + L  + + RI    + + F       +  + + I+
Sbjct: 174 SFLLSNCLLLTYASLRLLTLFRITAFKKDKFFLSLFLLTTAFSLIAIV 221

>TPHA0C02360 Chr3 (531446..532660) [1215 bp, 404 aa] {ON} Anc_8.389
           YLR246W
          Length = 404

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 42/73 (57%)

Query: 66  LPNYQPTPGIWPNFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLR 125
           LP    +  +   +C+ C+ ++P RS HC  C+ CV+ +DHHC W  NCVG  NY +FL 
Sbjct: 182 LPIKDESQYVEITYCRTCRIWRPPRSSHCSICDCCVMSLDHHCLWLNNCVGKRNYRYFLI 241

Query: 126 FLFWIIITTSILF 138
           FL   I+T   L 
Sbjct: 242 FLTSTIMTVIFLL 254

>ZYRO0C04092g Chr3 complement(320634..321734) [1101 bp, 366 aa] {ON}
           similar to uniprot|Q6B217 Saccharomyces cerevisiae
           YLR246W ERF2 Subunit of a palmitoyltransferase composed
           of Erf2p and Shr5p that adds a palmitoyl lipid moiety to
           Ras2p through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 366

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 45/79 (56%), Gaps = 3/79 (3%)

Query: 78  NFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLRFLFWIIITTSIL 137
            +C  C+ ++P R+ HC TC  C+L  DHHC W  NC+G  NY +F+ FL   I+++  +
Sbjct: 179 KYCTSCRIWRPPRASHCSTCEACILTHDHHCIWVNNCIGQRNYRYFILFLASAILSS--I 236

Query: 138 FCIQVKRICFIWQRRNFPG 156
           F I    I  I+  RN P 
Sbjct: 237 FLIANCSI-HIYHHRNLPS 254

>NDAI0G02250 Chr7 (503564..504733) [1170 bp, 389 aa] {ON} Anc_8.389
          Length = 389

 Score = 66.2 bits (160), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 31/78 (39%), Positives = 40/78 (51%), Gaps = 7/78 (8%)

Query: 66  LPNYQPTPGIWPNFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLR 125
           LP   P   I   +C  C+ ++P RS HC  C  C++  DHHC W  NC+G  NY  FL 
Sbjct: 203 LPTGNPESTINIKYCTTCRIWRPPRSSHCSICEACIITHDHHCIWVNNCIGQRNYRFFLT 262

Query: 126 FLF-------WIIITTSI 136
           FL        ++II  SI
Sbjct: 263 FLLSGTFTSIFLIINASI 280

>TBLA0H00920 Chr8 (203681..204763) [1083 bp, 360 aa] {ON} Anc_8.389
           YLR246W
          Length = 360

 Score = 65.1 bits (157), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 48/90 (53%), Gaps = 4/90 (4%)

Query: 59  YTNPGRPLPNYQPTPGIWPNFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFG 118
           YTN  R LP       I   +C  C  ++P R+ HC  C  C+ + DHHC W  NCVG  
Sbjct: 170 YTNTIR-LPVANKNHSIELKYCSTCHIWRPPRASHCSICQACIDVHDHHCIWINNCVGNR 228

Query: 119 NYPHFLRFLFWIIITT--SILFC-IQVKRI 145
           NY +F+ FL   I+++   I+ C I V RI
Sbjct: 229 NYRYFIIFLVGAILSSIFIIINCSIHVARI 258

>Ecym_4282 Chr4 complement(608898..609920) [1023 bp, 340 aa] {ON}
           similar to Ashbya gossypii AGR065W
          Length = 340

 Score = 64.7 bits (156), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 24/49 (48%), Positives = 31/49 (63%)

Query: 80  CKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLRFLF 128
           C+ C+  K  RS HC  C +C+L+ DHHC W  NC+G GNY +F  FL 
Sbjct: 133 CRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLL 181

>AGL125C Chr7 complement(473496..474599) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR246W
           (ERF2)
          Length = 367

 Score = 64.7 bits (156), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 46/79 (58%), Gaps = 1/79 (1%)

Query: 66  LPNYQPTPGIWPNFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLR 125
           LP+      +   +C  C+ ++P R+ HC  C+ C+L  DHHC W  NC+G  N+ +FL 
Sbjct: 173 LPSPVANAPVRLKYCTTCRIWRPPRASHCAVCDSCILSFDHHCDWLNNCIGQRNHRYFLA 232

Query: 126 FLFWIIITTS-ILFCIQVK 143
           FLF  ++++  +L C  +K
Sbjct: 233 FLFSSVLSSIWLLTCCALK 251

>Kwal_23.3302 s23 (234749..235810) [1062 bp, 353 aa] {ON} YLR246W
           (ERF2) - Mutation has an Effect on Ras Function [contig
           251] FULL
          Length = 353

 Score = 64.7 bits (156), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 26/64 (40%), Positives = 36/64 (56%), Gaps = 2/64 (3%)

Query: 78  NFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLRFLF--WIIITTS 135
            +C  C+ ++P R+ HC  C  C+L  DHHC W  NC+G  NY +FL FL   W+     
Sbjct: 171 KYCPTCRIWRPPRASHCSVCGACILNHDHHCKWVNNCIGQRNYRYFLTFLVSSWLTAVIC 230

Query: 136 ILFC 139
           I+ C
Sbjct: 231 IVSC 234

>TBLA0E02830 Chr5 (700364..701524) [1161 bp, 386 aa] {ON} Anc_5.579
           YDR459C
          Length = 386

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 53/105 (50%), Gaps = 1/105 (0%)

Query: 65  PLPNYQPTPGIWPNFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFL 124
           P   YQ  P  +P +C +CQ+ K ER+HH      CV   DH+C W    +G  NY  FL
Sbjct: 108 PPITYQCDPHGYPFWCSECQSLKLERTHHSSAMGHCVPRFDHYCVWVGTVIGKDNYLLFL 167

Query: 125 RFLFWIIITTSILFCIQVKRICFIWQRR-NFPGYLFKKSELTFLT 168
           +F+ +  I  SI++   V  I  I ++R N P + F  + +  L 
Sbjct: 168 QFVAYYAINLSIIWVSIVSYIHMIIRKRPNQPHHHFNTNLIIILV 212

>CAGL0G08217g Chr7 complement(778823..779803) [981 bp, 326 aa] {ON}
           similar to uniprot|Q06551 Saccharomyces cerevisiae
           YLR246w ERF2
          Length = 326

 Score = 63.5 bits (153), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 35/60 (58%)

Query: 78  NFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLRFLFWIIITTSIL 137
            +C  C+ ++P R+ HC  C  CVL  DHHC W  NCVG  NY +FL FL    +  ++L
Sbjct: 158 KYCHTCKIWRPPRASHCSVCECCVLTHDHHCIWVNNCVGQRNYRYFLAFLLSSTLACALL 217

>KLTH0G13112g Chr7 complement(1129318..1130367) [1050 bp, 349 aa]
           {ON} similar to uniprot|Q04629 Saccharomyces cerevisiae
           YDR126W SWF1 Spore Wall Formation
          Length = 349

 Score = 63.2 bits (152), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 41/134 (30%), Positives = 56/134 (41%), Gaps = 12/134 (8%)

Query: 6   RWPWLGIAIPTLLISFIGYGAHYF-------ILSNFLPIAKQIGFEFSLSMIWFSYYLAI 58
           R+ W   AIP   +S   Y    F       I S    + + +    +LS    +  L I
Sbjct: 47  RFRWKFRAIPAFYLSIYAYCTFLFFKDIEGLIRSRLFGVERLLIIPVALSAPIITGLLTI 106

Query: 59  YTNPGRP-----LPNYQPTPGIWPNFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMN 113
           +  P        L  Y          C+ C+  K  R+ HC  C+QCV + DHHC W  N
Sbjct: 107 WIKPKSTYASPMLDAYDELIFHSGVSCRTCKLPKFARTKHCPICDQCVQLADHHCVWANN 166

Query: 114 CVGFGNYPHFLRFL 127
           C+G GNY +F  FL
Sbjct: 167 CIGRGNYQYFYLFL 180

>KAFR0H01980 Chr8 (367846..368931) [1086 bp, 361 aa] {ON} Anc_8.389
           YLR246W
          Length = 361

 Score = 62.8 bits (151), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 33/54 (61%)

Query: 74  GIWPNFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLRFL 127
            I   +C+ C+ ++P R+ HC  C  CV+  DHHC W  NCVG  NY +F+ FL
Sbjct: 172 SILMKYCRTCRIWRPPRASHCSICEACVMTHDHHCIWINNCVGQRNYRYFVTFL 225

>AGR065W Chr7 (835871..836851) [981 bp, 326 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR126W (SWF1)
          Length = 326

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 24/44 (54%), Positives = 28/44 (63%)

Query: 80  CKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHF 123
           C+ C+  KP RS HC  C +CV + DHHC W  NCVG GNY  F
Sbjct: 126 CRTCRVRKPARSRHCGVCGRCVPLADHHCVWLNNCVGRGNYGLF 169

>Kwal_56.23697 s56 complement(665965..666981) [1017 bp, 338 aa] {ON}
           YDR126W (PSL10) - Hypothetical ORF [contig 174] FULL
          Length = 338

 Score = 60.1 bits (144), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 23/48 (47%), Positives = 29/48 (60%)

Query: 80  CKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLRFL 127
           C+ C+  K  RS HC  C +C  + DHHC W  NC+G GNY +F  FL
Sbjct: 131 CRTCKMPKYARSKHCAICGRCTQLADHHCVWANNCIGKGNYEYFYLFL 178

>KAFR0I01110 Chr9 (214426..215538) [1113 bp, 370 aa] {ON} Anc_5.579
           YDR459C
          Length = 370

 Score = 59.7 bits (143), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 48/97 (49%), Gaps = 4/97 (4%)

Query: 60  TNPGRPLPN--YQPTPGIWPNFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGF 117
           T P   +P   YQ     +P +C  C+  K  RSHH    N C+   DH+C W    +G 
Sbjct: 97  TQPTSTVPAKLYQCDSNGYPRWCSNCEGLKSLRSHHSSVANYCIPRFDHYCIWLGTTIGK 156

Query: 118 GNYPHFLRFLFWIIITTSILFCIQVKRICFIWQRRNF 154
            NY  F+ FLF+  ++  I++   +  +C++   R++
Sbjct: 157 DNYKQFVIFLFYCTVSFGIMWISAI--VCYLKYGRHY 191

>Ecym_4114 Chr4 complement(238112..239230) [1119 bp, 372 aa] {ON}
           similar to Ashbya gossypii ABR203W
          Length = 372

 Score = 58.9 bits (141), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 44/80 (55%), Gaps = 3/80 (3%)

Query: 69  YQPTPGIWPNFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLRFLF 128
           YQ  P  +P +C  CQ+ K ERSHH +    CV   DH+C W    +G  NY  F++++ 
Sbjct: 116 YQCDPQGYPMWCSTCQSLKIERSHHSELLKYCVPRFDHYCVWLGTVIGRKNYKLFMQYVM 175

Query: 129 WI---IITTSILFCIQVKRI 145
           +    ++T S+   + +KRI
Sbjct: 176 YFTIYLVTASLTIALFMKRI 195

>KNAG0H03110 Chr8 complement(584877..585872) [996 bp, 331 aa] {ON}
           Anc_8.286 YDR126W
          Length = 331

 Score = 58.5 bits (140), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 43/93 (46%), Gaps = 12/93 (12%)

Query: 47  LSMIWFSYYLAIYTNP---GRPLPNYQPTPGIWP---------NFCKKCQNYKPERSHHC 94
           L+ I  S  L ++T P   G       P+ G WP           C+ C   K  RS HC
Sbjct: 94  LAAIPVSGLLTMFTRPEGCGGRDQGVAPSEGQWPYDGILYYPNTTCRSCHTVKWARSKHC 153

Query: 95  KTCNQCVLMMDHHCPWTMNCVGFGNYPHFLRFL 127
             C +C+ + DHHC W   C+G GN+ +F  FL
Sbjct: 154 SICRRCIQLADHHCIWFNTCIGRGNFFYFYVFL 186

>Skud_4.734 Chr4 complement(1302386..1303528) [1143 bp, 380 aa] {ON}
           YDR459C (REAL)
          Length = 380

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 45/96 (46%), Gaps = 8/96 (8%)

Query: 65  PLPNYQPTPGIWPNFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFL 124
           P   YQ  P  +P +C  CQ+ K ER+HH      CV   DH+C W    +G  NY  F+
Sbjct: 117 PPKCYQSDPHGYPIWCSPCQSLKTERTHHSSELGHCVPRFDHYCMWAGTVIGRDNYRLFV 176

Query: 125 RFLFWIIITTSILFCIQVKRICF----IWQRRNFPG 156
           +F+ +     SIL  I    IC     I QR +  G
Sbjct: 177 QFVAYF----SILLLIMWASICVYTKEITQRHHSQG 208

>KLTH0G04972g Chr7 complement(404787..405890) [1104 bp, 367 aa] {ON}
           similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459C likely functions in pathway(s) outside Ras
          Length = 367

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 37/70 (52%), Gaps = 3/70 (4%)

Query: 60  TNPGRPLPNYQPTPGIWPNFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGN 119
           TNP R    YQ  P  +P +C  CQ+ K  R+HH  T   C+   DH+C W    VG  N
Sbjct: 115 TNPPRI---YQCDPQGYPIWCTACQSIKANRTHHSSTLGYCIPRFDHYCVWIGTVVGRKN 171

Query: 120 YPHFLRFLFW 129
           Y  F++F F+
Sbjct: 172 YRLFVQFAFY 181

>KNAG0C02830 Chr3 complement(563740..564804) [1065 bp, 354 aa] {ON}
           Anc_5.579 YDR459C
          Length = 354

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 39/74 (52%), Gaps = 2/74 (2%)

Query: 59  YTNP--GRPLPNYQPTPGIWPNFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVG 116
           +T+P   +P   YQ     +P +C  CQ+ K  R+HH      CV   DH+C W    +G
Sbjct: 103 FTSPQVNKPPLIYQCDENGYPTWCAHCQSVKSLRTHHSGRTGSCVFKFDHYCGWLGTLIG 162

Query: 117 FGNYPHFLRFLFWI 130
            GNY  F++FL ++
Sbjct: 163 AGNYLLFIQFLVYM 176

>Kwal_47.18366 s47 (796220..797290) [1071 bp, 356 aa] {ON} YDR459C -
           Hypothetical ORF [contig 196] FULL
          Length = 356

 Score = 56.2 bits (134), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 36/70 (51%)

Query: 60  TNPGRPLPNYQPTPGIWPNFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGN 119
           T   +P   YQ  P  +P +C  CQ+ K  R+HH  T   C+   DH+C W    VG  N
Sbjct: 105 TRSIKPPRIYQCDPQGYPIWCTACQSLKSNRTHHSSTLGYCIPRFDHYCVWIGTIVGRKN 164

Query: 120 YPHFLRFLFW 129
           Y  F++F F+
Sbjct: 165 YRLFVQFAFY 174

>NDAI0H01890 Chr8 complement(458111..459331) [1221 bp, 406 aa] {ON}
           Anc_5.579 YDR459C
          Length = 406

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 36/66 (54%)

Query: 64  RPLPNYQPTPGIWPNFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHF 123
           +P   YQ  P  +P +C  CQ+ K ER HH +    C+   DH+C W    +G  NY  F
Sbjct: 101 KPPLYYQCDPNGYPIWCTYCQSLKLERVHHSRQLGYCIFRFDHYCAWIGTVIGRNNYRLF 160

Query: 124 LRFLFW 129
           ++++F+
Sbjct: 161 IQYVFY 166

>NCAS0F01390 Chr6 complement(275879..277003) [1125 bp, 374 aa] {ON}
           Anc_5.579 YDR459C
          Length = 374

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 35/66 (53%)

Query: 64  RPLPNYQPTPGIWPNFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHF 123
           +P   YQ     +P +C  CQ+ K  RSHH K   +C+L  DH+C W    +   NY  F
Sbjct: 102 KPPKYYQCDKNGYPPWCTHCQSLKLSRSHHSKQVGRCILRFDHYCAWIGCVIARNNYRLF 161

Query: 124 LRFLFW 129
           L+++ W
Sbjct: 162 LQYVGW 167

>TDEL0A04440 Chr1 complement(795121..796218) [1098 bp, 365 aa] {ON}
           Anc_5.579 YDR459C
          Length = 365

 Score = 55.8 bits (133), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 40/80 (50%), Gaps = 3/80 (3%)

Query: 69  YQPTPGIWPNFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLRFLF 128
           YQ  P   P +C  C + K ER+HH      CV   DH C W    +G  NY  F++F+ 
Sbjct: 116 YQSCPRGNPIWCSACDSVKTERAHHSSDMEYCVPRFDHKCAWLGAVIGRDNYRFFIQFVM 175

Query: 129 WIIITTSILF---CIQVKRI 145
           ++ I +  +F   C  ++RI
Sbjct: 176 YMAILSLFVFVPICAFIRRI 195

>ZYRO0D13860g Chr4 complement(1171732..1172829) [1098 bp, 365 aa]
           {ON} similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459C likely functions in pathway(s) outside Ras
          Length = 365

 Score = 55.5 bits (132), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 40/150 (26%), Positives = 67/150 (44%), Gaps = 9/150 (6%)

Query: 69  YQPTPGIWPNFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLRFLF 128
           YQ  P  +P +C  CQ+ K ER+HH +    CV   DH C +  + +G  NY  F+++  
Sbjct: 116 YQCDPNGYPIWCTNCQSLKTERAHHSRELGHCVPKFDHKCTYLGSIIGKDNYRLFVQYCV 175

Query: 129 WIIITTSILFCIQVKRICFIWQRRNFPGY-LFKKSELTFLTILSPXXXXXXXXXXXXXXR 187
           ++ I  +I++   V  I  I   R++ G+       L  + IL+                
Sbjct: 176 FMTIWLAIIWTSIVAYIRSI--TRDYRGHGSHLNGNLIAILILTTLFWITVTSLLLTQLN 233

Query: 188 CLFNQIVNGRSQIESWDMDRLESLFDSRRL 217
           C    IV  ++ IE   M+R    F +R++
Sbjct: 234 C----IVKNKTSIEV--MERRRKAFSTRKM 257

>SAKL0G06160g Chr7 complement(514850..515944) [1095 bp, 364 aa] {ON}
           similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459C likely functions in pathway(s) outside Ras
          Length = 364

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/80 (37%), Positives = 40/80 (50%), Gaps = 3/80 (3%)

Query: 69  YQPTPGIWPNFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLRF-- 126
           YQ  P  +P +C  CQ+ K ER+HH  T   CV   DH+C W    VG  NY  F++F  
Sbjct: 116 YQCDPQGYPIWCSMCQSLKMERTHHSATLGYCVPRFDHYCVWIGTVVGRKNYRLFIQFSM 175

Query: 127 -LFWIIITTSILFCIQVKRI 145
             F+  +   I  C  +K I
Sbjct: 176 YFFFYFVIVLIPVCKYLKDI 195

>YDR459C Chr4 complement(1382319..1383443) [1125 bp, 374 aa] {ON}
           PFA5Palmitoyltransferase with autoacylation activity;
           likely functions in pathway(s) outside Ras; member of a
           family of putative palmitoyltransferases containing an
           Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain
          Length = 374

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 43/84 (51%), Gaps = 3/84 (3%)

Query: 65  PLPNYQPTPGIWPNFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFL 124
           P   YQ  P  +P +C +CQ+ K ER+HH      C+   DH+C W    +G  NY  F+
Sbjct: 116 PPKCYQSDPHGYPIWCSECQSLKMERTHHSSELGHCIPRFDHYCMWIGTVIGRDNYRLFV 175

Query: 125 RFLFW---IIITTSILFCIQVKRI 145
           +F  +   +++   +  C+ ++ I
Sbjct: 176 QFAAYFSTLLLIMWVSICVYIRII 199

>CAGL0K06347g Chr11 complement(624046..625104) [1059 bp, 352 aa]
           {ON} similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459c
          Length = 352

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 38/72 (52%), Gaps = 1/72 (1%)

Query: 67  PN-YQPTPGIWPNFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLR 125
           PN YQ  P  +P +C  CQ+ K  R+ H      CV   DH+C W    +GF NY  F++
Sbjct: 102 PNCYQSDPHGYPVWCSNCQSLKVGRTKHSSHQGHCVPRFDHYCVWLGAVIGFKNYRLFVQ 161

Query: 126 FLFWIIITTSIL 137
           F+F+  +   I+
Sbjct: 162 FVFYFAVLLMIV 173

>Smik_4.737 Chr4 complement(1303557..1304693) [1137 bp, 378 aa] {ON}
           YDR459C (REAL)
          Length = 378

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 32/62 (51%)

Query: 65  PLPNYQPTPGIWPNFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFL 124
           P   YQ  P  +P +C  CQ+ K ERSHH      C+   DH+C W    +G  NY  F+
Sbjct: 116 PPKCYQSDPNGYPIWCSPCQSLKMERSHHSSELGHCIPRFDHYCVWIGTIIGRDNYRPFV 175

Query: 125 RF 126
           +F
Sbjct: 176 QF 177

>Kpol_1004.57 s1004 complement(123368..124456) [1089 bp, 362 aa]
           {ON} complement(123368..124456) [1089 nt, 363 aa]
          Length = 362

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 48/99 (48%), Gaps = 5/99 (5%)

Query: 76  WPNFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLRFLFWIIITTS 135
           +P +C  C++ K  R+HH K    C+   DHHC W    +G  NY  F +F+F+    + 
Sbjct: 120 YPIWCDTCKSLKIGRTHHSKRLGYCIPRFDHHCMWVGTVIGKSNYLLFTQFVFYF---SC 176

Query: 136 ILFCIQVKRICFIWQRRNFP--GYLFKKSELTFLTILSP 172
           +L    +  + +I +  ++P  GY    + +  L +  P
Sbjct: 177 LLLIFWISIVSYIKRIVDYPHTGYKLDPNLIVILILSVP 215

>Suva_2.634 Chr2 complement(1134492..1135658) [1167 bp, 388 aa] {ON}
           YDR459C (REAL)
          Length = 388

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 33/61 (54%)

Query: 69  YQPTPGIWPNFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLRFLF 128
           YQ  P  +P +C  CQ+ K ER+HH      CV   DH+C W    +G  NY  F++F+ 
Sbjct: 126 YQCDPHGYPIWCSPCQSLKMERTHHSSELGHCVPRFDHYCLWVGTVIGRDNYRLFVQFVT 185

Query: 129 W 129
           +
Sbjct: 186 Y 186

>KLLA0D06149g Chr4 (527705..528754) [1050 bp, 349 aa] {ON} similar
           to uniprot|Q03289 Saccharomyces cerevisiae YDR459C
           likely functions in pathway(s) outside Ras
          Length = 349

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 33/62 (53%)

Query: 76  WPNFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLRFLFWIIITTS 135
           +P +C  CQ+ K  R+HH      CV   DH+C W    +G  NY  F++F F++ +   
Sbjct: 124 YPIWCSNCQSLKMSRTHHSTKVGYCVPRFDHYCVWIGTVLGRLNYKLFVQFTFYLDLVVL 183

Query: 136 IL 137
           IL
Sbjct: 184 IL 185

>KAFR0H00570 Chr8 (100639..102912) [2274 bp, 757 aa] {ON} Anc_5.626
           YOR034C
          Length = 757

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 34/71 (47%)

Query: 78  NFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLRFLFWIIITTSIL 137
           NFC +    KP RS      N  V   DH+CPW  N +G  N+  F+ F+  + I   I 
Sbjct: 461 NFCIETWIRKPLRSKFSTFYNSTVSRFDHYCPWVYNDIGLKNHKIFIFFIISVEIGILIF 520

Query: 138 FCIQVKRICFI 148
            C+ +K   F+
Sbjct: 521 VCLTMKYFDFL 531

>ABR203W Chr2 (782704..783783) [1080 bp, 359 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR459C
          Length = 359

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 36/74 (48%)

Query: 65  PLPNYQPTPGIWPNFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFL 124
           P   YQ     +P +C  CQ+ K  R+HH      CV  +DH+C W    +G  NY  F 
Sbjct: 107 PPDVYQCDTQGYPVWCSVCQSLKGLRTHHSVHLGFCVPRLDHYCVWLGTVIGRRNYRLFN 166

Query: 125 RFLFWIIITTSILF 138
           +FL   ++   I+F
Sbjct: 167 QFLMCFLMHALIIF 180

>NDAI0H00850 Chr8 (190934..193294) [2361 bp, 786 aa] {ON} Anc_5.626
           YDR264C
          Length = 786

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 45/106 (42%), Gaps = 15/106 (14%)

Query: 78  NFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLRFLFWI---IITT 134
           NFC +    KP RS +    N  V   DH CPW  N VG  N+ +F+ F+  +   IIT 
Sbjct: 472 NFCLESWTRKPLRSKYSHLNNALVARFDHFCPWIYNDVGLKNHKNFIGFILLVEAGIITF 531

Query: 135 SIL-----------FCIQVKRICFIWQRRNFPGYLFKKSELTFLTI 169
           + L           F +     CF+    +   Y F    LTFL +
Sbjct: 532 ASLCFEYFDELKDHFEVNENTSCFLLGDNDL-CYGFTYDRLTFLIL 576

>TPHA0C00370 Chr3 (62796..65075) [2280 bp, 759 aa] {ON} Anc_5.626
           YOR034C
          Length = 759

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 26/51 (50%)

Query: 78  NFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLRFLF 128
           NFC +    KP RS +    N  V   DH+CPW  N VG  N+  FL F+ 
Sbjct: 462 NFCIETLTRKPLRSRYSYMNNALVSRFDHYCPWVYNDVGLKNHKTFLFFIL 512

>ZYRO0C11132g Chr3 complement(861388..863667) [2280 bp, 759 aa] {ON}
           similar to uniprot|P39010 Saccharomyces cerevisiae
           YDR264C AKR1 Palmitoyl transferase involved in protein
           palmitoylation acts as a negative regulator of pheromone
           response pathway required for endocytosis of pheromone
           receptors involved in cell shape control contains
           ankyrin repeats
          Length = 759

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 40/154 (25%), Positives = 63/154 (40%), Gaps = 29/154 (18%)

Query: 7   WPWLGIAIPTLLIS--FIGYGAHYFI------LSNFLPIAKQ----IGFEFSLSMIWFSY 54
           +P +G+   +LL S  ++G      I      +S  +P+  Q      F   + ++  SY
Sbjct: 364 YPVVGVTSASLLRSPLYLGLFTASIIWPMLIWISRVIPVTIQDQYTANFLLMIIILAVSY 423

Query: 55  YLAIY--TNPGRPLPNYQPTPGIW--------------PNFCKKCQNYKPERSHHCKTCN 98
            L +   ++PGR +P  + T  I                NFC +    KP RS      N
Sbjct: 424 LLVVLVKSDPGR-IPTEKNTQVIRETIKDLLATGKFDSKNFCIETWVKKPLRSRFSSLSN 482

Query: 99  QCVLMMDHHCPWTMNCVGFGNYPHFLRFLFWIII 132
             V   DH+CPW  N +G  N+  FL  +  + I
Sbjct: 483 SLVARFDHYCPWVYNDIGLRNHKAFLMCILLVEI 516

>KLTH0E02420g Chr5 complement(211548..213752) [2205 bp, 734 aa] {ON}
           similar to uniprot|P39010 Saccharomyces cerevisiae
           YDR264C AKR1 Palmitoyl transferase involved in protein
           palmitoylation acts as a negative regulator of pheromone
           response pathway required for endocytosis of pheromone
           receptors involved in cell shape control contains
           ankyrin repeats
          Length = 734

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 31/66 (46%), Gaps = 2/66 (3%)

Query: 78  NFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLRFLFWIIITTSIL 137
           +FC      KP RS   +     ++  DH CPW  N VG  N+  F+ FL  ++   S  
Sbjct: 452 HFCVDTYKRKPLRSKFSRFNEALIVRFDHFCPWIYNDVGLLNHKQFIYFLLSLVSGVSCF 511

Query: 138 F--CIQ 141
           F  CI+
Sbjct: 512 FIACIE 517

>Kpol_526.32 s526 complement(77926..80259) [2334 bp, 777 aa] {ON}
           complement(77926..80259) [2334 nt, 778 aa]
          Length = 777

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 28/55 (50%)

Query: 78  NFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLRFLFWIII 132
           NFC +    KP RS +    +  V   DH CPW  N +G  N+  F+ F+  ++I
Sbjct: 477 NFCIESSVRKPLRSRYSYLNSAIVTRFDHFCPWIYNDIGLKNHKLFVLFIILMVI 531

>TBLA0J00830 Chr10 complement(187815..190034) [2220 bp, 739 aa] {ON}
           Anc_5.626 YOR034C
          Length = 739

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 50/114 (43%), Gaps = 15/114 (13%)

Query: 43  FEFSLSMIWFSYYLAIYTNPGRPLPNYQPTP-----------GIWP--NFCKKCQNYKPE 89
           F  S+  + + +Y  I +NPGR   N+               G +   +FC +    KP 
Sbjct: 418 FGVSIIGVIYEFYKLIRSNPGRKNRNHDMESVRKTIQTLMELGKFDIRHFCLETWVRKPL 477

Query: 90  RSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLRFLFW--IIITTSILFCIQ 141
           RS         V   DH+CPW  N +G  N+  F+ F+F+  + I + ++ C +
Sbjct: 478 RSKFSYLNQSVVNRYDHYCPWVYNDIGLRNHKRFIMFIFFSEVTIWSFVIVCFE 531

>Skud_4.527 Chr4 complement(938779..941073) [2295 bp, 764 aa] {ON}
           YDR264C (REAL)
          Length = 764

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 30/61 (49%), Gaps = 3/61 (4%)

Query: 78  NFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLRFLFWIIITTSIL 137
           NFC +    KP RS      N  V   DH+CPW  N VG  N+     F+F+I +  S +
Sbjct: 470 NFCIETWTRKPLRSKFSSLNNAVVARFDHYCPWIFNDVGLKNHK---AFIFFIALMESGI 526

Query: 138 F 138
           F
Sbjct: 527 F 527

>Suva_2.432 Chr2 complement(762658..764949) [2292 bp, 763 aa] {ON}
           YDR264C (REAL)
          Length = 763

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 25/50 (50%)

Query: 78  NFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLRFL 127
           NFC +    KP RS      N  V   DH+CPW  N VG  N+  F+ F+
Sbjct: 469 NFCIETWARKPLRSRFSSLNNAVVARFDHYCPWIFNDVGLKNHKGFMFFI 518

>Smik_4.515 Chr4 complement(928882..931176) [2295 bp, 764 aa] {ON}
           YDR264C (REAL)
          Length = 764

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 26/50 (52%)

Query: 78  NFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLRFL 127
           +FC +    KP RS +    N  V   DH+CPW  N VG  N+  F+ F+
Sbjct: 470 SFCIETWTRKPLRSKYSSLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFI 519

>Ecym_1330 Chr1 (684758..686977) [2220 bp, 739 aa] {ON} similar to
           Ashbya gossypii AER388C
          Length = 739

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 34/73 (46%)

Query: 78  NFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLRFLFWIIITTSIL 137
           +FC       P RS +    N  +   DH+CPW  N +GF N+  FL F+ ++ I   I 
Sbjct: 454 HFCIHSWVRIPLRSKYKTARNVLIARYDHYCPWVYNQIGFCNHKIFLFFIMFLQIGVFIF 513

Query: 138 FCIQVKRICFIWQ 150
             + ++     WQ
Sbjct: 514 VRLSIRYFELEWQ 526

>YDR264C Chr4 complement(996029..998323) [2295 bp, 764 aa] {ON}
           AKR1Palmitoyl transferase involved in protein
           palmitoylation; acts as a negative regulator of
           pheromone response pathway; required for endocytosis of
           pheromone receptors; involved in cell shape control;
           contains ankyrin repeats
          Length = 764

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 30/61 (49%), Gaps = 3/61 (4%)

Query: 78  NFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLRFLFWIIITTSIL 137
           NFC +    KP RS      N  V   DH+CPW  N VG  N+     F+F+I +  S +
Sbjct: 470 NFCIETWIRKPLRSKFSPLNNAVVARFDHYCPWIFNDVGLKNHK---AFIFFITLMESGI 526

Query: 138 F 138
           F
Sbjct: 527 F 527

>NCAS0C05280 Chr3 complement(1073710..1075983) [2274 bp, 757 aa]
           {ON} Anc_5.626
          Length = 757

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 28/59 (47%), Gaps = 4/59 (6%)

Query: 78  NFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLRFLFWIIITTSI 136
           NFC +    KP RSH        V   DH CPW  N +G  N+ +F+    W I+ T +
Sbjct: 455 NFCLETWIRKPLRSHFSTLNTHNVARFDHFCPWIYNDIGLKNHKNFM----WFILLTEV 509

>Suva_8.87 Chr8 complement(157531..159723) [2193 bp, 730 aa] {ON}
           YOR034C (REAL)
          Length = 730

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 37/92 (40%), Gaps = 12/92 (13%)

Query: 60  TNPGRPLPNYQPTPGIWP--NFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGF 117
           T P R   N     G +   NFC +    KP RS +       V   +H+CPW  N +G 
Sbjct: 409 TTPVRETINQLIQIGKYDRNNFCVETLERKPLRSKYSLFSGALVARFNHYCPWVYNDIGL 468

Query: 118 GNYPHFLRFLFWIIITTSILFCIQVKRICFIW 149
            N+  F+ F           F +Q +   F+W
Sbjct: 469 KNHKLFMFF----------AFSVQYEMFLFMW 490

>YOR034C Chr15 complement(394837..397086) [2250 bp, 749 aa] {ON}
           AKR2Ankyrin repeat-containing protein similar to Akr1p;
           member of a family of putative palmitoyltransferases
           containing an Asp-His-His-Cys-cysteine rich (DHHC-CRD)
           domain; possibly involved in constitutive endocytosis of
           Ste3p
          Length = 749

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 24/49 (48%)

Query: 78  NFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLRF 126
           NFC +    KP RS +       V   DH+CPW  N VG  N+  F+ F
Sbjct: 446 NFCVETLERKPLRSKYSFFSGALVARYDHYCPWIYNDVGLKNHKLFVFF 494

>CAGL0M08712g Chr13 (866454..868745) [2292 bp, 763 aa] {ON} similar
           to uniprot|P39010 Saccharomyces cerevisiae YDR264c
           ankyrin repeat-containing protein
          Length = 763

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 28/53 (52%)

Query: 78  NFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLRFLFWI 130
           +FC +    KP RS +    +  +L  DH+CPW  N VG  N+  F+ F+  +
Sbjct: 454 SFCLETWVRKPLRSKYSYLNDALILRFDHYCPWIYNDVGLKNHKLFIFFILAL 506

>TDEL0A04920 Chr1 complement(867970..870222) [2253 bp, 750 aa] {ON}
           Anc_5.626 YOR034C
          Length = 750

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 30/66 (45%), Gaps = 2/66 (3%)

Query: 78  NFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLRFLFWIIITTSIL 137
           +FC +    KP RS         +   DH+CPW  N VG  N+  FL F+  I +   I 
Sbjct: 460 HFCIESWIRKPLRSRFSSLNGTLIARFDHYCPWIYNDVGLKNHKRFLYFVALIEVAVWIF 519

Query: 138 --FCIQ 141
              C++
Sbjct: 520 AHLCLE 525

>KNAG0C06230 Chr3 complement(1208896..1211154) [2259 bp, 752 aa]
           {ON} Anc_5.626 YOR034C
          Length = 752

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 27/53 (50%)

Query: 78  NFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLRFLFWI 130
           NFC +    KP R       ++ VL  DH+CPW  N VG  N+  F+ ++  +
Sbjct: 458 NFCIETWQRKPLRCKFSSFHSRLVLRFDHYCPWVYNDVGLLNHKKFMYYVMSV 510

>Smik_15.213 Chr15 complement(360836..363070) [2235 bp, 744 aa] {ON}
           YOR034C (REAL)
          Length = 744

 Score = 39.3 bits (90), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 23/53 (43%)

Query: 78  NFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLRFLFWI 130
           NFC +    KP RS         V   DH CPW  N +G  N+  FL F   +
Sbjct: 443 NFCVETLERKPLRSKFSPFSGALVARYDHFCPWVYNDIGLKNHKLFLFFALTV 495

>AER388C Chr5 complement(1365604..1367778) [2175 bp, 724 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR264C
           (AKR1) and YOR034C (AKR2)
          Length = 724

 Score = 38.1 bits (87), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 26/49 (53%)

Query: 78  NFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLRF 126
           +FC       P R+ + +  +  +L  DH+CPW  N +GF N+  F+ F
Sbjct: 446 HFCIHSWIRLPLRAKYKRFVHSVILRYDHYCPWIYNYIGFRNHKIFIYF 494

>KNAG0B03140 Chr2 (604028..606076) [2049 bp, 682 aa] {ON} Anc_5.626
           YOR034C
          Length = 682

 Score = 36.6 bits (83), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 24/52 (46%)

Query: 79  FCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLRFLFWI 130
           FC K    KP R    K   Q V   DH+C W  N VG  N+  ++ FL  +
Sbjct: 404 FCLKTWIRKPVRCSLSKLNQQQVARFDHYCAWIYNDVGLKNHKLYIFFLILL 455

>SAKL0G07326g Chr7 complement(599477..601690) [2214 bp, 737 aa] {ON}
           uniprot|Q875S9 Saccharomyces kluyveri AKR1
           Palmitoyltransferase AKR1
          Length = 737

 Score = 36.6 bits (83), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 22/51 (43%)

Query: 78  NFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLRFLF 128
           +FC      KP RS         V   DH CPW  N +G  N+  FL F+ 
Sbjct: 450 HFCISTWVRKPIRSKFSNFSRALVTRFDHFCPWIYNDIGLRNHKTFLFFIL 500

>Skud_15.199 Chr15 complement(354702..356927) [2226 bp, 741 aa] {ON}
           YOR034C (REAL)
          Length = 741

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 22/49 (44%)

Query: 78  NFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLRF 126
           NFC +    K  RS +       V   DH+CPW  N +G  N+   L F
Sbjct: 440 NFCVETLERKSLRSKYSVFSGALVARFDHYCPWIYNDIGLKNHKLSLFF 488

>KLLA0E16721g Chr5 (1484752..1487010) [2259 bp, 752 aa] {ON} similar
           to uniprot|P39010 Saccharomyces cerevisiae YDR264C AKR1
           Palmitoyl transferase involved in protein palmitoylation
          Length = 752

 Score = 33.5 bits (75), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 28/59 (47%), Gaps = 2/59 (3%)

Query: 78  NFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLRFLFWIIITTSI 136
           +FC       P RS + +     +   DH CPW  N +G  N  H L ++F +++  S+
Sbjct: 466 HFCVHTWIRIPLRSKYDRDSACLISAFDHFCPWVYNQIGLLN--HKLFYMFVVLLEISV 522

>Suva_2.703 Chr2 complement(1238496..1239953) [1458 bp, 485 aa] {ON}
           YDR523C (REAL)
          Length = 485

 Score = 32.0 bits (71), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 23/107 (21%), Positives = 46/107 (42%), Gaps = 5/107 (4%)

Query: 234 TLQHERDAEGLLKQQR--SSFEGLVNFPYNFDLHTNAILYLGPVHLWLWPYGIPTGNGNN 291
           T+ + +    L+KQ++    +  +  +P    L+ N+    G      W +         
Sbjct: 271 TITNLKSDVDLIKQKKVQERYTKIPKYPLQNRLYKNSNTARGK---DFWNFESTRTTAIQ 327

Query: 292 FPKNDISNYEVDSPLEDIILSLPWPPDGGETTTVSNPKTSTIETCNE 338
             KN++S    DSP+  + +  P+   G   T ++NP +S+   CN+
Sbjct: 328 TSKNELSPITQDSPVSSLNMESPYLLHGQTVTPITNPNSSSFRKCNK 374

>KLTH0B09724g Chr2 complement(796023..800483) [4461 bp, 1486 aa] {ON}
            similar to uniprot|P53049 Saccharomyces cerevisiae
            YGR281W YOR1 Plasma membrane transporter of the ATP-
            binding cassette (ABC) family mediates export of many
            different organic anions including oligomycin
          Length = 1486

 Score = 32.0 bits (71), Expect = 3.0,   Method: Composition-based stats.
 Identities = 10/21 (47%), Positives = 14/21 (66%)

Query: 8    PWLGIAIPTLLISFIGYGAHY 28
            PW  IA+P L++ F+G   HY
Sbjct: 1041 PWFAIAVPFLMLVFVGVADHY 1061

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.141    0.479 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 42,211,358
Number of extensions: 1878399
Number of successful extensions: 6460
Number of sequences better than 10.0: 135
Number of HSP's gapped: 6469
Number of HSP's successfully gapped: 135
Length of query: 378
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 267
Effective length of database: 40,753,473
Effective search space: 10881177291
Effective search space used: 10881177291
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 66 (30.0 bits)