Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_15.1666.29ON1566156669620.0
YOL004W (SIN3)6.29ON1536101743450.0
Suva_15.1716.29ON1561101542500.0
Skud_15.1586.29ON1555101742500.0
ZYRO0C07524g6.29ON167084630030.0
TDEL0G044006.29ON149096829940.0
Kpol_1037.226.29ON149697928940.0
KAFR0A051206.29ON147996528870.0
KNAG0F029206.29ON149295628620.0
NCAS0D021306.29ON143497928260.0
SAKL0E01540g6.29ON141595327580.0
Ecym_30336.29ON147495027440.0
CAGL0E02475g6.29ON149395127310.0
KLTH0C10956g6.29ON143391027170.0
ACL004W6.29ON137795227140.0
TPHA0J004006.29ON151285127110.0
NDAI0C026606.29ON1657100326930.0
TBLA0E031606.29ON173985226880.0
Kwal_56.224626.29ON154192126780.0
KLLA0C06182g6.29ON151995326400.0
CAGL0J11594g6.29ON9373276094e-64
Suva_15.170singletonON1611193037e-31
Kpol_1064.538.403ON48969980.010
KAFR0A04880na 1ON344141781.7
CAGL0H05071g4.237ON1110103764.5
ADR150C2.638ON417188745.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_15.166
         (1566 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_15.166 Chr15 (284165..288865) [4701 bp, 1566 aa] {ON} YOL00...  2686   0.0  
YOL004W Chr15 (316938..321548) [4611 bp, 1536 aa] {ON}  SIN3Comp...  1678   0.0  
Suva_15.171 Chr15 (291325..296010) [4686 bp, 1561 aa] {ON} YOL00...  1641   0.0  
Skud_15.158 Chr15 (276509..281176) [4668 bp, 1555 aa] {ON} YOL00...  1641   0.0  
ZYRO0C07524g Chr3 (569197..574209) [5013 bp, 1670 aa] {ON} simil...  1161   0.0  
TDEL0G04400 Chr7 (795501..799973) [4473 bp, 1490 aa] {ON} Anc_6....  1157   0.0  
Kpol_1037.22 s1037 (46639..51129) [4491 bp, 1496 aa] {ON} (46639...  1119   0.0  
KAFR0A05120 Chr1 (1015307..1019746) [4440 bp, 1479 aa] {ON} Anc_...  1116   0.0  
KNAG0F02920 Chr6 (552441..556919) [4479 bp, 1492 aa] {ON} Anc_6....  1107   0.0  
NCAS0D02130 Chr4 (394326..398630) [4305 bp, 1434 aa] {ON} Anc_6....  1093   0.0  
SAKL0E01540g Chr5 complement(114922..119169) [4248 bp, 1415 aa] ...  1066   0.0  
Ecym_3033 Chr3 complement(64660..69084) [4425 bp, 1474 aa] {ON} ...  1061   0.0  
CAGL0E02475g Chr5 (236580..241061) [4482 bp, 1493 aa] {ON} simil...  1056   0.0  
KLTH0C10956g Chr3 (901384..905685) [4302 bp, 1433 aa] {ON} simil...  1051   0.0  
ACL004W Chr3 (347727..351860) [4134 bp, 1377 aa] {ON} Syntenic h...  1050   0.0  
TPHA0J00400 Chr10 complement(89956..94494) [4539 bp, 1512 aa] {O...  1048   0.0  
NDAI0C02660 Chr3 complement(615526..620499) [4974 bp, 1657 aa] {...  1041   0.0  
TBLA0E03160 Chr5 (789593..794812) [5220 bp, 1739 aa] {ON} Anc_6....  1040   0.0  
Kwal_56.22462 s56 complement(139779..144404) [4626 bp, 1541 aa] ...  1036   0.0  
KLLA0C06182g Chr3 (544281..548840) [4560 bp, 1519 aa] {ON} simil...  1021   0.0  
CAGL0J11594g Chr10 complement(1126896..1129709) [2814 bp, 937 aa...   239   4e-64
Suva_15.170 Chr15 (290805..291290) [486 bp, 161 aa] {ON}  YOL004...   121   7e-31
Kpol_1064.53 s1064 (95468..96937) [1470 bp, 489 aa] {ON} (95468....    42   0.010
KAFR0A04880 Chr1 complement(964742..965776) [1035 bp, 344 aa] {O...    35   1.7  
CAGL0H05071g Chr8 (486899..490231) [3333 bp, 1110 aa] {ON} simil...    34   4.5  
ADR150C Chr4 complement(969444..970697) [1254 bp, 417 aa] {ON} S...    33   5.8  

>Smik_15.166 Chr15 (284165..288865) [4701 bp, 1566 aa] {ON} YOL004W
            (REAL)
          Length = 1566

 Score = 2686 bits (6962), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1334/1566 (85%), Positives = 1334/1566 (85%)

Query: 1    MSQVWHNPNSQSNDVATSNDAAGSNERNERNEKEPLLXXXXXXXXXXXXRITLPSLSALN 60
            MSQVWHNPNSQSNDVATSNDAAGSNERNERNEKEPLL            RITLPSLSALN
Sbjct: 1    MSQVWHNPNSQSNDVATSNDAAGSNERNERNEKEPLLQGNQSSFVQQQQRITLPSLSALN 60

Query: 61   NKEENGRDSNGQLPLASHGTHILGYPPTHPNIIPSITSDSTFKQSHEYQPHPKXXXXXXX 120
            NKEENGRDSNGQLPLASHGTHILGYPPTHPNIIPSITSDSTFKQSHEYQPHPK       
Sbjct: 61   NKEENGRDSNGQLPLASHGTHILGYPPTHPNIIPSITSDSTFKQSHEYQPHPKSSSSSPS 120

Query: 121  INTSVMNXXXXXXXXXXXXXXXXXFSLSRFDNPLPINAPVHTEGSQSYNCPQEEEKASQQ 180
            INTSVMN                 FSLSRFDNPLPINAPVHTEGSQSYNCPQEEEKASQQ
Sbjct: 121  INTSVMNAASASAPAPLPTAGGASFSLSRFDNPLPINAPVHTEGSQSYNCPQEEEKASQQ 180

Query: 181  TQDHKEVSAGAQPTDATKSAXXXXXXXXXXXXXXXXXXXXXXXXXXXXYRPLNVKDALSY 240
            TQDHKEVSAGAQPTDATKSA                            YRPLNVKDALSY
Sbjct: 181  TQDHKEVSAGAQPTDATKSANDHIDTNDDNNNNNSNNNNENFNEEDPDYRPLNVKDALSY 240

Query: 241  LEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPILIQGFNTFLPQG 300
            LEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPILIQGFNTFLPQG
Sbjct: 241  LEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPILIQGFNTFLPQG 300

Query: 301  YRIECSTNPDDPIRVTTPMGTTTVNNNISPPERGTIDAQEPSSLPEADGNGTQRSHNVPM 360
            YRIECSTNPDDPIRVTTPMGTTTVNNNISPPERGTIDAQEPSSLPEADGNGTQRSHNVPM
Sbjct: 301  YRIECSTNPDDPIRVTTPMGTTTVNNNISPPERGTIDAQEPSSLPEADGNGTQRSHNVPM 360

Query: 361  VPSNVYHSEQNQDQQQVLPLSATSTGLPSIQQSEIPVHHQIPQIQPLAVQEDVKKNVDVE 420
            VPSNVYHSEQNQDQQQVLPLSATSTGLPSIQQSEIPVHHQIPQIQPLAVQEDVKKNVDVE
Sbjct: 361  VPSNVYHSEQNQDQQQVLPLSATSTGLPSIQQSEIPVHHQIPQIQPLAVQEDVKKNVDVE 420

Query: 421  FSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDF 480
            FSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDF
Sbjct: 421  FSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDF 480

Query: 481  KKFLPDSSASANXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 540
            KKFLPDSSASAN                                                
Sbjct: 481  KKFLPDSSASANQQVQHAQQHAQQQQDAQMQAQAQAQMQAQAQAQAQAQVQAQAQAQAQA 540

Query: 541  XXXXXXXXXXFLYPASSYYGHSNNRGIPQQNLPPIGSFSPPTNGSTVHENYQDQQHMQPP 600
                      FLYPASSYYGHSNNRGIPQQNLPPIGSFSPPTNGSTVHENYQDQQHMQPP
Sbjct: 541  QAQAEQQQQQFLYPASSYYGHSNNRGIPQQNLPPIGSFSPPTNGSTVHENYQDQQHMQPP 600

Query: 601  HLMPLPSMVQHGANIVHQGIANENLPLSDLRTSLTEQYAXXXXXXXXXXXXXXXXXXANS 660
            HLMPLPSMVQHGANIVHQGIANENLPLSDLRTSLTEQYA                  ANS
Sbjct: 601  HLMPLPSMVQHGANIVHQGIANENLPLSDLRTSLTEQYAPSNIQQQQQQHPQSISPIANS 660

Query: 661  QYGDVPVRPEIDLDXXXXXXXXXXXXXXXDNISLNEEVTFFEKAKRYIGNKHLYTEFLKI 720
            QYGDVPVRPEIDLD               DNISLNEEVTFFEKAKRYIGNKHLYTEFLKI
Sbjct: 661  QYGDVPVRPEIDLDPSIVPVVPEPTEPIEDNISLNEEVTFFEKAKRYIGNKHLYTEFLKI 720

Query: 721  LNLYSQDILDLDDLVEKVDFYLGSNKELFSWFKNFVGYQERTKFIENIVHEKHRLDLDLC 780
            LNLYSQDILDLDDLVEKVDFYLGSNKELFSWFKNFVGYQERTKFIENIVHEKHRLDLDLC
Sbjct: 721  LNLYSQDILDLDDLVEKVDFYLGSNKELFSWFKNFVGYQERTKFIENIVHEKHRLDLDLC 780

Query: 781  EAFGPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLF 840
            EAFGPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLF
Sbjct: 781  EAFGPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLF 840

Query: 841  KIEEERHEYDFYIESNLRTIQCLETIVNKIENMTENEKVNFKLPPGLGHTSMTIYKKVIR 900
            KIEEERHEYDFYIESNLRTIQCLETIVNKIENMTENEKVNFKLPPGLGHTSMTIYKKVIR
Sbjct: 841  KIEEERHEYDFYIESNLRTIQCLETIVNKIENMTENEKVNFKLPPGLGHTSMTIYKKVIR 900

Query: 901  KVYDKERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSL 960
            KVYDKERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSL
Sbjct: 901  KVYDKERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSL 960

Query: 961  DHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQLDFDFPDKNIFCDI 1020
            DHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQLDFDFPDKNIFCDI
Sbjct: 961  DHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQLDFDFPDKNIFCDI 1020

Query: 1021 LYLADSFISHTTAYSNPDKERLKDLLKYXXXXXXXXXXXXXXXXXQAYKQXXXXXXXXXX 1080
            LYLADSFISHTTAYSNPDKERLKDLLKY                 QAYKQ          
Sbjct: 1021 LYLADSFISHTTAYSNPDKERLKDLLKYFISLFFSISLEEIEESLQAYKQSVSESSGSDD 1080

Query: 1081 XXXXXXRKRSYQQEMTLLDILHRSRYQKLKRSKDEDGKVPQLSEAPDXXXXXXXXXXXXX 1140
                  RKRSYQQEMTLLDILHRSRYQKLKRSKDEDGKVPQLSEAPD             
Sbjct: 1081 GGSSVSRKRSYQQEMTLLDILHRSRYQKLKRSKDEDGKVPQLSEAPDEESNIIEEEELIN 1140

Query: 1141 XXAKNPWLTGNLVEEANSQGMIQNRGIFNLFANTNIYIFFRHWTTIYERLLEIKQMNEKV 1200
              AKNPWLTGNLVEEANSQGMIQNRGIFNLFANTNIYIFFRHWTTIYERLLEIKQMNEKV
Sbjct: 1141 EEAKNPWLTGNLVEEANSQGMIQNRGIFNLFANTNIYIFFRHWTTIYERLLEIKQMNEKV 1200

Query: 1201 TKEINTRSTVTFAKDLDLLSNQLSEMGLDFIGEDAYKQVLKLSRRLINGDLEHQWFEESL 1260
            TKEINTRSTVTFAKDLDLLSNQLSEMGLDFIGEDAYKQVLKLSRRLINGDLEHQWFEESL
Sbjct: 1201 TKEINTRSTVTFAKDLDLLSNQLSEMGLDFIGEDAYKQVLKLSRRLINGDLEHQWFEESL 1260

Query: 1261 RQAYNNRAFKLYTIDKVTQSLVKHAHTLMTDAKTAEIMALFVKDRNVTTTSAKGQIIYRL 1320
            RQAYNNRAFKLYTIDKVTQSLVKHAHTLMTDAKTAEIMALFVKDRNVTTTSAKGQIIYRL
Sbjct: 1261 RQAYNNRAFKLYTIDKVTQSLVKHAHTLMTDAKTAEIMALFVKDRNVTTTSAKGQIIYRL 1320

Query: 1321 QVRSHMSNTENMFRIEFDKRTLHVSIQYIALDDLTLKEPKEDEDKWKYYVTSYALPHPTE 1380
            QVRSHMSNTENMFRIEFDKRTLHVSIQYIALDDLTLKEPKEDEDKWKYYVTSYALPHPTE
Sbjct: 1321 QVRSHMSNTENMFRIEFDKRTLHVSIQYIALDDLTLKEPKEDEDKWKYYVTSYALPHPTE 1380

Query: 1381 GVLHEKLKIPFLERLIEFGQDIDGKDVDEKFSPEGISVSTLKIKIQPTTYKLDIENGSYD 1440
            GVLHEKLKIPFLERLIEFGQDIDGKDVDEKFSPEGISVSTLKIKIQPTTYKLDIENGSYD
Sbjct: 1381 GVLHEKLKIPFLERLIEFGQDIDGKDVDEKFSPEGISVSTLKIKIQPTTYKLDIENGSYD 1440

Query: 1441 VFTRKSANKYPTVANDDTHKEVVVQKKELISRFLDCAVHLRNDLNESQKISMQEKFESLK 1500
            VFTRKSANKYPTVANDDTHKEVVVQKKELISRFLDCAVHLRNDLNESQKISMQEKFESLK
Sbjct: 1441 VFTRKSANKYPTVANDDTHKEVVVQKKELISRFLDCAVHLRNDLNESQKISMQEKFESLK 1500

Query: 1501 DTTAKLNVDGQVVDXXXXXXXXXXXXXXXNLXXXXXXXXXXXXXXPQDDNIEVMRSTGLS 1560
            DTTAKLNVDGQVVD               NL              PQDDNIEVMRSTGLS
Sbjct: 1501 DTTAKLNVDGQVVDTKIEEATKTKQEQQENLASSDASVFSSTSDVPQDDNIEVMRSTGLS 1560

Query: 1561 DTETKI 1566
            DTETKI
Sbjct: 1561 DTETKI 1566

>YOL004W Chr15 (316938..321548) [4611 bp, 1536 aa] {ON}  SIN3Component
            of the Sin3p-Rpd3p histone deacetylase complex, involved
            in transcriptional repression and activation of diverse
            processes, including mating-type switching and meiosis;
            involved in the maintenance of chromosomal integrity
          Length = 1536

 Score = 1678 bits (4345), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 823/1017 (80%), Positives = 865/1017 (85%), Gaps = 2/1017 (0%)

Query: 551  FLYPASSYYGHSNNRGIPQQNLPPIGSFSPPTNGSTVHENYQDQQHMQPPHLMPLPSMVQ 610
            FLYPAS YYGH +NRGIPQQNLPPIGSFSPPTNGSTVHE YQDQQHMQPPH MPLPS+VQ
Sbjct: 520  FLYPASGYYGHPSNRGIPQQNLPPIGSFSPPTNGSTVHEAYQDQQHMQPPHFMPLPSIVQ 579

Query: 611  HGANIVHQGIANENLPLSDLRTSLTEQYAXXXXXXXXXXXXXXXXXXANSQYGDVPVRPE 670
            HG N+VHQGIANEN PLSDLRTSLTEQYA                  AN+QYGD+PVRPE
Sbjct: 580  HGPNMVHQGIANENPPLSDLRTSLTEQYAPSSIQHQQQHPQSISPI-ANTQYGDIPVRPE 638

Query: 671  IDLDXXXXXXXXXXXXXXXDNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILD 730
            IDLD               +NISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILD
Sbjct: 639  IDLDPSIVPVVPEPTEPIENNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILD 698

Query: 731  LDDLVEKVDFYLGSNKELFSWFKNFVGYQERTKFIENIVHEKHRLDLDLCEAFGPSYKRL 790
            LDDLVEKVDFYLGSNKELF+WFKNFVGYQE+TK IENIVHEKHRLDLDLCEAFGPSYKRL
Sbjct: 699  LDDLVEKVDFYLGSNKELFTWFKNFVGYQEKTKCIENIVHEKHRLDLDLCEAFGPSYKRL 758

Query: 791  PKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYD 850
            PKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYD
Sbjct: 759  PKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYD 818

Query: 851  FYIESNLRTIQCLETIVNKIENMTENEKVNFKLPPGLGHTSMTIYKKVIRKVYDKERGFE 910
            FYIESNLRTIQCLETIVNKIENMTENEK NFKLPPGLGHTSMTIYKKVIRKVYDKERGFE
Sbjct: 819  FYIESNLRTIQCLETIVNKIENMTENEKANFKLPPGLGHTSMTIYKKVIRKVYDKERGFE 878

Query: 911  IIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQA 970
            IIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQA
Sbjct: 879  IIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQA 938

Query: 971  DKKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQLDFDFPDKNIFCDILYLADSFISH 1030
            DKKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQLDFDFPDKNIF DIL LAD+FI+H
Sbjct: 939  DKKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQLDFDFPDKNIFYDILCLADTFITH 998

Query: 1031 TTAYSNPDKERLKDLLKYXXXXXXXXXXXXXXXXXQAYKQXXXXXXXXXXXXXXXXRKRS 1090
            TTAYSNPDKERLKDLLKY                  ++KQ                RKR 
Sbjct: 999  TTAYSNPDKERLKDLLKYFISLFFSISFEKIEESLYSHKQNVSESSGSDDGSSIASRKRP 1058

Query: 1091 YQQEMTLLDILHRSRYQKLKRSKDEDGKVPQLSEAPDXXXXXXXXXXXXXXXAKNPWLTG 1150
            YQQEM+LLDILHRSRYQKLKRS DEDGKVPQLSE P+               AKNPWLTG
Sbjct: 1059 YQQEMSLLDILHRSRYQKLKRSNDEDGKVPQLSEPPEEEPNTIEEEELIDEEAKNPWLTG 1118

Query: 1151 NLVEEANSQGMIQNRGIFNLFANTNIYIFFRHWTTIYERLLEIKQMNEKVTKEINTRSTV 1210
            NLVEEANSQG+IQNR IFNLFANTNIYIFFRHWTTIYERLLEIKQMNE+VTKEINTRSTV
Sbjct: 1119 NLVEEANSQGIIQNRSIFNLFANTNIYIFFRHWTTIYERLLEIKQMNERVTKEINTRSTV 1178

Query: 1211 TFAKDLDLLSNQLSEMGLDFIGEDAYKQVLKLSRRLINGDLEHQWFEESLRQAYNNRAFK 1270
            TFAKDLDLLS+QLSEMGLDF+GEDAYKQVL+LSRRLINGDLEHQWFEESLRQAYNN+AFK
Sbjct: 1179 TFAKDLDLLSSQLSEMGLDFVGEDAYKQVLRLSRRLINGDLEHQWFEESLRQAYNNKAFK 1238

Query: 1271 LYTIDKVTQSLVKHAHTLMTDAKTAEIMALFVKDRNVTTTSAKGQIIYRLQVRSHMSNTE 1330
            LYTIDKVTQSLVKHAHTLMTDAKTAEIMALFVKDRN +TTSAK QIIYRLQVRSHMSNTE
Sbjct: 1239 LYTIDKVTQSLVKHAHTLMTDAKTAEIMALFVKDRNASTTSAKDQIIYRLQVRSHMSNTE 1298

Query: 1331 NMFRIEFDKRTLHVSIQYIALDDLTLKEPKEDEDKWKYYVTSYALPHPTEGVLHEKLKIP 1390
            NMFRIEFDKRTLHVSIQYIALDDLTLKEPK DEDKWKYYVTSYALPHPTEG+ HEKLKIP
Sbjct: 1299 NMFRIEFDKRTLHVSIQYIALDDLTLKEPKADEDKWKYYVTSYALPHPTEGIPHEKLKIP 1358

Query: 1391 FLERLIEFGQDIDGKDVDEKFSPEGISVSTLKIKIQPTTYKLDIENGSYDVFTRKSANKY 1450
            FLERLIEFGQDIDG +VDE+FSPEGISVSTLKIKIQP TY+L IENGSYDVFTRK+ NKY
Sbjct: 1359 FLERLIEFGQDIDGTEVDEEFSPEGISVSTLKIKIQPITYQLHIENGSYDVFTRKATNKY 1418

Query: 1451 PTVANDDTHKEVVVQKKELISRFLDCAVHLRNDLNESQKISMQEKFESLKDTTAKLNVDG 1510
            PT+AND+T K +V QKKELIS+FLDCAV LRN+L+E+QK+SMQ+K+E+LKD+ AK +   
Sbjct: 1419 PTIANDNTQKGMVSQKKELISKFLDCAVGLRNNLDEAQKLSMQKKWENLKDSIAKTSAGN 1478

Query: 1511 QVVDXXXXXXXXXXXXXXXNLXXXXXXXX-XXXXXXPQDDNIEVMRSTGLSDTETKI 1566
            Q ++               NL               PQDDNIE   +T  SD   KI
Sbjct: 1479 QGIESETEKGKITKQEQSDNLDSSTASVLPASITTVPQDDNIETTGNTESSDKGAKI 1535

 Score =  671 bits (1731), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/492 (72%), Positives = 372/492 (75%), Gaps = 13/492 (2%)

Query: 1   MSQVWHNPNSQSNDVATSNDAAGSNERNERNEKEPLLXXXXXXXXXXXXRITLPSLSALN 60
           MSQVWHN NSQSNDVATSNDA GSNERNE   KEP L            RITLPSLSAL+
Sbjct: 1   MSQVWHNSNSQSNDVATSNDATGSNERNE---KEPSLQGNKPGFVQQQQRITLPSLSALS 57

Query: 61  NKEENGRDSNGQLPLASHGTHILGYPPTHPNIIPSITSDSTFKQSHEYQPHPKXXXXXXX 120
            KEE+ RDSNGQ  L SH  HILGYPP H N +PSI +DS  KQ HEY P PK       
Sbjct: 58  TKEEDRRDSNGQQALTSHAAHILGYPPPHSNAMPSIATDSALKQPHEYHPRPKSSSSSPS 117

Query: 121 INTSVMNXXXXXXXXXXXXXXXXXFSLSRFDNPLPINAPVHTEGSQSYNCPQEEEKASQQ 180
           IN S+MN                 FSLSRFDNPLPI APVHTE  +SYN  QEEEKA+Q+
Sbjct: 118 INASLMNAGPAPLPTVGAAS----FSLSRFDNPLPIKAPVHTEEPKSYNGLQEEEKATQR 173

Query: 181 TQDHKEVSAGAQPTDATKSAXXXXXXXXXXXXXXXXXXXXXXXXXXXXYRPLNVKDALSY 240
            QD KEV AG QP DA   +                            YRPLNVKDALSY
Sbjct: 174 PQDCKEVPAGVQPADAPDPSSNHADANDDNNNNENSHDEDAD------YRPLNVKDALSY 227

Query: 241 LEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPILIQGFNTFLPQG 300
           LEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPILIQGFNTFLPQG
Sbjct: 228 LEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPILIQGFNTFLPQG 287

Query: 301 YRIECSTNPDDPIRVTTPMGTTTVNNNISPPERGTIDAQEPSSLPEADGNGTQRSHNVPM 360
           YRIECS+NPDDPIRVTTPMGTTTVNNNISP  RGT DAQE  S PE+DGNG Q+  NVPM
Sbjct: 288 YRIECSSNPDDPIRVTTPMGTTTVNNNISPSGRGTTDAQELGSFPESDGNGVQQPSNVPM 347

Query: 361 VPSNVYHSEQNQDQQQVLPLSATSTGLPSIQQSEIPVHHQIPQIQPLAVQEDVKKNVDVE 420
           VPS+VY SEQNQDQQQ LPL ATS+GLPSIQQ E+P H QIPQ Q L  QED KKNVDVE
Sbjct: 348 VPSSVYQSEQNQDQQQSLPLLATSSGLPSIQQPEMPAHRQIPQSQSLVPQEDAKKNVDVE 407

Query: 421 FSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDF 480
           FSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDF
Sbjct: 408 FSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDF 467

Query: 481 KKFLPDSSASAN 492
           KKFLPDSSASAN
Sbjct: 468 KKFLPDSSASAN 479

 Score = 36.6 bits (83), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 30/127 (23%), Positives = 59/127 (46%), Gaps = 13/127 (10%)

Query: 361 VPSNVYHSEQNQDQQQVLPLSATSTGLPSIQQSEIPVHHQI---PQIQPLAVQEDVKKNV 417
            PS++ H  Q Q  Q + P++ T  G       +IPV  +I   P I P+  +       
Sbjct: 608 APSSIQH--QQQHPQSISPIANTQYG-------DIPVRPEIDLDPSIVPVVPEPTEPIEN 658

Query: 418 DVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLL 477
           ++  ++ +++  K K R+     +Y  FL+IL  Y ++   ++++  +V     +  +L 
Sbjct: 659 NISLNEEVTFFEKAK-RYIGNKHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNKELF 717

Query: 478 EDFKKFL 484
             FK F+
Sbjct: 718 TWFKNFV 724

>Suva_15.171 Chr15 (291325..296010) [4686 bp, 1561 aa] {ON} YOL004W
            (REAL)
          Length = 1561

 Score = 1641 bits (4250), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 806/1015 (79%), Positives = 851/1015 (83%), Gaps = 2/1015 (0%)

Query: 551  FLYPASSYYGHSNNRGIPQQNLPPIGSFSPPTNGSTVHENYQDQQHMQPPHLMPLPSMVQ 610
            FLYPAS+YY HS N GIPQQNLPPIGSFSPPTNGST HE +QDQQHMQPPHLMPLPSMVQ
Sbjct: 544  FLYPASNYYSHSTNGGIPQQNLPPIGSFSPPTNGSTTHEGFQDQQHMQPPHLMPLPSMVQ 603

Query: 611  HGANIVHQGIANENLPLSDLRTSLTEQYAXXXXXXXXXXXXXXXXXXANSQYGDVPVRPE 670
             G N+VHQGI NEN+PLSDLRTSLT+QYA                   +SQYGDVPVRPE
Sbjct: 604  QGPNMVHQGIVNENIPLSDLRTSLTDQYAPSNFQQQQQQQPSISPI-IDSQYGDVPVRPE 662

Query: 671  IDLDXXXXXXXXXXXXXXXDNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILD 730
            IDLD               DNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILD
Sbjct: 663  IDLDPSIVPVVPEPTEPIEDNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILD 722

Query: 731  LDDLVEKVDFYLGSNKELFSWFKNFVGYQERTKFIENIVHEKHRLDLDLCEAFGPSYKRL 790
            LDDLVEKVDFYLGSNKELFSWFKNFVGYQE+ K IEN+VHEKHRLDLDLCEAFGPSYKRL
Sbjct: 723  LDDLVEKVDFYLGSNKELFSWFKNFVGYQEKIKSIENVVHEKHRLDLDLCEAFGPSYKRL 782

Query: 791  PKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYD 850
            PKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYD
Sbjct: 783  PKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYD 842

Query: 851  FYIESNLRTIQCLETIVNKIENMTENEKVNFKLPPGLGHTSMTIYKKVIRKVYDKERGFE 910
            FYIESNLRTIQCLETIVNKIENMTENEK NFKLPPGLGHTSMTIYKKVIRKVYDKERGFE
Sbjct: 843  FYIESNLRTIQCLETIVNKIENMTENEKANFKLPPGLGHTSMTIYKKVIRKVYDKERGFE 902

Query: 911  IIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQA 970
            IIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKV+FKSLDHLGLTFKQA
Sbjct: 903  IIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLDHLGLTFKQA 962

Query: 971  DKKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQLDFDFPDKNIFCDILYLADSFISH 1030
            DKKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQLDFDFPDK+IF DILYLADSFI+H
Sbjct: 963  DKKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQLDFDFPDKDIFYDILYLADSFIAH 1022

Query: 1031 TTAYSNPDKERLKDLLKYXXXXXXXXXXXXXXXXXQAYKQXXXXXXXXXXXXXXXXRKRS 1090
            TTAYSNPDKERLKDLL Y                 Q+YKQ                RKR 
Sbjct: 1023 TTAYSNPDKERLKDLLNYFISLFFSIPLEKIEEALQSYKQNLSDSSGSDDGDSSTPRKRP 1082

Query: 1091 YQQEMTLLDILHRSRYQKLKRSKDEDGKVPQLSEAPDXXXXXXXXXXXXXXXAKNPWLTG 1150
            YQQEM+LLDILHRS+YQKLKRS DEDGKVPQLSE  D               AKNPWLTG
Sbjct: 1083 YQQEMSLLDILHRSKYQKLKRSNDEDGKVPQLSEPLDEESNAIEEEELINEEAKNPWLTG 1142

Query: 1151 NLVEEANSQGMIQNRGIFNLFANTNIYIFFRHWTTIYERLLEIKQMNEKVTKEINTRSTV 1210
            NLVEEANSQG+IQNR IFNLFAN+NIYIFFRHWTTIYERLLEIKQMNEKVTKEI+ RS V
Sbjct: 1143 NLVEEANSQGIIQNRNIFNLFANSNIYIFFRHWTTIYERLLEIKQMNEKVTKEISKRSMV 1202

Query: 1211 TFAKDLDLLSNQLSEMGLDFIGEDAYKQVLKLSRRLINGDLEHQWFEESLRQAYNNRAFK 1270
            TFAKDLDLLS+QLSEMGLDF GEDAYKQVLKLSRRLING+LEHQWFEE LRQAYNN+AFK
Sbjct: 1203 TFAKDLDLLSSQLSEMGLDFNGEDAYKQVLKLSRRLINGELEHQWFEEGLRQAYNNKAFK 1262

Query: 1271 LYTIDKVTQSLVKHAHTLMTDAKTAEIMALFVKDRNVTTTSAKGQIIYRLQVRSHMSNTE 1330
            LYTIDKV Q LVKHAHTLMTDAKTAEIMALFVKDRN +TTSAK QIIYRLQ RS+MSNTE
Sbjct: 1263 LYTIDKVIQLLVKHAHTLMTDAKTAEIMALFVKDRNASTTSAKDQIIYRLQARSYMSNTE 1322

Query: 1331 NMFRIEFDKRTLHVSIQYIALDDLTLKEPKEDEDKWKYYVTSYALPHPTEGVLHEKLKIP 1390
            NMFR+EFD+R LHVS+QYIALDDLTLKEP+ DEDKWKYYVTSYALPHPTEG+ HEKLKIP
Sbjct: 1323 NMFRMEFDRRNLHVSVQYIALDDLTLKEPRADEDKWKYYVTSYALPHPTEGISHEKLKIP 1382

Query: 1391 FLERLIEFGQDIDGKDVDEKFSPEGISVSTLKIKIQPTTYKLDIENGSYDVFTRKSANKY 1450
            FLERLIE+GQD DG++VDEKFSPEG+SVSTLKIKIQP TYKL IE+GSYDVFTRK+ANKY
Sbjct: 1383 FLERLIEYGQDTDGREVDEKFSPEGLSVSTLKIKIQPVTYKLHIESGSYDVFTRKAANKY 1442

Query: 1451 PTVANDDTHKEVVVQKKELISRFLDCAVHLRNDLNESQKISMQEKFESLKDTTAKLNVDG 1510
            PTVANDD HKE+VV+K  LIS+FLD A+ LRNDLNE++K+SMQEK +SLK  T K +VD 
Sbjct: 1443 PTVANDDIHKEMVVKKTGLISKFLDNAIRLRNDLNETKKLSMQEKLDSLKGATTKADVDD 1502

Query: 1511 QVVDXXXXXXXXXXXXXXXNL-XXXXXXXXXXXXXXPQDDNIEVMRSTGLSDTET 1564
            ++                 NL               PQDDN EV  +TG  D ET
Sbjct: 1503 KITVAKNEKAIEAKEEQQENLPTSDMHVLPSSIANVPQDDNTEVTGNTGPFDKET 1557

 Score =  489 bits (1258), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 256/338 (75%), Positives = 271/338 (80%), Gaps = 12/338 (3%)

Query: 156 INAPVHTEGSQSYNCPQEEEKASQQTQDHKEVSAGAQPTDATKSAXXXXXXXXXXXXXXX 215
           +NA   TE  +S+N   EEEKA+Q  QDHK   A  QP DA + +               
Sbjct: 1   MNALGRTEDRKSFNGLPEEEKANQPVQDHKRAPAAVQPADAAEVSNVYADTKDEINAENT 60

Query: 216 XXXXXXXXXXXXXYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGV 275
                        YRPLNVKDALSYLEQVKFQF+SRPDIYNLFLDIMKDFKSQAIDTPGV
Sbjct: 61  NDEDPD-------YRPLNVKDALSYLEQVKFQFNSRPDIYNLFLDIMKDFKSQAIDTPGV 113

Query: 276 IERVSTLFRGYPILIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTTTVNNNISPPERGT 335
           IERVSTLFRGYPILIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTTTVNNN+SPP R  
Sbjct: 114 IERVSTLFRGYPILIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTTTVNNNVSPPARSA 173

Query: 336 IDAQEPSSLPEADGNGTQRSHNVPMVPSNVYHSEQNQDQQQV-LPLSATSTGLPSIQQSE 394
           ++ QEPSSLPEADG+   +SHNVPMVPSNVYHSEQ+QDQQQ  LPL A  +GLPSI Q E
Sbjct: 174 LEPQEPSSLPEADGSTIPQSHNVPMVPSNVYHSEQSQDQQQQPLPLLANPSGLPSIHQPE 233

Query: 395 IPVHHQIPQIQPLAVQEDVKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQR 454
           +P    IPQ QPL  QEDVKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQR
Sbjct: 234 LP----IPQSQPLTAQEDVKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQR 289

Query: 455 EQKPINEVYAQVTHLFQNAPDLLEDFKKFLPDSSASAN 492
           EQKPINEVYAQVTHLFQNAPDLLEDFKKFLPDSSASAN
Sbjct: 290 EQKPINEVYAQVTHLFQNAPDLLEDFKKFLPDSSASAN 327

>Skud_15.158 Chr15 (276509..281176) [4668 bp, 1555 aa] {ON} YOL004W
            (REAL)
          Length = 1555

 Score = 1641 bits (4250), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 804/1017 (79%), Positives = 850/1017 (83%), Gaps = 2/1017 (0%)

Query: 551  FLYPASSYYGHSNNRGIPQQNLPPIGSFSPPTNGSTVHENYQDQQHMQPPHLMPLPSMVQ 610
            FLYPASSYY HS NRG+PQQNLPPIGSFSPPTNGSTVH+NYQDQQHMQPPHL+PLPSMVQ
Sbjct: 538  FLYPASSYYNHSTNRGVPQQNLPPIGSFSPPTNGSTVHDNYQDQQHMQPPHLVPLPSMVQ 597

Query: 611  HGANIVHQGIANENLPLSDLRTSLTEQYAXXXXXXXXXXXXXXXXXXANSQYGDVPVRPE 670
            HG N+VHQGIANENLP+SDLRTSLT+QYA                   + QYGDVPVRPE
Sbjct: 598  HGPNMVHQGIANENLPISDLRTSLTDQYAPSTFQQQQQNPPSISPI-TDLQYGDVPVRPE 656

Query: 671  IDLDXXXXXXXXXXXXXXXDNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILD 730
            IDLD               DNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILD
Sbjct: 657  IDLDPSIVPVVPEPTEPIEDNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILD 716

Query: 731  LDDLVEKVDFYLGSNKELFSWFKNFVGYQERTKFIENIVHEKHRLDLDLCEAFGPSYKRL 790
            LDDLVEKVDFYLGSNKELFSWFKNFVGYQE+TK IENIVHEKHRLDLDLCEAFGPSYKRL
Sbjct: 717  LDDLVEKVDFYLGSNKELFSWFKNFVGYQEKTKCIENIVHEKHRLDLDLCEAFGPSYKRL 776

Query: 791  PKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYD 850
            PKSDTFMPCSGRDDMCWE+LNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYD
Sbjct: 777  PKSDTFMPCSGRDDMCWEILNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYD 836

Query: 851  FYIESNLRTIQCLETIVNKIENMTENEKVNFKLPPGLGHTSMTIYKKVIRKVYDKERGFE 910
            FYIESNLRTIQCLETIVNKIENMTE+EK +FKLPPGLGHTSMTIYKKVIRKVYDKERGFE
Sbjct: 837  FYIESNLRTIQCLETIVNKIENMTESEKSDFKLPPGLGHTSMTIYKKVIRKVYDKERGFE 896

Query: 911  IIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQA 970
            IIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQA
Sbjct: 897  IIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQA 956

Query: 971  DKKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQLDFDFPDKNIFCDILYLADSFISH 1030
            DKKLLTTKQLISEI+SIKVDQTNKKIHWLTPKPKSQLDFDFPDK+IF DILYLADSFISH
Sbjct: 957  DKKLLTTKQLISEINSIKVDQTNKKIHWLTPKPKSQLDFDFPDKDIFYDILYLADSFISH 1016

Query: 1031 TTAYSNPDKERLKDLLKYXXXXXXXXXXXXXXXXXQAYKQXXXXXXXXXXXXXXXXRKRS 1090
            TTAYSNPDKERLKDLLKY                 Q +K+                RKR 
Sbjct: 1017 TTAYSNPDKERLKDLLKYFISLFFSIPLEKIEKALQFHKENVSESSGSDDGGSSTSRKRP 1076

Query: 1091 YQQEMTLLDILHRSRYQKLKRSKDEDGKVPQLSEAPDXXXXXXXXXXXXXXXAKNPWLTG 1150
            YQQEM+LLDILHR+RYQKLKRS DE+GK+PQLSE  D               A+NPWLTG
Sbjct: 1077 YQQEMSLLDILHRNRYQKLKRSNDEEGKIPQLSEPLDEESNTIEEEELISEEARNPWLTG 1136

Query: 1151 NLVEEANSQGMIQNRGIFNLFANTNIYIFFRHWTTIYERLLEIKQMNEKVTKEINTRSTV 1210
            NLVEEANSQG+IQNR IFNLFANTNIYIFFRHWTTIYERLLEIKQMN K+TKE+NTRSTV
Sbjct: 1137 NLVEEANSQGIIQNRSIFNLFANTNIYIFFRHWTTIYERLLEIKQMNGKITKEVNTRSTV 1196

Query: 1211 TFAKDLDLLSNQLSEMGLDFIGEDAYKQVLKLSRRLINGDLEHQWFEESLRQAYNNRAFK 1270
            TFAKDLDLLSNQL EMGLDFIGEDAYKQVL+LSRRLINGDLEHQWFEESLRQAYNN+AFK
Sbjct: 1197 TFAKDLDLLSNQLPEMGLDFIGEDAYKQVLRLSRRLINGDLEHQWFEESLRQAYNNKAFK 1256

Query: 1271 LYTIDKVTQSLVKHAHTLMTDAKTAEIMALFVKDRNVTTTSAKGQIIYRLQVRSHMSNTE 1330
            LYTIDKVTQSLVKHAHTLM D KTAEIMALFVKDRN  TTSAK QIIYRLQVRS+MSN E
Sbjct: 1257 LYTIDKVTQSLVKHAHTLMADVKTAEIMALFVKDRNAFTTSAKDQIIYRLQVRSYMSNIE 1316

Query: 1331 NMFRIEFDKRTLHVSIQYIALDDLTLKEPKEDEDKWKYYVTSYALPHPTEGVLHEKLKIP 1390
            NMFRIE +KR+LHVS+QYIALDDLTLKEPK DEDKWKYYVTSY LPHPTEG+ HEKLKIP
Sbjct: 1317 NMFRIELNKRSLHVSVQYIALDDLTLKEPKADEDKWKYYVTSYGLPHPTEGISHEKLKIP 1376

Query: 1391 FLERLIEFGQDIDGKDVDEKFSPEGISVSTLKIKIQPTTYKLDIENGSYDVFTRKSANKY 1450
            FLERLIEFGQD DG++VDE+FSPEGIS+STL+IKIQP TYKL IENGSYDVFTRK+ NKY
Sbjct: 1377 FLERLIEFGQDTDGREVDEEFSPEGISLSTLRIKIQPITYKLHIENGSYDVFTRKAVNKY 1436

Query: 1451 PTVANDDTHKEVVVQKKELISRFLDCAVHLRNDLNESQKISMQEKFESLKDTTAKLNVDG 1510
            PT+ANDD HKE+VVQK  LISRFL+ A+  RNDLNE+ K  MQEK   LK  TAK+N + 
Sbjct: 1437 PTIANDDVHKEMVVQKTALISRFLENAIRSRNDLNEATKSGMQEKLALLKGVTAKVNDEN 1496

Query: 1511 QVVDXXXXXXXXXXXXXXXNL-XXXXXXXXXXXXXXPQDDNIEVMRSTGLSDTETKI 1566
            +V +               NL               PQ  N E   S G S+ ETKI
Sbjct: 1497 EVKELKTEEDLAAKQEQPKNLPTSDANVITSSISNAPQYGNAEAGESPGPSEKETKI 1553

 Score =  633 bits (1633), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/498 (68%), Positives = 365/498 (73%), Gaps = 21/498 (4%)

Query: 1   MSQVWHNPNSQSNDVATSNDAAGSNERNERNEKEPLLXXXXXX---XXXXXXRITLPSLS 57
           MSQVWHN NSQ NDVATSNDAA SNER++   KEP L               RITLPSLS
Sbjct: 1   MSQVWHNSNSQPNDVATSNDAAASNERSD---KEPPLQGRQPSFPGQQQQQQRITLPSLS 57

Query: 58  ALNNKEENGRDSNGQLPLASHGTHILGYPPTHPNIIPSITSDSTFKQSHEYQPHPKXXXX 117
           ALN  +E+ RD NG  PLASH THILGY P H NIIPSI++DS  KQSHEY PHPK    
Sbjct: 58  ALNANDEDRRDYNGAQPLASHATHILGYSPVHSNIIPSISTDSALKQSHEYHPHPKSSSS 117

Query: 118 XXXINTSVMNXXXXXXXXXXXX----XXXXXFSLSRFDNPLPINAPVHTEGSQSYNCPQE 173
              + T+V++                     FSLSRFDNPLPIN  V T+ S+SYN  QE
Sbjct: 118 SPSLKTAVVDTAPATTLAPALAPLPTAGGASFSLSRFDNPLPINTSVCTKDSKSYNGVQE 177

Query: 174 EEKASQQ-TQDHKEVSAGAQPTDATKSAXXXXXXXXXXXXXXXXXXXXXXXXXXXXYRPL 232
           EEKA+QQ  QD +  +  A  ++ + +                             YRPL
Sbjct: 178 EEKANQQQIQDQRPAAHSANASEPSSN----------YVDTSYSVNNENSNDEDPDYRPL 227

Query: 233 NVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPILIQG 292
           NVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPILIQG
Sbjct: 228 NVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPILIQG 287

Query: 293 FNTFLPQGYRIECSTNPDDPIRVTTPMGTTTVNNNISPPERGTIDAQEPSSLPEADGNGT 352
           FNTFLPQGYRIECSTNPDDPIRVTTPMGTTTVNNN+SP  RGT+D QEPSSL E DGN  
Sbjct: 288 FNTFLPQGYRIECSTNPDDPIRVTTPMGTTTVNNNVSPSGRGTVDGQEPSSLSEPDGNAI 347

Query: 353 QRSHNVPMVPSNVYHSEQNQDQQQVLPLSATSTGLPSIQQSEIPVHHQIPQIQPLAVQED 412
           Q  HN+PMVPSNVY SEQ+QDQ+Q LPLSA S GL SI   EIP HHQI Q Q L VQED
Sbjct: 348 QPFHNLPMVPSNVYRSEQSQDQKQSLPLSANSVGLSSIHPPEIPPHHQILQGQSLPVQED 407

Query: 413 VKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQN 472
            KKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQN
Sbjct: 408 AKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQN 467

Query: 473 APDLLEDFKKFLPDSSAS 490
           APDLLEDFKKFLPDSSAS
Sbjct: 468 APDLLEDFKKFLPDSSAS 485

 Score = 32.7 bits (73), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 28/116 (24%), Positives = 54/116 (46%), Gaps = 7/116 (6%)

Query: 372 QDQQQVLPLSATSTGLPSIQQSEIPVHHQI---PQIQPLAVQEDVKKNVDVEFSQAISYV 428
           Q QQQ  P  +  T L   Q  ++PV  +I   P I P+  +       ++  ++ +++ 
Sbjct: 631 QQQQQNPPSISPITDL---QYGDVPVRPEIDLDPSIVPVVPEPTEPIEDNISLNEEVTFF 687

Query: 429 NKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKFL 484
            K K R+     +Y  FL+IL  Y ++   ++++  +V     +  +L   FK F+
Sbjct: 688 EKAK-RYIGNKHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNKELFSWFKNFV 742

>ZYRO0C07524g Chr3 (569197..574209) [5013 bp, 1670 aa] {ON} similar to
            uniprot|P22579 Saccharomyces cerevisiae YOL004W SIN3 DNA
            binding protein involved in transcriptional regulation
          Length = 1670

 Score = 1161 bits (3003), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 562/846 (66%), Positives = 657/846 (77%), Gaps = 5/846 (0%)

Query: 661  QYGDVPVRPEIDLDXXXXXXXXXXXXXXXDNISLNEEVTFFEKAKRYIGNKHLYTEFLKI 720
            QY D+ VRPEIDLD               D++SL EE +FF+KAK++IGNK LYTEFLKI
Sbjct: 759  QYVDIAVRPEIDLDPSIVPVVPEPTEPIEDSLSLVEETSFFDKAKKFIGNKQLYTEFLKI 818

Query: 721  LNLYSQDILDLDDLVEKVDFYLGSNKELFSWFKNFVGYQERTKFIENIVHEKHRLDLDLC 780
            LNLYSQD+LD+D LVEKV+ YLG +KELF+WFKNFVGYQ+R K IEN++HEKHRLDLD+C
Sbjct: 819  LNLYSQDLLDIDGLVEKVEHYLGGSKELFTWFKNFVGYQDRPKNIENVIHEKHRLDLDMC 878

Query: 781  EAFGPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLF 840
            EA GPSYK+LPKSDTFMPCSGRD+MCWEVLNDEW+GHPVWASEDSGFIAHRKNQYEETLF
Sbjct: 879  EASGPSYKKLPKSDTFMPCSGRDEMCWEVLNDEWIGHPVWASEDSGFIAHRKNQYEETLF 938

Query: 841  KIEEERHEYDFYIESNLRTIQCLETIVNKIENMTENEKVNFKLPPGLGHTSMTIYKKVIR 900
            K+EEERHEYDFYIESNLRTIQ LETI +KI NMTE EK NFKLPPGLGHTS+TIYKKVIR
Sbjct: 939  KVEEERHEYDFYIESNLRTIQTLETIASKIANMTEEEKANFKLPPGLGHTSLTIYKKVIR 998

Query: 901  KVYDKERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSL 960
            KVYDKERGFEIIDALHEHPAV  PVVLKRLKQKDEEWRRAQREWNKVWRELEQKV+FKSL
Sbjct: 999  KVYDKERGFEIIDALHEHPAVAVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSL 1058

Query: 961  DHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQLDFDFPDKNIFCDI 1020
            DHLGLTFKQADKKLLTTKQLISEISSIKVDQTNK+IHWLTPKPKSQLD+DFPD+ IFCDI
Sbjct: 1059 DHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKRIHWLTPKPKSQLDYDFPDREIFCDI 1118

Query: 1021 LYLADSFISHTTAYSNPDKERLKDLLKYXXX---XXXXXXXXXXXXXXQAYKQXXXXXXX 1077
            L L + F++HT  YSN DKERLKD LK                         +       
Sbjct: 1119 LSLTEVFLNHTGNYSNSDKERLKDFLKSFLSLFFSIPVSEVNDGLRRRSPSNKEEHEANK 1178

Query: 1078 XXXXXXXXXRKRSYQQEMTLLDILHRSRYQKLK-RSKDEDGKVPQLSEAPDXXXXXXXXX 1136
                      KR  + E+ L DILHR++YQKLK RS  E+G + Q  E  D         
Sbjct: 1179 KENGTALAHGKRPREIELPLRDILHRNKYQKLKLRSDGEEGSIGQSEEGLDEQEEVDEEE 1238

Query: 1137 XXXXXXAKNPWLTGNLVEEANSQGMIQNRGIFNLFANTNIYIFFRHWTTIYERLLEIKQM 1196
                  AK PWL GN+VEEAN+QG+I NR  FNLFANT+IY+FFRH TT+YERL+E+K +
Sbjct: 1239 EIIKQEAKKPWLLGNIVEEANAQGIISNRKSFNLFANTSIYVFFRHLTTLYERLIEVKSI 1298

Query: 1197 NEKVTKEINTRSTVTFAKDLDLLSNQLSEMGLDFIGEDAYKQVLKLSRRLINGDLEHQWF 1256
            +++VT+EIN+R    FAKDL+L+S QL  MGLDF G DAY+Q+L LS+RLI GD+EHQWF
Sbjct: 1299 DQEVTQEINSRKVSQFAKDLNLISEQLKNMGLDFAGLDAYEQLLHLSKRLIEGDIEHQWF 1358

Query: 1257 EESLRQAYNNRAFKLYTIDKVTQSLVKHAHTLMTDAKTAEIMALFVKDRNVTTTSAKGQI 1316
            EESLRQAYNNRAFK YT+DKV Q+LVKHAHT++TD K +EIM LF KDR + TTSAK QI
Sbjct: 1359 EESLRQAYNNRAFKFYTVDKVVQALVKHAHTILTDIKCSEIMVLFEKDRTLATTSAKDQI 1418

Query: 1317 IYRLQVRSHMSNTENMFRIEFDKRTLHVSIQYIALDDLTLKEPKEDEDKWKYYVTSYALP 1376
            +YR+Q RSHMSNTENMFRIEF++ + HV IQYIA+DDLTL E K  EDKWKYYVTSY+L 
Sbjct: 1419 LYRMQARSHMSNTENMFRIEFNRISKHVCIQYIAIDDLTLAEAKSLEDKWKYYVTSYSLS 1478

Query: 1377 HPTEGVLHEKLKIPFLERLIEFGQDIDGKD-VDEKFSPEGISVSTLKIKIQPTTYKLDIE 1435
            HPTEG+ HE L++PFLE++IE  Q+ D  +  D KFSPEG+S S+L+IKI P TY L++E
Sbjct: 1479 HPTEGISHEDLQVPFLEKIIESEQEYDEDNGGDPKFSPEGVSKSSLRIKIDPETYFLEVE 1538

Query: 1436 NGSYDVFTRKSANKYPTVANDDTHKEVVVQKKELISRFLDCAVHLRNDLNESQKISMQEK 1495
             GS DVF+RK+ NK+P   N ++HK  V +K ELI  +LD     + +L+     S++EK
Sbjct: 1539 PGSCDVFSRKAVNKFPLEKNSESHKTKVDKKNELIRGYLDSEKGWKKNLDAKSIQSVEEK 1598

Query: 1496 FESLKD 1501
               +K+
Sbjct: 1599 LNFVKN 1604

 Score =  191 bits (484), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 88/113 (77%), Positives = 97/113 (85%)

Query: 229 YRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPI 288
           YRPLNVKDALSYLEQVKFQF+SRPD+YN FLDIMKDFKSQAIDTPGVIERVSTLFRGYP 
Sbjct: 277 YRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFRGYPN 336

Query: 289 LIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTTTVNNNISPPERGTIDAQEP 341
           LIQGFNTFLPQGYRI+CS NPD+PI+VTTPMG++TV       +      Q+P
Sbjct: 337 LIQGFNTFLPQGYRIDCSQNPDEPIKVTTPMGSSTVAGVAEMNQAALFQGQQP 389

 Score =  146 bits (369), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 78/108 (72%), Positives = 84/108 (77%), Gaps = 7/108 (6%)

Query: 379 PLSATSTGLPSIQQSEIPVHHQIPQIQPLAVQEDVKKNVDVEFSQAISYVNKIKTRFADQ 438
           P SA S+G     Q E+P   Q PQ+      +  KK  DVEFSQAISYVNKIK RF+DQ
Sbjct: 487 PTSAVSSGT-GPTQPEVPAPVQ-PQLA-----DQTKKAADVEFSQAISYVNKIKNRFSDQ 539

Query: 439 PDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKFLPD 486
           PDIYKHFLEILQTYQREQKPINEVYAQVT LFQNAPDLL+DFKKFLPD
Sbjct: 540 PDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKFLPD 587

 Score = 58.9 bits (141), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/82 (37%), Positives = 50/82 (60%), Gaps = 4/82 (4%)

Query: 555 ASSYYGHSNNRGIPQQNLPPIGSFSPPTNGSTVHENYQD--QQHMQPP--HLMPLPSMVQ 610
           A+ Y  +  N+ + +QNLPP+GSFSPP NG+   + YQ+  Q    PP  HL    + V 
Sbjct: 612 ATGYGYYGENQPVARQNLPPLGSFSPPPNGTAPRDYYQEPSQGMALPPMTHLETQAAKVT 671

Query: 611 HGANIVHQGIANENLPLSDLRT 632
               ++ QG++N+ +PLS++R+
Sbjct: 672 PSHYVMTQGMSNDAIPLSNMRS 693

 Score = 55.1 bits (131), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 52/91 (57%), Gaps = 14/91 (15%)

Query: 395 IPVHHQIPQIQPLAVQEDVKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQR 454
           IP+H Q    +PL V++            A+SY+ ++K +F  +PD+Y HFL+I++ ++ 
Sbjct: 270 IPLHDQY--YRPLNVKD------------ALSYLEQVKFQFNSRPDVYNHFLDIMKDFKS 315

Query: 455 EQKPINEVYAQVTHLFQNAPDLLEDFKKFLP 485
           +      V  +V+ LF+  P+L++ F  FLP
Sbjct: 316 QAIDTPGVIERVSTLFRGYPNLIQGFNTFLP 346

 Score = 49.7 bits (117), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 39/62 (62%)

Query: 237 ALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPILIQGFNTF 296
           A+SY+ ++K +FS +PDIY  FL+I++ ++ +      V  +V+ LF+  P L+  F  F
Sbjct: 525 AISYVNKIKNRFSDQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKF 584

Query: 297 LP 298
           LP
Sbjct: 585 LP 586

 Score = 33.9 bits (76), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 51/114 (44%), Gaps = 6/114 (5%)

Query: 376 QVLPLSATSTGLP--SIQQSEIPVHHQI---PQIQPLAVQEDVKKNVDVEFSQAISYVNK 430
           Q +PL+  S   P   +Q  +I V  +I   P I P+  +        +   +  S+ +K
Sbjct: 742 QTIPLTQPSQLGPQQEVQYVDIAVRPEIDLDPSIVPVVPEPTEPIEDSLSLVEETSFFDK 801

Query: 431 IKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKFL 484
            K +F     +Y  FL+IL  Y ++   I+ +  +V H    + +L   FK F+
Sbjct: 802 AK-KFIGNKQLYTEFLKILNLYSQDLLDIDGLVEKVEHYLGGSKELFTWFKNFV 854

>TDEL0G04400 Chr7 (795501..799973) [4473 bp, 1490 aa] {ON} Anc_6.29
            YOL004W
          Length = 1490

 Score = 1157 bits (2994), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 575/968 (59%), Positives = 702/968 (72%), Gaps = 29/968 (2%)

Query: 554  PASSYYGHSNNRGIP--QQNLPPIGSFSPPTNGSTVHENYQDQQHMQPPHLMPLPSMVQ- 610
            PA     + N    P  +QNLPP+GSFSPP NG+  H  Y+DQQ    P  + LP + Q 
Sbjct: 467  PAFGLSAYYNETSPPTSRQNLPPLGSFSPPPNGAVPHNYYRDQQ----PQTLGLPPVAQV 522

Query: 611  -------HGANIVHQGIANENLPLSDLRTSLTEQYAXXXXXXXXXXX--XXXXXXXANSQ 661
                      +I  QGIA E +P+S+LR+ +T Q                       + Q
Sbjct: 523  ENHIDQRSPPHIATQGIAGEPMPVSNLRSQITAQSPSELAQLHQQQQIPSQPTANIPDGQ 582

Query: 662  YGDVPVRPEIDLDXXXXXXXXXXXXXXXDNISLNEEVTFFEKAKRYIGNKHLYTEFLKIL 721
            Y D+ VRPEIDLD               D+++L EE +FF++AK++IGNK +YTEFLKIL
Sbjct: 583  YLDIAVRPEIDLDPSIVPVVPEPTAPIEDSLTLVEETSFFDRAKKFIGNKQIYTEFLKIL 642

Query: 722  NLYSQDILDLDDLVEKVDFYLGSNKELFSWFKNFVGYQERTKFIENIVHEKHRLDLDLCE 781
            NL+SQD+LD+D+LV +V+ YLG NKELF WFKNFVG+Q++ K IENIVHEKHRLDLDLCE
Sbjct: 643  NLFSQDLLDVDELVGRVEHYLGGNKELFVWFKNFVGFQDKPKHIENIVHEKHRLDLDLCE 702

Query: 782  AFGPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFK 841
            A GPSYK+LPKSDTFMPCSGRD+MCW VLNDEWVGHPVWASEDSGFIAHRKNQYEETLFK
Sbjct: 703  ACGPSYKKLPKSDTFMPCSGRDEMCWAVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFK 762

Query: 842  IEEERHEYDFYIESNLRTIQCLETIVNKIENMTENEKVNFKLPPGLGHTSMTIYKKVIRK 901
            IEEERHEYDFYIESNLRTIQ LETI +KI NM+E EK  FKLPPGLGHTS+TIYKKVIRK
Sbjct: 763  IEEERHEYDFYIESNLRTIQTLETIASKIANMSEEEKATFKLPPGLGHTSLTIYKKVIRK 822

Query: 902  VYDKERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLD 961
            VYDKERGFEIIDALHE+PA+  PVVLKRLKQKDEEWRRAQREWNKVWRELEQKV++KSLD
Sbjct: 823  VYDKERGFEIIDALHEYPAIAVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLD 882

Query: 962  HLGLTFKQADKKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQLDFDFPDKNIFCDIL 1021
            HLGLTFKQADKKLLTTKQLISEI SIK DQTNK++HWLTPKPK QLD+  PDK++F DIL
Sbjct: 883  HLGLTFKQADKKLLTTKQLISEIGSIKTDQTNKRMHWLTPKPKDQLDYYVPDKSVFFDIL 942

Query: 1022 YLADSFISHTTAYSNPDKERLKDLLKYXXX---XXXXXXXXXXXXXXQAYKQXXXXXXXX 1078
             L D+FI+H ++YSNPDK RLKDL K                                  
Sbjct: 943  SLTDTFINHNSSYSNPDKIRLKDLFKIFVSLFFSIPMYEVNEAVSRRGNLDDDKEDSTQK 1002

Query: 1079 XXXXXXXXRKRSYQQEMTLLDILHRSRYQKLK-RSKDEDGKVPQLSEAPDXXXXXXXXXX 1137
                     KR  + E++L ++LHR++ Q+ K R+ DE  +                   
Sbjct: 1003 MESDNLNNSKRPREDEISLSEVLHRAKNQRFKSRAADETSEESAAEPE----PELNEEEE 1058

Query: 1138 XXXXXAKNPWLTGNLVEEANSQGMIQNRGIFNLFANTNIYIFFRHWTTIYERLLEIKQMN 1197
                 AK PWL GNLVEE N+QG+I NR  FN+FANTNIY+FFRH TT+YERL E+K+MN
Sbjct: 1059 TIRQEAKKPWLLGNLVEEVNAQGLINNRKTFNMFANTNIYVFFRHLTTLYERLEEVKKMN 1118

Query: 1198 EKVTKEINTRSTVTFAKDLDLLSNQLSEMGLDFIGEDAYKQVLKLSRRLINGDLEHQWFE 1257
            + VTKEIN+R  V FAKDL+L+S QL EMGLDF G DAY+Q+  L +RLI GD+EHQWFE
Sbjct: 1119 DAVTKEINSRKVVQFAKDLNLISQQLKEMGLDFEGADAYEQLRHLCKRLIEGDIEHQWFE 1178

Query: 1258 ESLRQAYNNRAFKLYTIDKVTQSLVKHAHTLMTDAKTAEIMALFVKDRNVTTTSAKGQII 1317
            ESLRQAYNN+AFKLYT+DKV QSLVKHAHT++TD+KT+EIM  F KDR    TSAK QI+
Sbjct: 1179 ESLRQAYNNKAFKLYTVDKVIQSLVKHAHTILTDSKTSEIMTSFEKDRTQINTSAKDQIL 1238

Query: 1318 YRLQVRSHMSNTENMFRIEFDKRTLHVSIQYIALDDLTLKEPKEDEDKWKYYVTSYALPH 1377
            YRLQVRS+MS+TENMFRIE++K++ +V IQ+IA+DDLTL EP+  E+KW+YYVTSY+L H
Sbjct: 1239 YRLQVRSYMSSTENMFRIEYNKQSKNVRIQFIAVDDLTLAEPRSLEEKWRYYVTSYSLSH 1298

Query: 1378 PTEGVLHEKLKIPFLERLIE----FGQDIDGKDVDEKFSPEGISVSTLKIKIQPTTYKLD 1433
            PTEG+  E+L++PFLE+++E    +G D+D   +D KFSPEG+S STLKIKI P TY LD
Sbjct: 1299 PTEGISQEELQLPFLEKVLETEEDYGSDVDNFSID-KFSPEGVSKSTLKIKIDPETYLLD 1357

Query: 1434 IENGSYDVFTRKSANKYPTVANDDTHKEVVVQKKELISRFLDCAVHLRNDLNESQKISMQ 1493
            IE GSYDVF+RKS N++P + + + +     +KK ++ +FL+     + +L++ Q  ++Q
Sbjct: 1358 IEAGSYDVFSRKSVNRFPVIVDSNDYTTKKEKKKNMVIQFLESKKGWKKNLDDDQVKAIQ 1417

Query: 1494 EKFESLKD 1501
            EK   +K+
Sbjct: 1418 EKLARVKE 1425

 Score =  310 bits (795), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 170/271 (62%), Positives = 193/271 (71%), Gaps = 15/271 (5%)

Query: 229 YRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPI 288
           YRPLNVKDALSYLEQVK+QF+SRPD+YN FLDIMKDFKSQAIDTPGVI+RVSTLF+GYP 
Sbjct: 191 YRPLNVKDALSYLEQVKYQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIDRVSTLFKGYPG 250

Query: 289 LIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTTTVNNNISPPERGTIDAQEPSSLPEAD 348
           LIQGFNTFLPQGYRIECS NPD+PIRVTTPMG+++V   I     G   AQ     P   
Sbjct: 251 LIQGFNTFLPQGYRIECSANPDEPIRVTTPMGSSSVAGTIENAVAG-FPAQ-----PRIQ 304

Query: 349 GNGTQRSHNVPMVPSNVYHSEQNQDQQQVLPLSATSTGLPSIQQSEIPVHHQIPQIQPLA 408
                       +P +V    Q          +  +       + ++P  +Q+P +QP A
Sbjct: 305 QLQQLGQQQEQSLPEHVLPGVQVTTSATTT-PTLNNQQPQPQPRPQLPADYQLP-LQPAA 362

Query: 409 VQED-------VKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINE 461
            Q+         KK  DVEFSQAI+YVNKIK RFA+QPDIYKHFLEILQTYQREQKPINE
Sbjct: 363 GQQSQLPSNDQGKKTADVEFSQAINYVNKIKNRFAEQPDIYKHFLEILQTYQREQKPINE 422

Query: 462 VYAQVTHLFQNAPDLLEDFKKFLPDSSASAN 492
           VYAQVT LFQNAPDLL+DFKKFLPDSS SAN
Sbjct: 423 VYAQVTVLFQNAPDLLDDFKKFLPDSSPSAN 453

 Score = 59.3 bits (142), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 69/301 (22%), Positives = 123/301 (40%), Gaps = 61/301 (20%)

Query: 237 ALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPILIQGFNTF 296
           A++Y+ ++K +F+ +PDIY  FL+I++ ++ +      V  +V+ LF+  P L+  F  F
Sbjct: 385 AINYVNKIKNRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKF 444

Query: 297 LPQ--------------------GYRIEC---STNPDDPIRVTTPMGTTTVNNNISPPER 333
           LP                      + +      T+P    +   P+G+       SPP  
Sbjct: 445 LPDSSPSANRQQQQPGVLQQQSPAFGLSAYYNETSPPTSRQNLPPLGS------FSPPPN 498

Query: 334 GTI-----DAQEPSSL-----PEADGNGTQRS---------HNVPMVPSNVYHSEQNQD- 373
           G +       Q+P +L      + + +  QRS            PM  SN+      Q  
Sbjct: 499 GAVPHNYYRDQQPQTLGLPPVAQVENHIDQRSPPHIATQGIAGEPMPVSNLRSQITAQSP 558

Query: 374 -------QQQVLPLSATSTGLPSIQQSEIPVHHQI---PQIQPLAVQEDVKKNVDVEFSQ 423
                  QQQ +P S  +  +P  Q  +I V  +I   P I P+  +        +   +
Sbjct: 559 SELAQLHQQQQIP-SQPTANIPDGQYLDIAVRPEIDLDPSIVPVVPEPTAPIEDSLTLVE 617

Query: 424 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKF 483
             S+ ++ K +F     IY  FL+IL  + ++   ++E+  +V H      +L   FK F
Sbjct: 618 ETSFFDRAK-KFIGNKQIYTEFLKILNLFSQDLLDVDELVGRVEHYLGGNKELFVWFKNF 676

Query: 484 L 484
           +
Sbjct: 677 V 677

>Kpol_1037.22 s1037 (46639..51129) [4491 bp, 1496 aa] {ON}
            (46639..51129) [4491 nt, 1497 aa]
          Length = 1496

 Score = 1119 bits (2894), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 571/979 (58%), Positives = 691/979 (70%), Gaps = 33/979 (3%)

Query: 552  LYPASSYYGHSNNRGIPQQNLPPIGSFSPPTNGSTV---HENYQDQQHMQPPHLMPLPSM 608
            +Y  ++ Y  +       QNLPP+G+FSPP+NG+      E   + QH    H+M LPSM
Sbjct: 453  MYGVNNGYYQAGKIPSANQNLPPLGNFSPPSNGAVPGRPEEFSTEAQH----HMMALPSM 508

Query: 609  VQ----HGANIVHQGIA---NENLPLSDLRT--------------SLTEQYAXXXXXXXX 647
            +Q    H      Q IA   NE +P+SDLR+               L +           
Sbjct: 509  LQAPTEHAQLHAQQHIAPMTNEAIPISDLRSQIIDNNHVHNYTPIELAQLQQQQQQQQQQ 568

Query: 648  XXXXXXXXXXANSQYG-DVPVRPEIDLDXXXXXXXXXXXXXXXDNISLNEEVTFFEKAKR 706
                        + Y  +  VRPEIDLD               +++SL EE  FF+KAK+
Sbjct: 569  QQQQQQQQMQLEAAYATEGIVRPEIDLDPSIVPVIPEPTEPIEESLSLVEEANFFDKAKK 628

Query: 707  YIGNKHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNKELFSWFKNFVGYQERTKFIE 766
            +IGNK +Y EFLKILNLYSQDIL LDDL+EKVD+YLGSNKELF WFKNFVG+Q++ K IE
Sbjct: 629  FIGNKQVYVEFLKILNLYSQDILSLDDLIEKVDYYLGSNKELFDWFKNFVGFQDKPKHIE 688

Query: 767  NIVHEKHRLDLDLCEAFGPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSG 826
            N+VHEKH+LDLDLCEA GPSYK+LPK+DTFMPCSGRD+MCWEVLNDEWVGHPVWASEDSG
Sbjct: 689  NVVHEKHKLDLDLCEACGPSYKKLPKTDTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSG 748

Query: 827  FIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQCLETIVNKIENMTENEKVNFKLPPG 886
            FIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQ LETI +KI NMTE EK  FKLP G
Sbjct: 749  FIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQTLETIASKIANMTEEEKQAFKLPIG 808

Query: 887  LGHTSMTIYKKVIRKVYDKERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNK 946
            LGHTS TIY+KVIRKVYDKERGFEIIDALHE+P+V  PVVLKRLKQKD+EWRRAQREWNK
Sbjct: 809  LGHTSTTIYQKVIRKVYDKERGFEIIDALHEYPSVAVPVVLKRLKQKDKEWRRAQREWNK 868

Query: 947  VWRELEQKVFFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQ 1006
            VWRELEQKVFFKSLDHLGLTFKQ+DKKLLTTKQL++EISSIKVDQTNK+IHWLTPKPKSQ
Sbjct: 869  VWRELEQKVFFKSLDHLGLTFKQSDKKLLTTKQLLAEISSIKVDQTNKRIHWLTPKPKSQ 928

Query: 1007 LDFDFPDKNIFCDILYLADSFISHTTAYSNPDKERLKDLLK-YXXXXXXXXXXXXXXXXX 1065
            LD++  DK +  DIL LAD FI+HT++YSNPDKERL+D L+ Y                 
Sbjct: 929  LDYEVKDKRVLFDILRLADVFINHTSSYSNPDKERLRDFLQSYIGLFFSIPIREIKDAVE 988

Query: 1066 QAYKQXXXXXXXXXXXXXXXXRKRSYQQEMTLLDILHRSRYQKLKRSKDEDGKVPQLSEA 1125
             A                    KR    E+ L DIL+RSRYQ+LK S D       L   
Sbjct: 989  AAIDNGKQLDENEQNSSKKNSNKRPRDVEICLSDILNRSRYQRLKHSLDSSEA--SLGAV 1046

Query: 1126 PDXXXXXXXXXXXXXXXAKNPWLTGNLVEEANSQGMIQNRGIFNLFANTNIYIFFRHWTT 1185
                             AK PWL G+LVEEANSQG+IQNR I+N+FAN N+Y+F R+  T
Sbjct: 1047 SPGQNEQDDMDEMIRQEAKKPWLLGSLVEEANSQGLIQNRKIYNMFANVNMYVFMRNLIT 1106

Query: 1186 IYERLLEIKQMNEKVTKEINTRSTVTFAKDLDLLSNQLSEMGLDFIGEDAYKQVLKLSRR 1245
            IY+RL E+K +N+ VTKEIN R  V FAKDL+L+S QL  MGLDF G D+Y Q+L LS+R
Sbjct: 1107 IYDRLHEVKDINDVVTKEINGRKVVQFAKDLNLISAQLKNMGLDFSGGDSYTQLLLLSKR 1166

Query: 1246 LINGDLEHQWFEESLRQAYNNRAFKLYTIDKVTQSLVKHAHTLMTDAKTAEIMALFVKDR 1305
            LI GDLEHQWFEESLRQAY NRAFKLYTIDKV QSLVKHAH +MTD+K++++MALF KDR
Sbjct: 1167 LIEGDLEHQWFEESLRQAYRNRAFKLYTIDKVIQSLVKHAHAIMTDSKSSDVMALFEKDR 1226

Query: 1306 NVTTTSAKGQIIYRLQVRSHMSNTENMFRIEFDKRTLHVSIQYIALDDLTLKEPKEDEDK 1365
              ++T++K QI+YRLQ RSHMS TE+MFRIE++ +   +SIQYIALDDLTL+EPK  EDK
Sbjct: 1227 ISSSTTSKDQILYRLQTRSHMSTTEHMFRIEYNTKKSSISIQYIALDDLTLEEPKTLEDK 1286

Query: 1366 WKYYVTSYALPHPTEGVLHEKLKIPFLERLIEFGQ-DIDGKDVDEKFSPEGISVSTLKIK 1424
            WKYY+TSY+L HPTEG+  E++KIPFL+++IE  Q  ++ +D + K+SPEG+S S L IK
Sbjct: 1287 WKYYITSYSLSHPTEGIPQEEIKIPFLDKVIESEQVHMEDEDDNPKYSPEGVSKSNLMIK 1346

Query: 1425 IQPTTYKLDIENGSYDVFTRKSANKYPTVANDDTHKEVVVQKKELISRFLDCAVHLRNDL 1484
            I P TY+L++E GS+D+F+RKS NK+P     +++K     ++     FL+     +  L
Sbjct: 1347 IDPETYRLEVEPGSFDIFSRKSVNKFPVDVFSESYKVKKQTRRNRCKNFLNGKHGWKRQL 1406

Query: 1485 NESQKISMQEKFESLKDTT 1503
            +      +++KF  LK+ T
Sbjct: 1407 SSDAISKIEQKFNDLKNGT 1425

 Score =  186 bits (471), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 84/99 (84%), Positives = 92/99 (92%)

Query: 229 YRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPI 288
           YRPLNVKDAL+YLEQVK QF+SRPDIYN FLDIMKDFKSQ+IDTPGVIERVSTLFRGYP 
Sbjct: 121 YRPLNVKDALTYLEQVKLQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPN 180

Query: 289 LIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTTTVNNN 327
           LIQGFNTFLPQGY IECS+NPDDPI+VTTP+G+  V N+
Sbjct: 181 LIQGFNTFLPQGYTIECSSNPDDPIKVTTPLGSQIVTNS 219

 Score =  145 bits (366), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 88/119 (73%), Gaps = 7/119 (5%)

Query: 377 VLPLSATSTGLPS----IQQSEIPVHHQIPQIQPLAVQEDVKKNVDVEFSQAISYVNKIK 432
           VL +S T+TG+ S    I    +P       IQ       ++K  DVEFSQA+SYVNKIK
Sbjct: 318 VLQVSNTNTGISSPSSTIPAGTVPGTTVANNIQGTT---QIEKPADVEFSQAVSYVNKIK 374

Query: 433 TRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKFLPDSSASA 491
            RFADQPDIYKHFLEILQTYQREQKPI+EVYAQVT LFQNAPDLL+DFKKFLPDSS S 
Sbjct: 375 NRFADQPDIYKHFLEILQTYQREQKPISEVYAQVTVLFQNAPDLLDDFKKFLPDSSPSV 433

 Score = 53.9 bits (128), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 41/62 (66%)

Query: 424 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKF 483
           A++Y+ ++K +F  +PDIY HFL+I++ ++ +      V  +V+ LF+  P+L++ F  F
Sbjct: 129 ALTYLEQVKLQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPNLIQGFNTF 188

Query: 484 LP 485
           LP
Sbjct: 189 LP 190

 Score = 49.3 bits (116), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 39/62 (62%)

Query: 237 ALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPILIQGFNTF 296
           A+SY+ ++K +F+ +PDIY  FL+I++ ++ +      V  +V+ LF+  P L+  F  F
Sbjct: 366 AVSYVNKIKNRFADQPDIYKHFLEILQTYQREQKPISEVYAQVTVLFQNAPDLLDDFKKF 425

Query: 297 LP 298
           LP
Sbjct: 426 LP 427

>KAFR0A05120 Chr1 (1015307..1019746) [4440 bp, 1479 aa] {ON} Anc_6.29
            YOL004W
          Length = 1479

 Score = 1116 bits (2887), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 564/965 (58%), Positives = 679/965 (70%), Gaps = 63/965 (6%)

Query: 567  IPQQNLPPIGSFSPPTN-GSTVHENYQDQQHMQPPHLMPLPSMVQH----------GANI 615
            + QQ+LPPIGSFSPP N G ++H+        Q PH+M LPSM+QH             +
Sbjct: 474  VAQQSLPPIGSFSPPANTGISMHD------QSQRPHMMALPSMLQHEQIIDMNNHPKPAV 527

Query: 616  VHQGIANENLPLSD----------------------LRTSLTEQ-------YAXXXXXXX 646
              QGI+N+ +P+SD                      ++  L  Q                
Sbjct: 528  STQGISNDEIPVSDVRMAQYPNGAVPDYGQYPTHPQMKPDLATQRHILQQQEIQQQQLML 587

Query: 647  XXXXXXXXXXXANSQYGDVPVRPEIDLDXXXXXXXXXXXXXXXDNISLNEEVTFFEKAKR 706
                          QY + PVRPEIDLD                N +L EE +FF+KAK+
Sbjct: 588  QQQQEQELLEQQQQQYVEAPVRPEIDLDPSIVPVVPEPTEPIESNFTLIEETSFFDKAKK 647

Query: 707  YIGNKHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNKELFSWFKNFVGYQERTKFIE 766
            +I NK +YTEFLK+LNL+SQD++ +DDLV KV++Y+GS+KELF WF+NFVGYQ   K IE
Sbjct: 648  FINNKQIYTEFLKVLNLFSQDLISVDDLVNKVEYYIGSSKELFEWFRNFVGYQGNPKIIE 707

Query: 767  NIVHEKHRLDLDLCEAFGPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSG 826
            NIVHEKHRLDLDLCEA GPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSG
Sbjct: 708  NIVHEKHRLDLDLCEACGPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSG 767

Query: 827  FIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQCLETIVNKIENMTENEKVNFKLPPG 886
            FIAHRKNQYEETLFKIEEERHEYD+YIESNLRTIQ LE IVNKI NM+E EK NFKL PG
Sbjct: 768  FIAHRKNQYEETLFKIEEERHEYDYYIESNLRTIQTLEAIVNKISNMSEEEKKNFKLEPG 827

Query: 887  LGHTSMTIYKKVIRKVYDKERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNK 946
            LGHTS+TIYKKVIRKVYDKERGFEIIDALHEHPA+ AP+VLKRLKQKDEEWRRAQREWNK
Sbjct: 828  LGHTSLTIYKKVIRKVYDKERGFEIIDALHEHPAIAAPIVLKRLKQKDEEWRRAQREWNK 887

Query: 947  VWRELEQKVFFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQ 1006
            VWRELEQKV+FKSLDHLGLTFKQADKKLLT KQLISEISSIKVDQ NK+IHWLTPKPKSQ
Sbjct: 888  VWRELEQKVYFKSLDHLGLTFKQADKKLLTIKQLISEISSIKVDQNNKRIHWLTPKPKSQ 947

Query: 1007 LDFDFPDKNIFCDILYLADSFISHTTAYSNPDKERLKDLLKYXXX---XXXXXXXXXXXX 1063
            L+FD  D  I  DIL L+++FI+H++ YS  DKERL D LK                   
Sbjct: 948  LNFDIKDFEILFDILSLSENFINHSSTYSTSDKERLNDFLKSFISLFFSVPLNEINNALD 1007

Query: 1064 XXQAYKQXXXXXXXXXXXXXXXXRKRSYQQ-EMTLLDILHRSRYQKLK------RSKDED 1116
                 K                 +KRS    E+++ DILHR++YQK+K       S++E+
Sbjct: 1008 KRNNQKNSEKVTDSALPDGTENQKKRSIHDIELSMSDILHRTKYQKMKLSNRGSDSQEEN 1067

Query: 1117 GKVPQLSEAPDXXXXXXXXXXXXXXXAKNPWLTGNLVEEANSQGMIQNRGIFNLFANTNI 1176
                 + E  D               AK PWL G+++++ N+QG+I +R  FNLFANTNI
Sbjct: 1068 NIDTIIDEESD--ERLAEEADLIRQDAKRPWLLGDIIDKTNTQGIITDRKKFNLFANTNI 1125

Query: 1177 YIFFRHWTTIYERLLEIKQMNEKVTKEINTRSTVTFAKDLDLLSNQLSEMGLDFIGEDAY 1236
            Y+F RHWTT+YERLLE+K+MN +VTKEIN R +V FA+DL L+S QL  MGLDF+ +D+Y
Sbjct: 1126 YVFLRHWTTLYERLLELKEMNGEVTKEINNRKSVKFAEDLGLVSTQLKNMGLDFVDKDSY 1185

Query: 1237 KQVLKLSRRLINGDLEHQWFEESLRQAYNNRAFKLYTIDKVTQSLVKHAHTLMTDAKTAE 1296
            +++L+LS+RLI  D+EHQWFEESLRQAYNNRAFKLYT+DKV Q+LVKH HTLMTD KT E
Sbjct: 1186 EELLRLSKRLIENDIEHQWFEESLRQAYNNRAFKLYTVDKVVQALVKHGHTLMTDYKTTE 1245

Query: 1297 IMALFVKDRNVTTTSAKGQIIYRLQVRSHMSNTENMFRIEFDKRTLHVSIQYIALDDLTL 1356
            +M LF KDR  + TSAK QI+YRLQ RSHMSNTE MFRIE++K   ++ IQYIALDDLTL
Sbjct: 1246 VMKLFEKDRLSSATSAKDQILYRLQARSHMSNTEYMFRIEYNKDDRNICIQYIALDDLTL 1305

Query: 1357 KEPKEDEDKWKYYVTSYALPHPTEGVLHEKLKIPFLERLIEFGQDIDGKDV-----DEKF 1411
            KE   +E+KWKYYVTSY+LPHPTEG+ HE L+IPFL++++EF Q+    +      + K+
Sbjct: 1306 KEGNTEEEKWKYYVTSYSLPHPTEGIDHESLQIPFLQKILEFDQEELENNDEENKSNGKY 1365

Query: 1412 SPEGISVSTLKIKIQPTTYKLDIENGSYDVFTRKSANKYPTVANDDTHKEVVVQKKELIS 1471
            SPEG+S S  KIKI P  Y LDI+ GS+D+F+RKS NKYP   N+D     + +KK +++
Sbjct: 1366 SPEGVSNSMYKIKIHPGNYALDIQTGSFDIFSRKSLNKYPVKVNEDHESLKLNKKKNILN 1425

Query: 1472 RFLDC 1476
             FL+ 
Sbjct: 1426 TFLES 1430

 Score =  303 bits (776), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 164/262 (62%), Positives = 186/262 (70%), Gaps = 36/262 (13%)

Query: 229 YRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPI 288
           YRPLNVKDALSYLEQVK QF+SRPDIYN FLDIMKDFKSQ IDTPGVIERVSTLFRGYP 
Sbjct: 210 YRPLNVKDALSYLEQVKQQFNSRPDIYNQFLDIMKDFKSQTIDTPGVIERVSTLFRGYPS 269

Query: 289 LIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTTTVNNNISPPERGTIDAQEPSSLPEAD 348
           LIQGFNTFLP GYRI+C +NP+DPI+VTTP+G++T++      +R   + Q+  +L    
Sbjct: 270 LIQGFNTFLPTGYRIDCPSNPNDPIKVTTPIGSSTLHEMTRSVQRANSNLQQQQAL---- 325

Query: 349 GNGTQRSHNVPMVPSNVYHSEQNQDQQQVLPLSATS--TGLPSIQQSEIPVHHQIPQIQP 406
                              S+ N  QQ  +P+ + S    L +  QS   V  Q  Q   
Sbjct: 326 -------------------SQNNMMQQAQIPIGSISNNANLNAAVQS---VDDQAKQAN- 362

Query: 407 LAVQEDVKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQV 466
                  KK  DVEFSQAI+YVNKIK RFADQPDIYK+FLEILQTYQREQKPINEVYAQV
Sbjct: 363 -------KKPADVEFSQAINYVNKIKNRFADQPDIYKNFLEILQTYQREQKPINEVYAQV 415

Query: 467 THLFQNAPDLLEDFKKFLPDSS 488
           T LFQNAPDLL+DFKKFLPDSS
Sbjct: 416 TILFQNAPDLLDDFKKFLPDSS 437

>KNAG0F02920 Chr6 (552441..556919) [4479 bp, 1492 aa] {ON} Anc_6.29
            YOL004W
          Length = 1492

 Score = 1107 bits (2862), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 547/956 (57%), Positives = 672/956 (70%), Gaps = 41/956 (4%)

Query: 563  NNRGI--------PQQNLPPIGSFSPPTNGSTVHEN----YQDQQHMQPPHLMPLPSMVQ 610
            NN G+        PQ NLPPIGSFSPP NG          + D+QH+    +  +P+M  
Sbjct: 477  NNTGVYYPPQVNQPQSNLPPIGSFSPPANGVAPTTGTAIPHADEQHV----VAGVPAMAP 532

Query: 611  HGANIVHQGIANENLPLSDLRTSLT----EQYAXXXXXXXXXXXXXXXXXXANSQY---- 662
            H        I N+ + +S++R   T     QY                      Q     
Sbjct: 533  HEQQHAPSMINNDGIQISNMRGGGTVPALNQYGMISPHDYTQQQAKQVQQFQEDQQQQQQ 592

Query: 663  -----------GDVPVRPEIDLDXXXXXXXXXXXXXXXDNISLNEEVTFFEKAKRYIGNK 711
                       GD+ VRPEIDLD               +N+SL+EE +FFEK K+ IGN+
Sbjct: 593  QSMMMDEQYGSGDMQVRPEIDLDPSIVPVVPEPTEPIENNLSLSEETSFFEKVKKNIGNR 652

Query: 712  HLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNKELFSWFKNFVGYQERTKFIENIVHE 771
             +Y EFLK+LNL+SQD++ +D+LV KV+ YL    ELF WFKNFVGYQ++ K IEN++HE
Sbjct: 653  QIYIEFLKVLNLFSQDLIAVDELVTKVENYLAGQPELFEWFKNFVGYQDKPKIIENVIHE 712

Query: 772  KHRLDLDLCEAFGPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHR 831
            KHRLDLDLCEA+GPSYK+LPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHR
Sbjct: 713  KHRLDLDLCEAYGPSYKKLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHR 772

Query: 832  KNQYEETLFKIEEERHEYDFYIESNLRTIQCLETIVNKIENMTENEKVNFKLPPGLGHTS 891
            KNQYEETLFKIEEERHEYDFYIESNLRTIQ LETI +KI NMTE EK  FKLPPGLGHTS
Sbjct: 773  KNQYEETLFKIEEERHEYDFYIESNLRTIQTLETIASKIANMTEEEKNMFKLPPGLGHTS 832

Query: 892  MTIYKKVIRKVYDKERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWREL 951
            +TIYKK+IRKVYDKERGFEIID LHEHPA+T P+VLKRLKQKDEEWRRAQREWNKVWREL
Sbjct: 833  LTIYKKIIRKVYDKERGFEIIDELHEHPAITVPIVLKRLKQKDEEWRRAQREWNKVWREL 892

Query: 952  EQKVFFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQLDFDF 1011
            EQKV+FKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQ NK++HWLTPKPK QLD+ F
Sbjct: 893  EQKVYFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQNNKRMHWLTPKPKKQLDYQF 952

Query: 1012 PDKNIFCDILYLADSFISHTTAYSNPDKERLKDLLKYXXXXXXXXXXXXXXXXXQAYKQX 1071
             D +I  DI+ L D F+ H + YSNPDKERLKDL +                        
Sbjct: 953  NDMDIIFDIVGLTDVFVDHCSTYSNPDKERLKDLFRVFISLFFFIPRDLISAALDTKSDE 1012

Query: 1072 XXXXXXXXXXXXXXXRKRSYQQEMTLLDILHRSRYQKLKRSKDEDGKVPQLSEAPDXXXX 1131
                           ++     E++L DILHR++YQKLK     +G+   +SE  D    
Sbjct: 1013 GKSTDTKFEKADDSKKRPRPDVELSLSDILHRAKYQKLK-----NGEGLGMSEDDDEEKL 1067

Query: 1132 XXXXXXXXXXXAKNPWLTGNLVEEANSQGMIQNRGIFNLFANTNIYIFFRHWTTIYERLL 1191
                       A  PWL G++VE ANS G++ +R ++NLF NTN+YIF RHW+T+Y RLL
Sbjct: 1068 AKEAEEMSEKNASKPWLVGDIVERANSHGLVTDRAVYNLFGNTNVYIFIRHWSTLYGRLL 1127

Query: 1192 EIKQMNEKVTKEINTRSTVTFAKDLDLLSNQLSEMGLDFIGEDAYKQVLKLSRRLINGDL 1251
            E+KQM+E+VTKEIN R  V FA+DL+LLS QL +MGLDF G++AY++ LKLS+RLI  +L
Sbjct: 1128 ELKQMDERVTKEINNRKVVQFAEDLNLLSTQLRDMGLDFDGKNAYQETLKLSKRLIRNEL 1187

Query: 1252 EHQWFEESLRQAYNNRAFKLYTIDKVTQSLVKHAHTLMTDAKTAEIMALFVKDRNVTTTS 1311
            EHQWFEESLRQAYNN+AFKLYT+DKV  SLVKHAHTLMTD K++E+M LF KDR  ++T 
Sbjct: 1188 EHQWFEESLRQAYNNKAFKLYTVDKVVHSLVKHAHTLMTDNKSSELMELFEKDRLQSSTC 1247

Query: 1312 AKGQIIYRLQVRSHMSNTENMFRIEFDKRTLHVSIQYIALDDLTLKEPKEDEDKWKYYVT 1371
             K QI+YRL  RSHMS+TENMFR++++K T HVSIQYI LDD+TL++ K+D ++W YY+T
Sbjct: 1248 VKDQILYRLLTRSHMSSTENMFRVQYNKDTRHVSIQYIGLDDVTLEDAKDDNERWNYYMT 1307

Query: 1372 SYALPHPTEGVLHEKLKIPFLERLIEFGQD-IDGKDVDEKFSPEGISVSTLKIKIQPTTY 1430
            SYALPHPTEG++ +KL +PFLER++EF  D +D +   ++++P G S S LKI I P TY
Sbjct: 1308 SYALPHPTEGIMQDKLVVPFLERILEFENDMLDVEAGSDRYNPVGTSYSKLKINIDPKTY 1367

Query: 1431 KLDIENGSYDVFTRKSANKYPTVANDDTHKEVVVQKKELISRFLDCAVHLRNDLNE 1486
            KL I++GSYD+F+R S N+YP   +   + ++V ++KE   +FLD     + DL++
Sbjct: 1368 KLIIQDGSYDIFSRSSINEYPIRPDSKGYVQMVEKRKETAQKFLDGRFGWKKDLSD 1423

 Score =  299 bits (765), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 171/266 (64%), Positives = 191/266 (71%), Gaps = 37/266 (13%)

Query: 229 YRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPI 288
           YRPLNVKDALSYLEQVK QF+SRP IYN FLDIMKDFKSQ IDTPGVIERVSTLF+G+P 
Sbjct: 218 YRPLNVKDALSYLEQVKLQFNSRPYIYNQFLDIMKDFKSQNIDTPGVIERVSTLFKGFPA 277

Query: 289 LIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTTTVNNNISPPERGT-IDA-QEPS--SL 344
           LIQGFNTFLPQGYRIECS+NP++PI+VTTPMG   V  N+    RG+ I A Q+P+   L
Sbjct: 278 LIQGFNTFLPQGYRIECSSNPNEPIKVTTPMG---VLENV----RGSDITADQQPAIGQL 330

Query: 345 PEADGNGTQRSHNVPMVPSNVYHSEQNQDQQQVLPLSATSTGLPSIQQSEIPVHHQIPQI 404
           P      TQ      + P    H          L L +T     ++QQS   VH      
Sbjct: 331 PT-----TQSPIQASLPPPQSAH----------LHLPSTVAAATTVQQSA-NVH------ 368

Query: 405 QPLAVQEDVKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYA 464
                + + KK  DVEFSQAISYVNKIK RF+DQPDIYK+FLEILQTYQREQKPINEVYA
Sbjct: 369 ----AENEPKKANDVEFSQAISYVNKIKNRFSDQPDIYKNFLEILQTYQREQKPINEVYA 424

Query: 465 QVTHLFQNAPDLLEDFKKFLPDSSAS 490
           QVT LF NAPDLL+DFKKFLPDSSAS
Sbjct: 425 QVTVLFHNAPDLLDDFKKFLPDSSAS 450

 Score = 60.8 bits (146), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 70/323 (21%), Positives = 125/323 (38%), Gaps = 84/323 (26%)

Query: 237 ALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPILIQGFNTF 296
           A+SY+ ++K +FS +PDIY  FL+I++ ++ +      V  +V+ LF   P L+  F  F
Sbjct: 384 AISYVNKIKNRFSDQPDIYKNFLEILQTYQREQKPINEVYAQVTVLFHNAPDLLDDFKKF 443

Query: 297 LP--------------------------QGYRIECSTNPDDPIRVTTPMGTTTVNNNISP 330
           LP                          +GY +  +T    P +V  P        + SP
Sbjct: 444 LPDSSASNEQQPKQSPYSPQVYSGADMARGY-MYNNTGVYYPPQVNQPQSNLPPIGSFSP 502

Query: 331 PERGTIDAQEPSSLPEADGNGTQRSHNVPMVPSNVYHSEQ------NQDQQQVLPLSATS 384
           P  G +     +++P AD       H V  VP+   H +Q      N D  Q+  +    
Sbjct: 503 PANG-VAPTTGTAIPHAD-----EQHVVAGVPAMAPHEQQHAPSMINNDGIQISNMRGGG 556

Query: 385 TGLPSIQQ----------------------------------------SEIPVHHQI--- 401
           T +P++ Q                                         ++ V  +I   
Sbjct: 557 T-VPALNQYGMISPHDYTQQQAKQVQQFQEDQQQQQQQSMMMDEQYGSGDMQVRPEIDLD 615

Query: 402 PQIQPLAVQEDVKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINE 461
           P I P+  +       ++  S+  S+  K+K    ++  IY  FL++L  + ++   ++E
Sbjct: 616 PSIVPVVPEPTEPIENNLSLSEETSFFEKVKKNIGNR-QIYIEFLKVLNLFSQDLIAVDE 674

Query: 462 VYAQVTHLFQNAPDLLEDFKKFL 484
           +  +V +     P+L E FK F+
Sbjct: 675 LVTKVENYLAGQPELFEWFKNFV 697

>NCAS0D02130 Chr4 (394326..398630) [4305 bp, 1434 aa] {ON} Anc_6.29
            YOL004W
          Length = 1434

 Score = 1093 bits (2826), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 560/979 (57%), Positives = 682/979 (69%), Gaps = 50/979 (5%)

Query: 554  PASSYYGHSNN---RGI-PQQNLPPIGSFSPPTNGSTVHENYQDQQHMQPPHLMPLPSMV 609
            P    YG+ NN    G   QQNLPPIGSF+PP NG+   E     Q + P  L   PSM+
Sbjct: 452  PKHQQYGYPNNYYPNGTGTQQNLPPIGSFAPP-NGTASREYAPGNQFVGPGGL---PSMI 507

Query: 610  QHG--------ANIVHQGIANENLPLSDLRTSLT-EQYAXXXXXXXXXXXXXXXXXXANS 660
             +           +VH G  NE +P+S+LR+ LT +QY                   A +
Sbjct: 508  PNDQALQQQQQPGLVH-GYTNEAIPVSNLRSPLTDQQYPNLLNMQNQMTPGQMDINNATA 566

Query: 661  ----QY-GDVPVRPEIDLDXXXXXXXXXXXXXXXDNISLNEEVTFFEKAKRYIGNKHLYT 715
                QY  + P+RPEIDLD                N+SL EE  FFEKAK++IG K +YT
Sbjct: 567  PMAQQYTNEAPIRPEIDLDPSIVPVIPEPTEPLEYNVSLVEETNFFEKAKKFIGTKQVYT 626

Query: 716  EFLKILNLYSQDILDLDDLVEKVDFYLGSNKELFSWFKNFVGYQERTKFIENIVHEKHRL 775
            EFLKILNLYSQD+L  D+L  KV++YLGSN+ELF+WFKNFVG+QE+   IENIVHEKH+L
Sbjct: 627  EFLKILNLYSQDLLTTDELCVKVEYYLGSNEELFTWFKNFVGFQEKPLIIENIVHEKHKL 686

Query: 776  DLDLCEAFGPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQY 835
            DLDLCEA GPSYK+LPK+DTFMPCSGRD+MCWEVLNDEWVGHPVWASEDSGFIAHRKNQY
Sbjct: 687  DLDLCEACGPSYKKLPKTDTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQY 746

Query: 836  EETLFKIEEERHEYDFYIESNLRTIQCLETIVNKIENMTENEKVNFKLPPGLGHTSMTIY 895
            EE+LFK EEERHEYDF IESNLRTIQ LETI NKI NMT  EK NFKLPPGLGHTS TIY
Sbjct: 747  EESLFKTEEERHEYDFCIESNLRTIQTLETIANKIGNMTNEEKKNFKLPPGLGHTSSTIY 806

Query: 896  KKVIRKVYDKERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKV 955
            KKVIRKVYDK+RGFEIID LHE PA+T PVVLKRLKQKDEEWRRAQREWNKVWRELEQKV
Sbjct: 807  KKVIRKVYDKDRGFEIIDLLHEEPALTVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKV 866

Query: 956  FFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQLDFDFPDKN 1015
            ++KSLDHLGLTFKQADKKLLTTKQL+SEISSIKVDQTNK+IHWLTPKPKSQL+F F D +
Sbjct: 867  YYKSLDHLGLTFKQADKKLLTTKQLLSEISSIKVDQTNKRIHWLTPKPKSQLEFQFDDND 926

Query: 1016 IFCDILYLADSFISHTTAYSNPDKERLKDLL-------------KYXXXXXXXXXXXXXX 1062
            IF DIL L   FI+H++ YSNP+KER+KD L             K               
Sbjct: 927  IFVDILGLTSVFINHSSTYSNPEKERMKDFLRVFVSLFFSIPLDKVNEALSDRSHWLQEK 986

Query: 1063 XXXQAYKQXXXXXXXXXXXXXXXXRKRSYQQEMTLLDILHRSRYQKLKRSKDEDGKVPQL 1122
                                    +KR    ++ L DIL + +YQK+++   E  +    
Sbjct: 987  EKKTKESSRNIDSTTSSSSSGSNSKKRPLNIDIPLADILRKHKYQKIRKQAKESNEENAQ 1046

Query: 1123 SE-------APDXXXXXXXXXXXXXXXAKNPWLTGNLVEEANSQGMIQNRGIFNLFANTN 1175
             E         +                K PWL GN++E A++ G I NR +FN+FANTN
Sbjct: 1047 EEDDENIVGDSNEELNEQDENEIILEEIKRPWLLGNIIETASNHGTISNRKVFNMFANTN 1106

Query: 1176 IYIFFRHWTTIYERLLEIKQMNEKVTKEINTRSTVTFAKDLDLLSNQLSEMGLDFIGEDA 1235
            IY+FFR WT IYERL E+KQ+NEKVTKE+N+R    FAKDL+L+S QL +MGLDF+G ++
Sbjct: 1107 IYVFFRLWTVIYERLYEMKQINEKVTKEVNSRRISQFAKDLNLISTQLKDMGLDFVGVNS 1166

Query: 1236 YKQVLKLSRRLINGDLEHQWFEESLRQAYNNRAFKLYTIDKVTQSLVKHAHTLMTDAKTA 1295
            Y+++L LS+RLI  D+EHQWFEESLRQA+NN+AFKLYT+DKV QSLVKHAHT++ D KT+
Sbjct: 1167 YQELLVLSKRLIQNDIEHQWFEESLRQAFNNKAFKLYTVDKVIQSLVKHAHTILGDVKTS 1226

Query: 1296 EIMALFVKDRNVTTTSAKGQIIYRLQVRSHMSNTENMFRIEFDKRTLHVSIQYIALDDLT 1355
            EIM LF KDR  ++TSAK QI+YRLQ R+HM+NTENMFRIEF++   HV IQYIAL+DLT
Sbjct: 1227 EIMVLFEKDRLCSSTSAKEQILYRLQTRAHMTNTENMFRIEFNEEKNHVCIQYIALEDLT 1286

Query: 1356 LKEPKEDEDKWKYYVTSYALPHPTEGVLHEKLKIPFLERLIEFGQDIDGKDVDEKFSPEG 1415
            +K+PK  E  W+YYVTSY+LPHPTEGV  ++LKIPFLE+ +E   D +G   D K SPEG
Sbjct: 1287 IKQPKSMEKNWEYYVTSYSLPHPTEGVPQDELKIPFLEKTLELEVDEEG---DNKSSPEG 1343

Query: 1416 ISVSTLKIKIQPTTYKLDIENGSYDVFTRKSANKYPTVANDDTHKEVVVQKKELISRFLD 1475
            +S S LKIKI P +Y L+IE GS+D+F+RKS N YPT +++   ++ + Q    +++FLD
Sbjct: 1344 VSSSKLKIKIDPKSYALEIEPGSFDLFSRKSMNVYPTYSDETKKRKSIDQ----MTKFLD 1399

Query: 1476 CAVHLRNDLNESQKISMQE 1494
                 + +L  +   ++++
Sbjct: 1400 GKNGWKKNLTTADSTNIED 1418

 Score =  310 bits (794), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 163/265 (61%), Positives = 192/265 (72%), Gaps = 41/265 (15%)

Query: 229 YRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPI 288
           YRPLNVKDALSYLEQVK+QFS RPDIYN FLDIMKDFKSQ+IDTPGVIERVS LFRGYP+
Sbjct: 207 YRPLNVKDALSYLEQVKYQFSQRPDIYNQFLDIMKDFKSQSIDTPGVIERVSALFRGYPM 266

Query: 289 LIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTTTVNNNISPPERGTIDAQEPSSLPEAD 348
           L+QGFNTFLPQGYRIEC+T+PD PIRVTTPMGT+T++        G    + PSS   ++
Sbjct: 267 LVQGFNTFLPQGYRIECTTDPDGPIRVTTPMGTSTLS--------GGPAMEAPSS---SE 315

Query: 349 GN-GTQRSHNVPMVPSNVYHSEQNQDQQQVLPLSATSTGLPSIQQSEIPVHHQIPQIQPL 407
            N   Q+ H  P +PS                L+A++    + QQ+  P           
Sbjct: 316 SNLQQQQHHQSPTIPS----------------LAASTFQESNFQQTPQP----------- 348

Query: 408 AVQEDVKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVT 467
             ++   KN +VEFSQAI+YVNKIK RFADQPDIYK FLEILQTYQREQKPINEVY+QVT
Sbjct: 349 --EDQSAKNAEVEFSQAINYVNKIKNRFADQPDIYKRFLEILQTYQREQKPINEVYSQVT 406

Query: 468 HLFQNAPDLLEDFKKFLPDSSASAN 492
            LFQ+APDLL+DFKKFLP+SS + +
Sbjct: 407 VLFQHAPDLLDDFKKFLPESSGTTS 431

 Score = 50.4 bits (119), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 68/306 (22%), Positives = 121/306 (39%), Gaps = 59/306 (19%)

Query: 237 ALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPILIQGFNTF 296
           A++Y+ ++K +F+ +PDIY  FL+I++ ++ +      V  +V+ LF+  P L+  F  F
Sbjct: 363 AINYVNKIKNRFADQPDIYKRFLEILQTYQREQKPINEVYSQVTVLFQHAPDLLDDFKKF 422

Query: 297 LPQGYRIECSTNPDDPIRVTTPMGTTTVN---------NNISPPERGTIDAQEP------ 341
           LP+      ++       +       T N         NN  P   GT     P      
Sbjct: 423 LPESSGTTSTSELPQNAGIQQRAAIPTPNPKHQQYGYPNNYYPNGTGTQQNLPPIGSFAP 482

Query: 342 ----SSLPEADGNGTQRSHNVP-MVPSN----------VYHSEQNQ------------DQ 374
               +S   A GN       +P M+P++          + H   N+            DQ
Sbjct: 483 PNGTASREYAPGNQFVGPGGLPSMIPNDQALQQQQQPGLVHGYTNEAIPVSNLRSPLTDQ 542

Query: 375 Q---------QVLP--LSATSTGLPSIQQ--SEIPVHHQI---PQIQPLAVQEDVKKNVD 418
           Q         Q+ P  +   +   P  QQ  +E P+  +I   P I P+  +       +
Sbjct: 543 QYPNLLNMQNQMTPGQMDINNATAPMAQQYTNEAPIRPEIDLDPSIVPVIPEPTEPLEYN 602

Query: 419 VEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLE 478
           V   +  ++  K K +F     +Y  FL+IL  Y ++    +E+  +V +   +  +L  
Sbjct: 603 VSLVEETNFFEKAK-KFIGTKQVYTEFLKILNLYSQDLLTTDELCVKVEYYLGSNEELFT 661

Query: 479 DFKKFL 484
            FK F+
Sbjct: 662 WFKNFV 667

>SAKL0E01540g Chr5 complement(114922..119169) [4248 bp, 1415 aa] {ON}
            similar to uniprot|Q75CF0 Ashbya gossypii ACL004W
            ACL004Wp and some similarites with YOL004W uniprot|P22579
            Saccharomyces cerevisiae YOL004W SIN3 DNA binding protein
            involved in transcriptional regulation
          Length = 1415

 Score = 1066 bits (2758), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 552/953 (57%), Positives = 681/953 (71%), Gaps = 27/953 (2%)

Query: 554  PASSYYGHSNNRGIPQQNLPPIGSFSPPTNGSTVHENYQDQQHMQPPHLMPLPSMVQHGA 613
            PA    G    +  PQQNLPP+GSFS          + ++ +H+  P + P PSM   G 
Sbjct: 416  PAPVNGGTFYPQAAPQQNLPPLGSFS-----PPSSGSAREGEHVGLPAVQP-PSMDISGQ 469

Query: 614  ---NIVHQGIANENLPLSDLRTSLTEQYAXXXXXXXXXXXXXXXXXXANSQYGDVPVRPE 670
               +I+ QG++N+++P+S++R +    Y                      QY +   RPE
Sbjct: 470  PQQHIITQGMSNDDIPISEVRNTADGAY------------RSDLRNSGEVQYMEPVARPE 517

Query: 671  IDLDXXXXXXXXXXXXXXXDNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILD 730
            IDLD               + +SL EE +FF+KAK++IGNK +YTEFLKILNLYSQD+LD
Sbjct: 518  IDLDPSLVPVIPEPIEPMENEVSLVEETSFFDKAKKFIGNKQIYTEFLKILNLYSQDLLD 577

Query: 731  LDDLVEKVDFYLGSNKELFSWFKNFVGYQERTKFIENIVHEKHRLDLDLCEAFGPSYKRL 790
             D+LVEKV++YLG NKELF WFKNFVGY+++ K IENIVHEKHRLDLDLCEA GPSYK+L
Sbjct: 578  RDELVEKVEYYLGGNKELFDWFKNFVGYEKKPKHIENIVHEKHRLDLDLCEACGPSYKKL 637

Query: 791  PKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYD 850
            PK+DTFMPCSGRD+MCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYD
Sbjct: 638  PKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYD 697

Query: 851  FYIESNLRTIQCLETIVNKIENMTENEKVNFKLPPGLGHTSMTIYKKVIRKVYDKERGFE 910
            FYIE+NLRTIQ LETI NKI NMT  EK  FKL PGLGHTS+TIYKKVIRKVYDK+RGFE
Sbjct: 698  FYIEANLRTIQTLETIANKIANMTPEEKATFKLSPGLGHTSVTIYKKVIRKVYDKDRGFE 757

Query: 911  IIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQA 970
            IIDALHE P++  P+VLKRLKQKDEEWRRAQREWNKVWRELEQKV++KSLDHLGLTFKQA
Sbjct: 758  IIDALHETPSIAVPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQA 817

Query: 971  DKKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQLDFDFPDKNIFCDILYLADSFISH 1030
            DKKLLTTKQL+SEIS+IKVDQ NK+IH LTPKPKSQLD+ F D+ +  DIL LA  FI  
Sbjct: 818  DKKLLTTKQLVSEISTIKVDQANKRIHPLTPKPKSQLDYHFKDREVLYDILNLAKVFIDC 877

Query: 1031 TTAYSNPDKERLKDLLKYXXXXXXXXXXXXXXXXXQAYK---QXXXXXXXXXXXXXXXXR 1087
             T YSNPDKE++ D LK                     +                    R
Sbjct: 878  NTTYSNPDKEKMFDFLKSFLVLFFSYPMYEVETAFARRRGDIGVQDGEENSGQENSDLSR 937

Query: 1088 KRSYQQEMTLLDILHRSRYQKLKRSKDEDGKVPQLSEAPDXXXXXXXXXXXXXXXAKNPW 1147
            KR+ ++E  L D+L R++YQK  R+  E+  +P+ SE  +               AK PW
Sbjct: 938  KRTREEENLLKDVLRRNKYQK-GRNFAEEEPIPEESEFAEKTVEEKEEEEIIRQEAKKPW 996

Query: 1148 LTGNLVEEANSQGMIQNRGIFNLFANTNIYIFFRHWTTIYERLLEIKQMNEKVTKEINTR 1207
            L G++V+EAN  G ++NR  FN+FANTNIY+FFRH  T+Y RL E+K +NE VT+EI  R
Sbjct: 997  LLGSIVDEANEHGFVENRKTFNMFANTNIYVFFRHLATLYTRLSEVKDINEAVTEEIKNR 1056

Query: 1208 STVTFAKDLDLLSNQLSEMGLDFIGEDAYKQVLKLSRRLINGDLEHQWFEESLRQAYNNR 1267
              V FAKDL+L+S QLS+MGLDF G DAY QVL LS+RLI GD+EHQWFEESLRQAY N+
Sbjct: 1057 KVVQFAKDLNLISTQLSDMGLDFEGADAYGQVLTLSKRLIEGDIEHQWFEESLRQAYKNK 1116

Query: 1268 AFKLYTIDKVTQSLVKHAHTLMTDAKTAEIMALFVKDRNVTTTSAKGQIIYRLQVRSHMS 1327
            AFK+YTIDKV QSLVKHAHT++TD KT EIM LF KDR    TSAK QI+YRLQVRSHM+
Sbjct: 1117 AFKIYTIDKVVQSLVKHAHTIITDPKTVEIMILFEKDRTCLNTSAKEQILYRLQVRSHMT 1176

Query: 1328 NTENMFRIEFDKRTLHVSIQYIALDDLTLKEPKEDEDKWKYYVTSYALPHPTEGVLHEKL 1387
              ENMFRIE+++++ H SIQ++A+DDLTL+EPK  ED+WKYYVTSY+L HPTEG+ HE+L
Sbjct: 1177 TAENMFRIEYNRQSTHASIQFVAVDDLTLEEPKSLEDRWKYYVTSYSLSHPTEGISHEEL 1236

Query: 1388 KIPFLERLIEFGQDIDGKDVDEKFSPEGISVSTLKIKIQPTTYKLDIENGSYDVFTRKSA 1447
            + PFLE+++E  ++   ++ +  +SPEG+S S LK+KI P TY LD++ GSYD F+RKS 
Sbjct: 1237 QPPFLEKILEKEEEFQCENGE--YSPEGVSSSNLKVKINPETYSLDVQPGSYDFFSRKSI 1294

Query: 1448 NKYPTVANDDTHKEVVVQKKELISRFLDCAVHLRNDLNESQKISMQEKFESLK 1500
            NK+P   N+DT+K    +K + ++ +L+ A   +  L  S+ +  Q + E +K
Sbjct: 1295 NKFPIEINNDTYKSKRGEKAKCLTSYLNGAKGWKRGLVASKVLKAQTEIEYVK 1347

 Score =  291 bits (745), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 166/267 (62%), Positives = 190/267 (71%), Gaps = 21/267 (7%)

Query: 229 YRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPI 288
           YRPLNVKDALSYLEQVKFQF++RPD+YN FLDIMKDFKSQAIDTPGVIERVS LF+GYP 
Sbjct: 158 YRPLNVKDALSYLEQVKFQFNNRPDVYNHFLDIMKDFKSQAIDTPGVIERVSNLFQGYPN 217

Query: 289 LIQGFNTFLPQGYRIECSTNPDD--PIRVTTPMGTT-TVNNNISPPERGTIDAQEPSS-- 343
           LIQGFNTFLPQGY+IECS+NP+D  PI+VTTP GTT +V  N +P     ++ + PS+  
Sbjct: 218 LIQGFNTFLPQGYKIECSSNPNDPHPIKVTTPFGTTGSVTLNTAP-----LEQRYPSNEN 272

Query: 344 -LPEADGNGTQRSHNVPMVPSNVYHSEQNQDQQQVLPLSATSTGLPSIQQSEIPVHHQIP 402
            L   D    Q+ H+V      +   +Q    Q        +      Q      H+   
Sbjct: 273 VLLSPDHLQLQQHHSV------LQQEQQQPQPQPQQQPQPQTQTQTQTQTQTQQQHYPDQ 326

Query: 403 QIQPLAVQEDVKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEV 462
           Q Q    +    K  DVEFS AISYVNKIKTRFA+QPDIYKHFLEILQTYQREQKPINEV
Sbjct: 327 QDQHYLAK----KGGDVEFSHAISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEV 382

Query: 463 YAQVTHLFQNAPDLLEDFKKFLPDSSA 489
           YAQVT LFQNAPDLL+DFKKFLPD+SA
Sbjct: 383 YAQVTVLFQNAPDLLDDFKKFLPDASA 409

 Score = 60.5 bits (145), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 62/276 (22%), Positives = 116/276 (42%), Gaps = 44/276 (15%)

Query: 237 ALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPILIQGFNTF 296
           A+SY+ ++K +F+ +PDIY  FL+I++ ++ +      V  +V+ LF+  P L+  F  F
Sbjct: 344 AISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKF 403

Query: 297 LPQGYRIECSTNPDDPIRVTTPMGTTTVNNNISP--------------PERGTIDAQEPS 342
           LP     + +T P  P+   T         N+ P               E   + A +P 
Sbjct: 404 LPDASAPQSTTTP-APVNGGTFYPQAAPQQNLPPLGSFSPPSSGSAREGEHVGLPAVQP- 461

Query: 343 SLPEADGNGTQRSHNVPMVPSNVYHSEQNQDQQQVLPLSATSTGLPSIQQSEIPVHHQIP 402
             P  D +G  + H +    SN             +P+S          +S++    ++ 
Sbjct: 462 --PSMDISGQPQQHIITQGMSN-----------DDIPISEVRNTADGAYRSDLRNSGEVQ 508

Query: 403 QIQPLAVQE-DVKKNV-------------DVEFSQAISYVNKIKTRFADQPDIYKHFLEI 448
            ++P+A  E D+  ++             +V   +  S+ +K K +F     IY  FL+I
Sbjct: 509 YMEPVARPEIDLDPSLVPVIPEPIEPMENEVSLVEETSFFDKAK-KFIGNKQIYTEFLKI 567

Query: 449 LQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKFL 484
           L  Y ++    +E+  +V +      +L + FK F+
Sbjct: 568 LNLYSQDLLDRDELVEKVEYYLGGNKELFDWFKNFV 603

 Score = 57.0 bits (136), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 51/86 (59%), Gaps = 12/86 (13%)

Query: 400 QIPQIQPLAVQEDVKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPI 459
           Q P  +PL V++            A+SY+ ++K +F ++PD+Y HFL+I++ ++ +    
Sbjct: 154 QDPSYRPLNVKD------------ALSYLEQVKFQFNNRPDVYNHFLDIMKDFKSQAIDT 201

Query: 460 NEVYAQVTHLFQNAPDLLEDFKKFLP 485
             V  +V++LFQ  P+L++ F  FLP
Sbjct: 202 PGVIERVSNLFQGYPNLIQGFNTFLP 227

>Ecym_3033 Chr3 complement(64660..69084) [4425 bp, 1474 aa] {ON}
            similar to Ashbya gossypii ACL004W
          Length = 1474

 Score = 1061 bits (2744), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 549/950 (57%), Positives = 666/950 (70%), Gaps = 55/950 (5%)

Query: 571  NLPPIGSFSPPTNGSTVHENYQDQQHMQPPHLMPLPSM---VQHGANIVHQGIANENLPL 627
            NLPP+GSFS P           D   M  P L+  P+M     H A+I+ QG++N+ +P+
Sbjct: 488  NLPPLGSFSTPG----------DHHPMNLP-LVQAPNMNLNQGHPAHIITQGMSNQKIPI 536

Query: 628  SDLRTSLTEQYAXXXXXXXXXXXXXXXXXXANSQYGDVPVRPEIDLDXXXXXXXXXXXXX 687
            SDLRT+    Y                    ++QY +   RPEIDLD             
Sbjct: 537  SDLRTTADTSY-----------RPAEYSQGQDTQYMETNARPEIDLDPSLVPVIPEPIKP 585

Query: 688  XXDNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNKE 747
              D ++L EE +FF+KAK+YIGNK +YTEFLKILNLYSQD+LD + LVEKV  YL    E
Sbjct: 586  LEDELNLVEEASFFDKAKKYIGNKQIYTEFLKILNLYSQDLLDKERLVEKVGHYLSGCPE 645

Query: 748  LFSWFKNFVGYQERTKFIENIVHEKHRLDLDLCEAFGPSYKRLPKSDTFMPCSGRDDMCW 807
            LF WFK+FVGYQE+ K IENIVHEKHRLDLDLCEA GPSYKRLPK+DTFMPCSGRD+MCW
Sbjct: 646  LFDWFKSFVGYQEKPKHIENIVHEKHRLDLDLCEACGPSYKRLPKADTFMPCSGRDEMCW 705

Query: 808  EVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQCLETIV 867
            EVLNDEWVGHPVWASEDSGFIAHRKNQYE+TLFKIEEERHEYDFYIE+NLRTIQ LETI 
Sbjct: 706  EVLNDEWVGHPVWASEDSGFIAHRKNQYEDTLFKIEEERHEYDFYIEANLRTIQTLETIA 765

Query: 868  NKIENMTENEKVNFKLPPGLGHTSMTIYKKVIRKVYDKERGFEIIDALHEHPAVTAPVVL 927
            NKI NMT  EK  FKLPPGLGHTS+TIYKKVIRKVYDK+RG+EIIDALHE+PA+T P+VL
Sbjct: 766  NKIANMTPEEKATFKLPPGLGHTSVTIYKKVIRKVYDKDRGYEIIDALHEYPAITVPIVL 825

Query: 928  KRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQADKKLLTTKQLISEISSI 987
            KRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQADKKLLT KQLISEISSI
Sbjct: 826  KRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQADKKLLTAKQLISEISSI 885

Query: 988  KVDQTNKKIHWLTPKPKSQLDFDFPDKNIFCDILYLADSFISHTTAYSNPDKERLKDLL- 1046
            KVDQ NK+IH LTPK KSQLD DF D  +F DIL LA  F+ +   YS PDKERLKD   
Sbjct: 886  KVDQNNKRIHPLTPKAKSQLDHDFTDPEVFYDILNLAIVFLENNNTYSAPDKERLKDFFK 945

Query: 1047 ---------------KYXXXXXXXXXXXXXXXXXQAYKQXXXXXXXXXXXXXXXXRKRSY 1091
                           K                  + Y +                +KR+ 
Sbjct: 946  GFISLFCSYPVPQIEKALAKRDAASSSQSSNSNTETYSEKQQEDGDMKLP-----KKRNR 1000

Query: 1092 QQEMTLL-DILHRSRYQKLKRSKDEDGKVPQLSEAPDXXXXXXXXXXXXXXXAKNPWLTG 1150
            +    LL D+L R++ QK  R+          S                   AKNPWL G
Sbjct: 1001 EDSDRLLRDVLFRNKQQKGGRNSPRGD-----SSISAEKESDMEEEEIIRQEAKNPWLLG 1055

Query: 1151 NLVEEANSQGMIQNRGIFNLFANTNIYIFFRHWTTIYERLLEIKQMNEKVTKEINTRSTV 1210
            ++V+EA++ G ++NR  FNLFANTNIY+FFRH  TIYERL+E+K+MN++VTKEI  R  V
Sbjct: 1056 SIVDEADNHGHVENRKTFNLFANTNIYVFFRHLATIYERLVEVKKMNDEVTKEIANRKVV 1115

Query: 1211 TFAKDLDLLSNQLSEMGLDFIGEDAYKQVLKLSRRLINGDLEHQWFEESLRQAYNNRAFK 1270
             FAKDL+L+S QL++MGLDF GEDAY+++L+LSR LI GDLEHQWFEESLRQAY N+AFK
Sbjct: 1116 QFAKDLNLISTQLTDMGLDFKGEDAYEKLLQLSRSLIAGDLEHQWFEESLRQAYKNKAFK 1175

Query: 1271 LYTIDKVTQSLVKHAHTLMTDAKTAEIMALFVKDRNVTTTSAKGQIIYRLQVRSHMSNTE 1330
            +YT+DKV Q+LVKHAH ++TD KT EIM LF KDR   +TS K QI+YRLQVRS+MSN E
Sbjct: 1176 IYTVDKVIQALVKHAHAIITDNKTVEIMMLFEKDRTSLSTSTKDQILYRLQVRSNMSNIE 1235

Query: 1331 NMFRIEFDKRTLHVSIQYIALDDLTLKEPKEDEDKWKYYVTSYALPHPTEGVLHEKLKIP 1390
            NMFRIE+++ T HV IQ++A+DDLTL+EPK  +DKW+YY+TSY+L HPTEG+ H+ L+ P
Sbjct: 1236 NMFRIEYNRLTAHVCIQFVAVDDLTLEEPKSLKDKWQYYLTSYSLSHPTEGISHDNLRSP 1295

Query: 1391 FLERLIEFGQDIDGKDVDEKFSPEGISVSTLKIKIQPTTYKLDIENGSYDVFTRKSANKY 1450
            FLE++IE  +DI     DEK+SPEG++ S LK+KI P TY +++E GS+D+F+RK+ NK+
Sbjct: 1296 FLEKIIESEEDIIEDK-DEKYSPEGVATSNLKVKIDPITYSMEVEFGSHDIFSRKAVNKF 1354

Query: 1451 PTVANDDTHKEVVVQKKELISRFLDCAVHLRNDLNESQKISMQEKFESLK 1500
            P     D  K+   + K  + RFL+     + DL+  Q   ++++ E +K
Sbjct: 1355 PVRV--DIRKKKSSELKLELERFLNSNSGWKKDLSAKQIAEVEKRLEFVK 1402

 Score =  301 bits (770), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 167/279 (59%), Positives = 186/279 (66%), Gaps = 34/279 (12%)

Query: 229 YRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPI 288
           YRPLNVKDALSYLEQVKFQF+SRPD+YN FLDIMKDFKSQAIDTPGVIERVSTLF+GYP 
Sbjct: 160 YRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFQGYPT 219

Query: 289 LIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTTTVNNNISPPERGTIDAQEPSSLPEAD 348
           LIQGFNTFLPQGY IECS++P+DPI+VTTP GTT           G      P + P   
Sbjct: 220 LIQGFNTFLPQGYNIECSSDPNDPIKVTTPFGTTGEVAIGGGGGSGVCGHVVPRAEPLQQ 279

Query: 349 GNGTQRSHNVPMVPSNVYHSEQNQD------------------QQQVLPLSATSTGLPSI 390
                +       P+ V  +                       Q Q L +  ++ G P++
Sbjct: 280 QLRQHQQ------PATVAEAAAAAAAAAGGGGGGAIAGGGPPPQAQTLVVYQSTDGSPTM 333

Query: 391 QQSEIPVHHQIPQIQPLAVQEDVKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQ 450
            Q +       PQ Q        KK  DVEFS AISYVNKIKTRFADQPDIYKHFLEILQ
Sbjct: 334 PQRQ-------PQDQ---FGTGGKKTGDVEFSHAISYVNKIKTRFADQPDIYKHFLEILQ 383

Query: 451 TYQREQKPINEVYAQVTHLFQNAPDLLEDFKKFLPDSSA 489
           TYQREQKPINEVYAQVT LFQNAPDLL+DFKKFLPD+SA
Sbjct: 384 TYQREQKPINEVYAQVTVLFQNAPDLLDDFKKFLPDASA 422

 Score = 55.1 bits (131), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 48/90 (53%), Gaps = 12/90 (13%)

Query: 396 PVHHQIPQIQPLAVQEDVKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQRE 455
           P H      +PL V++            A+SY+ ++K +F  +PD+Y HFL+I++ ++ +
Sbjct: 152 PAHQDGSSYRPLNVKD------------ALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQ 199

Query: 456 QKPINEVYAQVTHLFQNAPDLLEDFKKFLP 485
                 V  +V+ LFQ  P L++ F  FLP
Sbjct: 200 AIDTPGVIERVSTLFQGYPTLIQGFNTFLP 229

 Score = 33.1 bits (74), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 35/71 (49%), Gaps = 3/71 (4%)

Query: 232 LNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPILIQ 291
           LN+ +  S+ ++ K ++     IY  FL I+  +    +D   ++E+V     G P L  
Sbjct: 590 LNLVEEASFFDKAK-KYIGNKQIYTEFLKILNLYSQDLLDKERLVEKVGHYLSGCPELFD 648

Query: 292 GFNTFLPQGYR 302
            F +F+  GY+
Sbjct: 649 WFKSFV--GYQ 657

>CAGL0E02475g Chr5 (236580..241061) [4482 bp, 1493 aa] {ON} similar to
            uniprot|P22579 Saccharomyces cerevisiae YOL004w SIN3
            transcription regulatory protein
          Length = 1493

 Score = 1056 bits (2731), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 528/951 (55%), Positives = 651/951 (68%), Gaps = 51/951 (5%)

Query: 572  LPPIGSFSPPTNGSTVHENYQDQQHMQPPHLMPLPSMVQHGANIVHQGI----------- 620
            LPPIGSFSPPTNG  V +  Q         +M LPSM+ +   +  Q I           
Sbjct: 470  LPPIGSFSPPTNGPFVDQTQQSANPETQKGVMSLPSMMNNAEAVKEQAIKQAHSRLISDS 529

Query: 621  ---------------ANENLPLSDLRTSLTEQYAXXXXXXXXXXXXXXXXXXANSQYGDV 665
                           +N+++P+S+LRT++ EQ                     +  Y   
Sbjct: 530  HDHNSQQQVLSQNIHSNDDIPVSNLRTTVVEQ--NYHPETIYQQQGNAQQHMVDGGYVGT 587

Query: 666  P----VRPEIDLDXXXXXXXXXXXXXXXDNISLNEEVTFFEKAKRYIGNKHLYTEFLKIL 721
            P    VRPEIDLD               ++++L EE  FFE+ K+ IGNK +Y EFLKIL
Sbjct: 588  PSELVVRPEIDLDPSLVPVVPEPTEPIENSLNLMEETNFFERVKKSIGNKQIYNEFLKIL 647

Query: 722  NLYSQDILDLDDLVEKVDFYLGSNKELFSWFKNFVGYQERTKFIENIVHEKHRLDLDLCE 781
            NL+S D+L +D+LV+KV++Y+G+NKELF WFK FVGYQ++ K IENIVHEKH+LDLDLCE
Sbjct: 648  NLFSLDLLTVDELVDKVEYYIGANKELFDWFKVFVGYQDKPKRIENIVHEKHKLDLDLCE 707

Query: 782  AFGPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFK 841
            A+GPSYK+LPK+DTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFK
Sbjct: 708  AYGPSYKKLPKTDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFK 767

Query: 842  IEEERHEYDFYIESNLRTIQCLETIVNKIENMTENEKVNFKLPPGLGHTSMTIYKKVIRK 901
            IEEERHEYD+YIESNLRTIQ LETI NKI NMT+ EK  F+LPPGLGHTSMTIYKKVIRK
Sbjct: 768  IEEERHEYDYYIESNLRTIQTLETIANKIANMTDAEKAQFRLPPGLGHTSMTIYKKVIRK 827

Query: 902  VYDKERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLD 961
            VYDKERGFEIIDALH +PA++ P++L+RLKQKDEEWRRAQREWNK+WR+LEQKV+FKSLD
Sbjct: 828  VYDKERGFEIIDALHNYPAISVPIILRRLKQKDEEWRRAQREWNKIWRDLEQKVYFKSLD 887

Query: 962  HLGLTFKQADKKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQLDFDFPDKNIFCDIL 1021
            HLGLTFKQADKKLLTTKQLISEI+ IKVDQ +K+IHWLTPKPK+QLD+DFPD +I  DI+
Sbjct: 888  HLGLTFKQADKKLLTTKQLISEINGIKVDQNSKRIHWLTPKPKNQLDYDFPDYDILFDII 947

Query: 1022 YLADSFISHTTAYSNPDKERLKDLLKYXXXXXXXXXXXXXXXXXQ--------------- 1066
             L   F  +T  YSNPDKER+KD+L+                  +               
Sbjct: 948  ALGFVFTINTNLYSNPDKERIKDMLRVFVSQFFSIPLKEVSDALERRGFSDDNNNDSDKG 1007

Query: 1067 -AYKQXXXXXXXXXXXXXXXXRKRSYQQEMTLLDILHRSRYQKLKRSKDEDG-KVPQLSE 1124
                                 +KR +  ++ + DILH+++ QK K +K+ DG K P    
Sbjct: 1008 SGKMDQIAEEIGETEQDTSSSKKRPFDNDLNMSDILHKTKQQKTKMNKEMDGSKSPSEDL 1067

Query: 1125 APDXXXXXXXXXXXXXXXAKNPWLTGNLVEEANSQGMIQNRGIFNLFANTNIYIFFRHWT 1184
              D                K  WL G++V+ AN +  + NR I+NLFANTNIYIFFRH  
Sbjct: 1068 GTDRNVGTIEDSGSLSEHRKQ-WLVGDVVDSANKETPMDNRNIYNLFANTNIYIFFRHLV 1126

Query: 1185 TIYERLLEIKQMNEKVTKEINTRSTVTFAKDLDLLSNQLSEMGLDFIGEDAYKQVLKLSR 1244
            T+YERL E+KQ+N+++ KEI +R   TFAKDL L+S QLSE+GLDF   DAY+Q+L LS+
Sbjct: 1127 TLYERLSEVKQINDEINKEIKSRRVTTFAKDLGLISTQLSELGLDFNSSDAYQQLLTLSK 1186

Query: 1245 RLINGDLEHQWFEESLRQAYNNRAFKLYTIDKVTQSLVKHAHTLMTDAKTAEIMALFVKD 1304
            RLI GD+EHQWFEES+RQAYNNRAFKLYTIDKV QS VKHAHTL++D+KT+EIM LF   
Sbjct: 1187 RLIEGDIEHQWFEESIRQAYNNRAFKLYTIDKVVQSFVKHAHTLISDSKTSEIMLLFENQ 1246

Query: 1305 RNVTTTSAKGQIIYRLQVRSHMSNTENMFRIEFDKRTLHVSIQYIALDDLTLKEPKEDED 1364
            RN T T+ K QI+YR+Q RSHMS+TENMFRIE+ +   H SIQYIALDDLTLK  K  E+
Sbjct: 1247 RNNTLTTTKDQILYRIQCRSHMSSTENMFRIEYKREKRHASIQYIALDDLTLKTAKSPEE 1306

Query: 1365 KWKYYVTSYALPHPTEGVLHEKLKIPFLERLIEFGQDIDGKDVDEK-FSPEGISVSTLKI 1423
             W YYVTSY+L +PTEGV HE L++PFLE++IEF Q+    + +   +S  GIS S L I
Sbjct: 1307 AWNYYVTSYSLSNPTEGVPHENLEVPFLEKVIEFDQEYSKDNGNNSTYSLAGISKSNLHI 1366

Query: 1424 KIQPTTYKLDIENGSYDVFTRKSANKYPTVANDDTHKEVVVQKKELISRFL 1474
             I    Y L ++ GS DV++R +  KYP VA+D++    + +K + I + L
Sbjct: 1367 DIDREKYNLILQGGSSDVYSRATIQKYPIVASDESRAANISEKTQEIRKVL 1417

 Score =  317 bits (813), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 172/264 (65%), Positives = 191/264 (72%), Gaps = 38/264 (14%)

Query: 229 YRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPI 288
           YRPLNVKDALSYLEQVKFQF +RPDIYNLFLDIMKDFKSQ IDTPGVIERVS+LF+GYP 
Sbjct: 185 YRPLNVKDALSYLEQVKFQFHTRPDIYNLFLDIMKDFKSQTIDTPGVIERVSSLFKGYPN 244

Query: 289 LIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTTTVNNNISPPERGTIDAQEPSSLPEAD 348
           LIQGFNTFLPQGYRIECS NP+DPI+VTTPMG++T   N +P        + PS      
Sbjct: 245 LIQGFNTFLPQGYRIECSNNPNDPIKVTTPMGSSTTVLNTAP-------QKSPS------ 291

Query: 349 GNGTQRSHNVPMVPSNVYHSEQNQDQQQVLPLSATSTGLPSIQQSEIPVHHQIPQIQPLA 408
                        PS++   + N  Q Q +   A    L S Q + IP  H + Q    A
Sbjct: 292 -------------PSDI---QTNNQQTQAI---AQEAQLQS-QATPIPTQHDVGQNFGSA 331

Query: 409 VQEDVKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTH 468
                KK  DVEFSQAI+YVNKIKTRFADQPDIYK FLEILQTYQREQKPI+EVYAQVT 
Sbjct: 332 -----KKPADVEFSQAITYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTI 386

Query: 469 LFQNAPDLLEDFKKFLPDSSASAN 492
           LFQNAPDLL+DFKKFLPDSSAS +
Sbjct: 387 LFQNAPDLLDDFKKFLPDSSASGS 410

 Score = 52.8 bits (125), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 52/213 (24%), Positives = 86/213 (40%), Gaps = 34/213 (15%)

Query: 288 ILIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTTTVNNNISPPERGTIDAQEPSSLPEA 347
           I++  F++   +  RI+ S NP  P  +TT   T        P   G   A   + LP A
Sbjct: 61  IILPSFSSLKTEDNRIDTSMNPIGPKSITTSSST--------PASVGFSVASLDNPLPPA 112

Query: 348 DGNGTQRSHNVPM---------------VPSNVYHSEQNQDQQQVLPLSATSTGLPSIQQ 392
                 + H +P                        E  Q+Q+Q       STG      
Sbjct: 113 TKKPEIKLHPLPQQQQPRIYTQQQPQQQQILQQDQQEILQNQRQ------GSTGASETST 166

Query: 393 SEIPVHHQIPQIQPLAVQEDVKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTY 452
           ++ P+        P   Q D      +    A+SY+ ++K +F  +PDIY  FL+I++ +
Sbjct: 167 TQSPLVSG-----PAQTQGDPMSYRPLNVKDALSYLEQVKFQFHTRPDIYNLFLDIMKDF 221

Query: 453 QREQKPINEVYAQVTHLFQNAPDLLEDFKKFLP 485
           + +      V  +V+ LF+  P+L++ F  FLP
Sbjct: 222 KSQTIDTPGVIERVSSLFKGYPNLIQGFNTFLP 254

>KLTH0C10956g Chr3 (901384..905685) [4302 bp, 1433 aa] {ON} similar to
            uniprot|P22579 Saccharomyces cerevisiae YOL004W SIN3 DNA
            binding protein involved in transcriptional regulation
          Length = 1433

 Score = 1051 bits (2717), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 518/910 (56%), Positives = 659/910 (72%), Gaps = 26/910 (2%)

Query: 570  QNLPPIGSFSPPTNGSTVHENYQDQQHMQPPHLMPLPSMV-QHGANIVHQGIANENLPLS 628
            QNLPP+GSFSPP NG   ++   +   +QPP +      V  H +++V Q I    LPLS
Sbjct: 468  QNLPPLGSFSPPINGRE-NDPQLNLPAVQPPAMEFASQQVPHHPSHVVPQVIPGGTLPLS 526

Query: 629  DLRTSLTEQYAXXXXXXXXXXXXXXXXXXANSQYGDVPVRPEIDLDXXXXXXXXXXXXXX 688
            DLR ++   +A                   + Q+ +   RPEIDLD              
Sbjct: 527  DLRGAMDGNFAPQPLQSQ------------DVQFIEPTSRPEIDLDPSLVPVIPEPIKPL 574

Query: 689  XDNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNKEL 748
             ++++L EE +FF++AK+Y+GNK +YTEFLKILNL+SQD++  ++LV+KV+ YLG + EL
Sbjct: 575  ENDLTLIEETSFFDRAKKYMGNKQVYTEFLKILNLFSQDLIGTEELVDKVEHYLGGSPEL 634

Query: 749  FSWFKNFVGYQERTKFIENIVHEKHRLDLDLCEAFGPSYKRLPKSDTFMPCSGRDDMCWE 808
            F WFK+FV Y E+ K IEN++HEKHRLDLDLCEA  PSYK+LPK+DTFMPCSGRD+MCWE
Sbjct: 635  FDWFKSFVNYVEKPKHIENVIHEKHRLDLDLCEACFPSYKKLPKADTFMPCSGRDEMCWE 694

Query: 809  VLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQCLETIVN 868
            VLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYD+YIE+NLRTIQ LETI N
Sbjct: 695  VLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDYYIEANLRTIQLLETIAN 754

Query: 869  KIENMTENEKVNFKLPPGLGHTSMTIYKKVIRKVYDKERGFEIIDALHEHPAVTAPVVLK 928
            KI NMT  EK  FKLPPGLGHTSMTIYKKVIRKVYDK+RGFEIIDALHE+PAV+ P++LK
Sbjct: 755  KISNMTPEEKQAFKLPPGLGHTSMTIYKKVIRKVYDKDRGFEIIDALHENPAVSVPIILK 814

Query: 929  RLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQADKKLLTTKQLISEISSIK 988
            RLKQKDEEWRRAQREWNKVWRELEQKVF+KSLDHLGLTFKQADKKLLT KQLISEISSIK
Sbjct: 815  RLKQKDEEWRRAQREWNKVWRELEQKVFYKSLDHLGLTFKQADKKLLTAKQLISEISSIK 874

Query: 989  VDQTNKKIHWLTPKPKSQLDFDFPDKNIFCDILYLADSFISHTTAYSNPDKERLKDLLKY 1048
            VDQTNK+I+  TPKPKSQLD+D  DK +  DIL L ++FI H++ YSNPDKE+L    K 
Sbjct: 875  VDQTNKRIYPFTPKPKSQLDYDLKDKGVLFDILCLVNNFIDHSSTYSNPDKEKLAAFFKG 934

Query: 1049 XXXXXXXXXXXXXXXXXQAYKQXXXXXXXXXXXXXXXXRKRSYQQEMTLLDILH-RSRYQ 1107
                              A                   RKR ++ E  L ++L  + ++ 
Sbjct: 935  FLSVFFSISYQEIENSTPA---------DSDAVSNSNPRKRLWESEQPLKELLRSKHKHH 985

Query: 1108 KLKRSKDEDGKVPQLSEAPDXXXXXXXXXXXXXXXAKNPWLTGNLVEEANSQGMIQNRGI 1167
            K + +  ED  +     +P+               AK PWL GN+++EAN  G + NR I
Sbjct: 986  KKRDTSAEDDSISDDQNSPEKSPQEIEDEEVIRQEAKKPWLLGNILDEANDHGYVSNRKI 1045

Query: 1168 FNLFANTNIYIFFRHWTTIYERLLEIKQMNEKVTKEINTRSTVTFAKDLDLLSNQLSEMG 1227
            FNLFANTN+Y+FFRH TT+Y+RL E+K MNE+VT+EIN+R+ V FAKDL+L+S QLS+MG
Sbjct: 1046 FNLFANTNVYVFFRHLTTMYQRLSEVKNMNEEVTREINSRNVVQFAKDLNLVSTQLSDMG 1105

Query: 1228 LDFIGEDAYKQVLKLSRRLINGDLEHQWFEESLRQAYNNRAFKLYTIDKVTQSLVKHAHT 1287
            LDF G+DAY Q+L L +RLI  D++HQWFEESLRQAY N+AFK+YT+DKV QSLVKHAH+
Sbjct: 1106 LDFKGKDAYDQLLTLCKRLIRNDMDHQWFEESLRQAYKNKAFKIYTVDKVIQSLVKHAHS 1165

Query: 1288 LMTDAKTAEIMALFVKDRNVTTTSAKGQIIYRLQVRSHMSNTENMFRIEFDKRTLHVSIQ 1347
            ++TDAK+AEIM LF KDR  T TS K QI+YRLQVRS+M  TENMFR+E +K + HV IQ
Sbjct: 1166 IITDAKSAEIMILFEKDRRCTATSTKEQILYRLQVRSYMGLTENMFRVEINKDSCHVCIQ 1225

Query: 1348 YIALDDLTLKEPKEDEDKWKYYVTSYALPHPTEGVLHEKLKIPFLERLIEFGQDIDGKDV 1407
            Y+A+DDLTLKEP+  +D+W YY+TSYAL HPTEG+ HE++K+PFLE+ ++  ++ D  + 
Sbjct: 1226 YVAIDDLTLKEPESLKDRWHYYLTSYALSHPTEGIPHEEIKVPFLEKTLQDDEEAD--EG 1283

Query: 1408 DEKFSPEGISVSTLKIKIQPTTYKLDIENGSYDVFTRKSANKYPTVANDDTHKEVVVQKK 1467
             E+ SP G S+S L+I++ P +Y+L IE GS D+FTR + N++   + ++++ ++  +K+
Sbjct: 1284 SEERSPSGHSLSNLRIQVNPESYELQIEPGSKDIFTRFAVNRFLNSSENNSNTDLKEEKR 1343

Query: 1468 ELISRFLDCA 1477
            + +   LD +
Sbjct: 1344 KTLMSQLDGS 1353

 Score =  283 bits (725), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 158/270 (58%), Positives = 188/270 (69%), Gaps = 14/270 (5%)

Query: 229 YRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPI 288
           YRPLN KDALSYLEQVKFQF++RPD+YN FLDIMKD+KSQAIDT GVIER+STLF+GYPI
Sbjct: 142 YRPLNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFKGYPI 201

Query: 289 LIQGFNTFLPQGYRIECSTNPDDP--IRVTTPMGTTTVNNNISPPERGTIDAQEPSSLPE 346
           LIQG NTFLPQGY+IEC+ NP+DP  I+VTTP       N  +      I    PS +P 
Sbjct: 202 LIQGLNTFLPQGYKIECTLNPNDPHSIKVTTPFDNARELNLATMATGNGIVEGHPSLMPS 261

Query: 347 ADGNGTQR-SHNVPMVPSNVYHSEQNQDQQQVLPLSAT-STGLPSIQQSEIPVHHQIPQI 404
            D +  +   H    V   + ++  N      LP+  T +  LP  +Q       Q P +
Sbjct: 262 DDVSPPKLVGHEPAAVQPKLENAPTN------LPVPTTFNQNLPQHEQQNQQHGSQSPAM 315

Query: 405 QPLAVQEDV----KKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPIN 460
                Q+      + + DVEFS AISYVNKIKTRFADQP+IYKHFLEILQTYQREQKPI+
Sbjct: 316 PQQQRQDQQFMGNRPSGDVEFSHAISYVNKIKTRFADQPEIYKHFLEILQTYQREQKPIH 375

Query: 461 EVYAQVTHLFQNAPDLLEDFKKFLPDSSAS 490
           EVYAQVT LFQNAPDLL+DFKKFLPD++A+
Sbjct: 376 EVYAQVTSLFQNAPDLLDDFKKFLPDATAA 405

 Score = 34.3 bits (77), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 56/117 (47%), Gaps = 18/117 (15%)

Query: 370 QNQDQQQVLPLSATSTGL-PSIQQSEIPVHHQIPQ-IQPLAVQEDVKKNVDVEFSQAISY 427
           Q+QD Q + P S     L PS+    +PV   IP+ I+PL          D+   +  S+
Sbjct: 542 QSQDVQFIEPTSRPEIDLDPSL----VPV---IPEPIKPL--------ENDLTLIEETSF 586

Query: 428 VNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKFL 484
            ++ K ++     +Y  FL+IL  + ++     E+  +V H    +P+L + FK F+
Sbjct: 587 FDRAK-KYMGNKQVYTEFLKILNLFSQDLIGTEELVDKVEHYLGGSPELFDWFKSFV 642

>ACL004W Chr3 (347727..351860) [4134 bp, 1377 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YOL004W (SIN3)
          Length = 1377

 Score = 1050 bits (2714), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 535/952 (56%), Positives = 663/952 (69%), Gaps = 55/952 (5%)

Query: 569  QQNLPPIGSFSPPTNGSTVHENYQDQQHMQPPHLMPLPSM------VQHG--ANIVHQGI 620
            QQNLPP+G+FS P +                 H M LPS+      +  G   +IV QG+
Sbjct: 392  QQNLPPLGNFSTPGDH----------------HPMSLPSVQGPNVGLSQGQSGHIVTQGV 435

Query: 621  ANENLPLSDLRTSLTEQYAXXXXXXXXXXXXXXXXXXANSQYGDVPVRPEIDLDXXXXXX 680
            +N+++P+SDLR +    +                    + QY +  VRPEIDLD      
Sbjct: 436  SNQHIPVSDLRGAPDASF-----------RASEYNQVQDVQYMEPTVRPEIDLDPSLVPV 484

Query: 681  XXXXXXXXXDNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILDLDDLVEKVDF 740
                     D ++L EE TFF+KAK++IGNK +YTEFLKILNLYSQD+L+ + LVE V  
Sbjct: 485  IPEPIKPLEDELNLVEEATFFDKAKKFIGNKQIYTEFLKILNLYSQDLLEKEKLVEDVSH 544

Query: 741  YLGSNKELFSWFKNFVGYQERTKFIENIVHEKHRLDLDLCEAFGPSYKRLPKSDTFMPCS 800
            YL  + ELF WFK+FVGYQER K IEN++HEKHRLDLDLCEA GPSYKRLPK+DTFMPCS
Sbjct: 545  YLSGSPELFDWFKSFVGYQERPKHIENVIHEKHRLDLDLCEACGPSYKRLPKADTFMPCS 604

Query: 801  GRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTI 860
            GRD+MCWEVLNDEWVGHPVWASEDSGFIAHRKNQYE+TLFKIEEERHEYDFYIE+NLRTI
Sbjct: 605  GRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEDTLFKIEEERHEYDFYIEANLRTI 664

Query: 861  QCLETIVNKIENMTENEKVNFKLPPGLGHTSMTIYKKVIRKVYDKERGFEIIDALHEHPA 920
            Q LETI NKI NMT  EK  FKLPPGLGHTS+TIYKKVIRKVYDK+RGFEIIDALHEHPA
Sbjct: 665  QTLETIANKIANMTPEEKAAFKLPPGLGHTSVTIYKKVIRKVYDKDRGFEIIDALHEHPA 724

Query: 921  VTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQADKKLLTTKQL 980
            +T P+VLKRLKQKDEEWRRAQREWNKVWRELEQKVF+KSLDHLGLTFKQADKKLLT KQL
Sbjct: 725  ITVPLVLKRLKQKDEEWRRAQREWNKVWRELEQKVFYKSLDHLGLTFKQADKKLLTAKQL 784

Query: 981  ISEISSIKVDQTNKKIHWLTPKPKSQLDFDFPDKNIFCDILYLADSFISHTTAYSNPDKE 1040
            ISEISSIKVDQ+NK+IH LTPK KSQL +DF +  +F DIL L   F+++   YS  D E
Sbjct: 785  ISEISSIKVDQSNKRIHPLTPKAKSQLSYDFKEPEVFQDILSLVMVFLANNNTYSPSDNE 844

Query: 1041 RLKDLLK-----YXXXXXXXXXXXXXXXXXQ----AYKQXXXXXXXXXXXXXXXXRKRSY 1091
            RLKD  K     +                 Q    ++                  RKR  
Sbjct: 845  RLKDFFKGFISLFFSYPLHEIEEGLLKRSSQNGTISHGDDTRKSKEDPKTEKHSARKRVR 904

Query: 1092 QQ-EMTLLDILHRSRYQKLKRSKDEDGKVPQLSEAPDXXXXXXXXXXXXXXXAKNPWLTG 1150
               E  L DIL+R++ QK+ +    D    +  +  D               AK PWL G
Sbjct: 905  DDTEHLLRDILYRNKQQKVNKGPQNDQSSEEFEKESD-----IEEKEIVRQEAKKPWLLG 959

Query: 1151 NLVEEANSQGMIQNRGIFNLFANTNIYIFFRHWTTIYERLLEIKQMNEKVTKEINTRSTV 1210
            ++V+EA++ G + +R  FN+FANTNIY+FFRH TT+YERL+E+K++N +VTKEI+ R  V
Sbjct: 960  SIVDEADNHGHVSDRVTFNMFANTNIYVFFRHLTTMYERLVEVKKINGEVTKEISNRKVV 1019

Query: 1211 TFAKDLDLLSNQLSEMGLDFIGEDAYKQVLKLSRRLINGDLEHQWFEESLRQAYNNRAFK 1270
             FAKDL+L+S QL++MGLDF G DAY+++L+LSR LI+G+LEHQWFEESLRQAY N+AFK
Sbjct: 1020 QFAKDLNLISTQLTDMGLDFKGADAYEELLRLSRSLISGELEHQWFEESLRQAYKNKAFK 1079

Query: 1271 LYTIDKVTQSLVKHAHTLMTDAKTAEIMALFVKDRNVTTTSAKGQIIYRLQVRSHMSNTE 1330
            LYTIDKV Q+LVKHAHT++ D KT EIM LF  DR  T+TS K QI+YRLQVRS+MSN E
Sbjct: 1080 LYTIDKVIQALVKHAHTILMDHKTVEIMLLFDNDRTSTSTSTKDQILYRLQVRSNMSNIE 1139

Query: 1331 NMFRIEFDKRTLHVSIQYIALDDLTLKEPKEDEDKWKYYVTSYALPHPTEGVLHEKLKIP 1390
            NMFRIE++  T H SIQ++A++DLTL EPK   DKW+YY+TSY+L HPTEG+ H+ L+ P
Sbjct: 1140 NMFRIEYNTTTSHASIQFVAVEDLTLDEPKSLRDKWQYYLTSYSLSHPTEGISHDNLRTP 1199

Query: 1391 FLERLIEFGQD-IDGKDVDEKFSPEGISVSTLKIKIQPTTYKLDIENGSYDVFTRKSANK 1449
            FLE++IE  +  ID  D DE++SPEG++ S +K+KI P TY +++E G +D+F+RKS NK
Sbjct: 1200 FLEKIIERDEGYID--DGDERYSPEGVASSNMKVKIDPLTYSMEVEPGCHDIFSRKSVNK 1257

Query: 1450 YPTVANDDTHKEVVVQKKELISRFLDCAVHLRNDLNESQKISMQEKFESLKD 1501
            +PT    D  K+   + K ++  FL+     +  L   +    + + E +K+
Sbjct: 1258 FPTRV--DVKKKKSAELKLVLEGFLNGERGWKRGLTTKRTAEAERRLEYVKN 1307

 Score =  303 bits (776), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 165/261 (63%), Positives = 179/261 (68%), Gaps = 35/261 (13%)

Query: 229 YRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPI 288
           YRPLNVKDALSYLEQVKFQFSSRPD+YN FLDIMKDFKSQAIDTPGVIERVSTLF GYP 
Sbjct: 129 YRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFHGYPA 188

Query: 289 LIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTTTVNNNISPPERGTIDAQEPSSLPEAD 348
           LIQGFNTFLP GY IEC ++P+DPI+VTTP GT      I     G   A   ++ P   
Sbjct: 189 LIQGFNTFLPHGYNIECPSDPNDPIKVTTPFGTI---GEIPITGAGGNHAHGANTEPR-- 243

Query: 349 GNGTQRSHNVPMVPSNVYHSEQNQDQQQVLPLSATSTGLPSIQQSEIPVHHQIPQIQPLA 408
               Q + NVP     VY S +          S  +   P+  Q +              
Sbjct: 244 ---LQSTQNVP----TVYRSAEG---------SPAAIATPATTQEQYGT----------- 276

Query: 409 VQEDVKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTH 468
                KK  DVEFS AISYVNKIKTRFA+QPDIYKHFLEILQTYQREQKPINEVYAQVT 
Sbjct: 277 ---GPKKAGDVEFSHAISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTV 333

Query: 469 LFQNAPDLLEDFKKFLPDSSA 489
           LFQNAPDLL+DFKKFLPDSSA
Sbjct: 334 LFQNAPDLLDDFKKFLPDSSA 354

 Score = 59.7 bits (143), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 66/285 (23%), Positives = 117/285 (41%), Gaps = 50/285 (17%)

Query: 237 ALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPILIQGFNTF 296
           A+SY+ ++K +F+ +PDIY  FL+I++ ++ +      V  +V+ LF+  P L+  F  F
Sbjct: 289 AISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKF 348

Query: 297 LPQGYRIECSTNPDDPIRVTTPM-------------GTTTVNNNISPPERGTIDA---QE 340
           LP     +  ++      +  P              GT  + +  + P  G         
Sbjct: 349 LPDSSAPQLQSHQQINGAMVAPGFGHAQSGLQQALPGTQPLMHQQNLPPLGNFSTPGDHH 408

Query: 341 PSSLPEADG---------------NGTQRSHNVPM-----VPSNVYHSEQNQDQQQVLPL 380
           P SLP   G                G    H +P+      P   + + +    Q V  +
Sbjct: 409 PMSLPSVQGPNVGLSQGQSGHIVTQGVSNQH-IPVSDLRGAPDASFRASEYNQVQDVQYM 467

Query: 381 SATSTGLPSIQQSEIPVHHQIPQ-IQPLAVQEDVKKNVDVEFSQAISYVNKIKTRFADQP 439
             T      +  S +PV   IP+ I+PL   ED     ++   +  ++ +K K +F    
Sbjct: 468 EPTVRPEIDLDPSLVPV---IPEPIKPL---ED-----ELNLVEEATFFDKAK-KFIGNK 515

Query: 440 DIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKFL 484
            IY  FL+IL  Y ++     ++   V+H    +P+L + FK F+
Sbjct: 516 QIYTEFLKILNLYSQDLLEKEKLVEDVSHYLSGSPELFDWFKSFV 560

>TPHA0J00400 Chr10 complement(89956..94494) [4539 bp, 1512 aa] {ON}
            Anc_6.29 YOL004W
          Length = 1512

 Score = 1048 bits (2711), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 521/851 (61%), Positives = 634/851 (74%), Gaps = 18/851 (2%)

Query: 664  DVPVRPEIDLDXXXXXXXXXXXXXXXDNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNL 723
            D+ VRPEIDLD               D++SL EE  FF+KAK++I NK +Y EFLKILNL
Sbjct: 619  DISVRPEIDLDPSIVPVIPEPVEPIEDSLSLVEETNFFDKAKKFINNKQIYMEFLKILNL 678

Query: 724  YSQDILDLDDLVEKVDFYLGSNKELFSWFKNFVGYQERTKFIENIVHEKHRLDLDLCEAF 783
            YSQ+IL++++LVEKV +YLGSNKELF WFK FVGYQ++ K IENIVHEKH+LDLDLCEA+
Sbjct: 679  YSQNILNVNELVEKVQYYLGSNKELFDWFKGFVGYQDKPKHIENIVHEKHKLDLDLCEAY 738

Query: 784  GPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIE 843
            GPSYK+LPK+DTFMPCSGRD+MCWEVLND+WVGHPVWASEDSGFIAHRKNQYEETLFKIE
Sbjct: 739  GPSYKKLPKTDTFMPCSGRDEMCWEVLNDDWVGHPVWASEDSGFIAHRKNQYEETLFKIE 798

Query: 844  EERHEYDFYIESNLRTIQCLETIVNKIENMTENEKVNFKLPPGLGHTSMTIYKKVIRKVY 903
            EERHEYDFYIESNLRTIQ LETI +KI NMTE E+ NFKLP GLGHTS+TIY+KVIRKVY
Sbjct: 799  EERHEYDFYIESNLRTIQTLETIASKIANMTEEERANFKLPIGLGHTSVTIYQKVIRKVY 858

Query: 904  DKERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHL 963
             KERGFE+IDALHE+PAV  P++LKRLKQKDEEWRRAQREWNKVWREL+QKV++KSLDHL
Sbjct: 859  GKERGFELIDALHEYPAVAVPIILKRLKQKDEEWRRAQREWNKVWRELQQKVYYKSLDHL 918

Query: 964  GLTFKQADKKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQLDFDFPDKNIFCDILYL 1023
            GLTFKQADKKLLTTKQLISEISSIKVDQTNKK+HWLTPKPKSQLD+   D+ I  DIL L
Sbjct: 919  GLTFKQADKKLLTTKQLISEISSIKVDQTNKKLHWLTPKPKSQLDYKVADRQILYDILKL 978

Query: 1024 ADSFISHTTAYSNPDKERLKDLLKYXXXX---XXXXXXXXXXXXXQAYKQXXXXXXXXXX 1080
             D FI+HT+ YSNPDKERL+D L+                                    
Sbjct: 979  TDVFINHTSNYSNPDKERLRDFLQSFISLFFFIPLADIKAAIKIRSPLDDTKTDSEESSG 1038

Query: 1081 XXXXXXRKRSYQ-QEMTLLDILHRSRYQKLKRSKDEDGKVPQ-LSEAPDXXXXXXXXXXX 1138
                  +KRS +  +++  DIL + +YQK+K+  D++      +S A             
Sbjct: 1039 DSDKFPKKRSIEDDDISFHDILDKVKYQKVKQGLDKNETFSNDISSA-----TSVDDDEL 1093

Query: 1139 XXXXAKNPWLTGNLVEEANSQGMIQNRGIFNLFANTNIYIFFRHWTTIYERLLEIKQMNE 1198
                A+ PWL G++V++ANS G+IQNR  +N+F NTNIY+F RH  T+YERL E KQMN 
Sbjct: 1094 IRQEAQKPWLLGSIVDDANSLGIIQNRSKYNIFGNTNIYVFIRHLITLYERLNEAKQMNA 1153

Query: 1199 KVTKEINTRSTVTFAKDLDLLSNQLSEMGLDFIGEDAYKQVLKLSRRLINGDLEHQWFEE 1258
            +VT+EI  RS V FAKDL+L+S QL  MGLDF G D+YKQ+L LS RLI G+LEH WFEE
Sbjct: 1154 EVTEEIKNRSIVPFAKDLNLVSTQLKNMGLDFEGTDSYKQLLDLSTRLIEGNLEHHWFEE 1213

Query: 1259 SLRQAYNNRAFKLYTIDKVTQSLVKHAHTLMTDAKTAEIMALFVKDRNVTTTSAKGQIIY 1318
            SLRQA+ N+AFKLYTIDKVTQS+VKHAHT+M+D KTAEIM L  KDR+  TTS+K QI+Y
Sbjct: 1214 SLRQAFRNKAFKLYTIDKVTQSIVKHAHTIMSDTKTAEIMMLMEKDRSCATTSSKDQILY 1273

Query: 1319 RLQVRSHMSNTENMFRIEFDKRTLHVSIQYIALDDLTLKEPKEDEDKWKYYVTSYALPHP 1378
            RLQ RSHMS T+NMFRIEF+K + ++SIQYI +DDLTL EPK  E+KWKYY+TSYAL HP
Sbjct: 1274 RLQARSHMSTTDNMFRIEFNKSSDNISIQYIGMDDLTLGEPKTAEEKWKYYITSYALSHP 1333

Query: 1379 TEGVLHEKLKIPFLERLIEFGQDIDGKD--VDEKFSPEGISVSTLKIKIQPTTYKLDIEN 1436
            TEGV  E+++IPFLE+++E  +    ++  +++K+SP+G+S S LKIKI P  Y L+IE 
Sbjct: 1334 TEGVPQEEIQIPFLEKILETEEAYAEEEEVINDKYSPKGVSQSDLKIKISPENYALEIEP 1393

Query: 1437 GSYDVFTRKSANKYPTVANDDTHKEVVVQKKELISRFLDCAVHLRNDLNESQ------KI 1490
            GS+D F+R S NKYP     D +K       + ++ FL+     +  L+E +      K 
Sbjct: 1394 GSFDTFSRLSMNKYPIDVTSDDYKNKKKLSIDRVNAFLNGKFGWKQSLSEDEINNINLKY 1453

Query: 1491 SMQEKFESLKD 1501
            S  +K+ SLK+
Sbjct: 1454 SHIKKYGSLKN 1464

 Score =  288 bits (737), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 164/289 (56%), Positives = 198/289 (68%), Gaps = 32/289 (11%)

Query: 229 YRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPI 288
           YRPLNVKDAL+YLEQVK QFSSRPDIYN FLDIMKDFKSQ+IDTPGVIERVSTLFRGYP 
Sbjct: 142 YRPLNVKDALTYLEQVKLQFSSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPS 201

Query: 289 LIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTTTV-----------NNNISPPERGTID 337
           LIQGFNTFLPQGY IEC+ NP+DPI+VTTP+G+ T+           N N+     G   
Sbjct: 202 LIQGFNTFLPQGYTIECTNNPNDPIKVTTPIGSETIPYAKPIPSAATNTNVP----GPTT 257

Query: 338 AQEPSSLPEADGNGTQRSHNVPMVPSNVYHSEQNQDQQQVLPLSATSTGLPSI---QQSE 394
           +  P +     G  T  + N   +P+   + E N  +   +  +A  + LP++     +E
Sbjct: 258 STSPPTAATTTGTTTPVAANTTAIPNITRNKETNAIEN--VATAAQPSLLPNLGTPSHTE 315

Query: 395 IPVHHQIPQ------IQP---LAVQEDVK---KNVDVEFSQAISYVNKIKTRFADQPDIY 442
           +     + Q      IQP      Q+ +K   K  DVEFSQA+SYVNKIK RF D+PDIY
Sbjct: 316 VTKSESVIQSSANAPIQPNMHNMTQDTMKITEKPADVEFSQAVSYVNKIKNRFVDEPDIY 375

Query: 443 KHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKFLPDSSASA 491
           K FLEILQTYQ+EQKPI+EVY+QVT LFQNAPDLL+DFKKFLPD++ SA
Sbjct: 376 KTFLEILQTYQKEQKPIHEVYSQVTILFQNAPDLLDDFKKFLPDNNNSA 424

>NDAI0C02660 Chr3 complement(615526..620499) [4974 bp, 1657 aa] {ON}
            Anc_6.29 YOL004W
          Length = 1657

 Score = 1041 bits (2693), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 546/1003 (54%), Positives = 666/1003 (66%), Gaps = 82/1003 (8%)

Query: 567  IPQQNLPPIGSFSPPTNG----------STVHENYQDQQHMQPPHLMPLPSMVQHGANIV 616
            IPQQNLPPIGSFSPPT             TV  N++    MQ      LPSM+       
Sbjct: 584  IPQQNLPPIGSFSPPTATNANATTTPAAGTVVNNFRHGISMQ----TALPSMMTPDT--- 636

Query: 617  HQGIANENLPLSDLRT-----------------------------------SLTEQYAXX 641
                  E +P+S+LR+                                    L +Q+   
Sbjct: 637  ------EAIPISNLRSVDGFPPSSGGVIPMPNNQTADFQYQQQQPQPPLTNRLPDQFPLD 690

Query: 642  XXXXXXXXXXXXXXXXANSQYGDVPVRPEIDLDXXXXXXXXXXXXXXXDNISLNEEVTFF 701
                                  + P RPEIDLD               +NI+L EE +FF
Sbjct: 691  QQQSQQQQAQQQAQQQQQQLISEAPTRPEIDLDPSIVPIIPEPTEPIENNITLVEETSFF 750

Query: 702  EKAKRYIGNKHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNKELFSWFKNFVGYQER 761
            EK K++I +K +Y EFLK+LNLYSQD+L  ++LV +VD+Y+GSNKELF WFK FVGY E 
Sbjct: 751  EKVKKFISSKPIYMEFLKVLNLYSQDLLSTNELVTRVDYYIGSNKELFDWFKTFVGYSEI 810

Query: 762  TKFIENIVHEKHRLDLDLCEAFGPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWA 821
               IENI+HEKH+LDLDLCEA+GPSYK+LPK+DTFMPCSGRD MCWEVLNDEWVGHPVWA
Sbjct: 811  PSTIENIIHEKHKLDLDLCEAYGPSYKKLPKTDTFMPCSGRDAMCWEVLNDEWVGHPVWA 870

Query: 822  SEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQCLETIVNKIENMTENEKVNF 881
            SEDSGFIAHRKNQYEETLFKIEEERHEYDF+IESNLRTIQ LETI NKI NMT  EK NF
Sbjct: 871  SEDSGFIAHRKNQYEETLFKIEEERHEYDFHIESNLRTIQTLETIANKINNMTAEEKKNF 930

Query: 882  KLPPGLGHTSMTIYKKVIRKVYDKERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQ 941
            KLP GLGHTS TIYKKVIRKVYDKERGFEIIDALHEHPA   P++L+RLK+KDEEWRRAQ
Sbjct: 931  KLPVGLGHTSSTIYKKVIRKVYDKERGFEIIDALHEHPAFAVPIILRRLKEKDEEWRRAQ 990

Query: 942  REWNKVWRELEQKVFFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKKIHWLTP 1001
            REWNKVWRELEQKV++KSLDHLGLTFKQADKKLLTTKQLISEISSI+VDQ NK+IHWLTP
Sbjct: 991  REWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLISEISSIQVDQNNKRIHWLTP 1050

Query: 1002 KPKSQLDFDFPDKNIFCDILYLADSFISHTTAYSNPDKERLKDLLKYXXXXXXXXXXXXX 1061
            KPKSQLDF F D +I  DIL LA+ FI HT+ YSN +KERLKD L+              
Sbjct: 1051 KPKSQLDFTFNDHDILVDILDLANVFIDHTSTYSNSEKERLKDFLRVFIGLFFSIPSSEI 1110

Query: 1062 XXXXQAYK----QXXXXXXXXXXXXXXXXRKRSYQQEMTLLDILHRSRYQKLKR------ 1111
                        +                +KRS + ++ L D+L + +YQK+K       
Sbjct: 1111 DKKLSGKNDEKFEKGSSSSSSTSNSTPSAKKRSLELDIPLADVLRKYKYQKIKEKVINEL 1170

Query: 1112 ----SKDEDGKVPQLSEAPDXXXXXXXXXXXXXXXAKNPWLTGNLVEEANSQGMIQNRGI 1167
                ++ ++       E                   K PWL G+++++ +  G+I+NR I
Sbjct: 1171 ENNSNEYDERDEEFDEELKRQQQEQEEEDHMIDEEMKKPWLLGSVIDKTSEHGLIENRHI 1230

Query: 1168 FNLFANTNIYIFFRHWTTIYERLLEIKQMNEKVTKEINTRSTVTFAKDLDLLSNQLSEMG 1227
            FNLFANTNIY+FFRHWTTIYERLLE+KQ+N+KVT+EIN+R    FAKDL L+S QL+ MG
Sbjct: 1231 FNLFANTNIYVFFRHWTTIYERLLELKQINDKVTREINSRKVTPFAKDLGLISTQLTMMG 1290

Query: 1228 LDFIGEDAYKQVLKLSRRLINGDLEHQWFEESLRQAYNNRAFKLYTIDKVTQSLVKHAHT 1287
            LDF   D+YK++L L++RLI  D+EHQWFEESLRQAYNN+AFKLYT DKV Q+LVKHA++
Sbjct: 1291 LDFKTSDSYKELLNLTKRLIKNDIEHQWFEESLRQAYNNKAFKLYTADKVIQALVKHANS 1350

Query: 1288 LMTDAKTAEIMALFVKDRNVTTTSAKGQIIYRLQVRSHMSNTENMFRIEFDKRTLHVSIQ 1347
            ++TD+K +EIMALF KDR  ++T+ + QIIYRLQ R+HM+NTENMFRIEF++ T HV IQ
Sbjct: 1351 ILTDSKASEIMALFEKDRLRSSTTTRDQIIYRLQTRTHMTNTENMFRIEFNENTNHVCIQ 1410

Query: 1348 YIALDDLTLKEPKEDEDKWKYYVTSYALPHPTEGVLHEKLKIPFLER----LIEFGQDID 1403
            YIA++DLTLK     ++ W+YYVTSYALPHPTEGV  E LK+PFLE+     +E  QD+D
Sbjct: 1411 YIAVEDLTLKPSPTTKETWEYYVTSYALPHPTEGVPQEGLKVPFLEKNLNLELENAQDLD 1470

Query: 1404 GK----DVDEKFSPEGISVSTLKIKIQPTTYKLDIENGSYDVFTRKSANKYPTVANDDTH 1459
             +    +  EK SPEGIS S LKIKI   TY LD+E GS+DVF+RKS NK+PT A     
Sbjct: 1471 NETEKNEFIEKISPEGISTSKLKIKIDQETYNLDVEPGSFDVFSRKSLNKFPTDAKK--I 1528

Query: 1460 KEVVVQKKELISRFLDCAVHLRNDLNESQKISMQEKFESLKDT 1502
            +  + +K E  ++FL       N     Q   ++E ++  ++T
Sbjct: 1529 ESSIKEKSEAFNKFLSSKRGWNNQFKPDQVAGIEEGWKKFQET 1571

 Score =  283 bits (725), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 160/269 (59%), Positives = 187/269 (69%), Gaps = 9/269 (3%)

Query: 229 YRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPI 288
           YRPLNVKDALSYLEQVK QF+S+P IYN FLDIMKDFKSQ IDTPGVIERVSTLF+GYP+
Sbjct: 270 YRPLNVKDALSYLEQVKVQFNSQPVIYNQFLDIMKDFKSQTIDTPGVIERVSTLFKGYPV 329

Query: 289 LIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTTTV-------NNNISPPERGTIDAQEP 341
           LIQGFNTFLPQGY I CS NPDDP+RVTTPMGT+T        N N+S P   T+     
Sbjct: 330 LIQGFNTFLPQGYTIHCSDNPDDPVRVTTPMGTSTYTNLPNVDNTNVS-PTLPTVQPLLQ 388

Query: 342 SSLPEADGNGTQRSHNVPMVPSNVYHSEQNQDQQQVLPLSATSTGLPSIQQSEIPVHHQI 401
              P+ + + T   +N    P  V+     Q+Q Q     A +      +       H  
Sbjct: 389 QPQPQGNNDTTNVINNAANQPQQVHAQTHLQEQTQAQ-TPADADAQAQAEVQAQVQAHAQ 447

Query: 402 PQIQPLAVQEDVKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINE 461
            Q Q  A  +   +N +VEFSQAI+YVNKIKTR+ADQP IYKHFLEILQTYQRE+KPI+E
Sbjct: 448 AQAQAQAQMQAQNQNPEVEFSQAINYVNKIKTRYADQPFIYKHFLEILQTYQREEKPISE 507

Query: 462 VYAQVTHLFQNAPDLLEDFKKFLPDSSAS 490
           VY QVT LF +APDLLEDFKKFLP++ A+
Sbjct: 508 VYEQVTVLFNDAPDLLEDFKKFLPETPAN 536

 Score = 39.7 bits (91), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 54/111 (48%), Gaps = 13/111 (11%)

Query: 376 QVLP-LSATSTGLPSIQQSEIPVHHQIPQIQPLAVQEDVKKNVDVEFSQAISYVNKIKTR 434
           Q LP     S      QQ +     + P+ +PL V++            A+SY+ ++K +
Sbjct: 241 QSLPHQLIQSQQPQLQQQPQQQQSEEDPEYRPLNVKD------------ALSYLEQVKVQ 288

Query: 435 FADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKFLP 485
           F  QP IY  FL+I++ ++ +      V  +V+ LF+  P L++ F  FLP
Sbjct: 289 FNSQPVIYNQFLDIMKDFKSQTIDTPGVIERVSTLFKGYPVLIQGFNTFLP 339

 Score = 34.7 bits (78), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 45/95 (47%), Gaps = 4/95 (4%)

Query: 393 SEIPVHHQI---PQIQPLAVQEDVKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEIL 449
           SE P   +I   P I P+  +       ++   +  S+  K+K   + +P IY  FL++L
Sbjct: 712 SEAPTRPEIDLDPSIVPIIPEPTEPIENNITLVEETSFFEKVKKFISSKP-IYMEFLKVL 770

Query: 450 QTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKFL 484
             Y ++    NE+  +V +   +  +L + FK F+
Sbjct: 771 NLYSQDLLSTNELVTRVDYYIGSNKELFDWFKTFV 805

>TBLA0E03160 Chr5 (789593..794812) [5220 bp, 1739 aa] {ON} Anc_6.29
            YOL004W
          Length = 1739

 Score = 1040 bits (2688), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 510/852 (59%), Positives = 625/852 (73%), Gaps = 14/852 (1%)

Query: 662  YGDVPVRPEIDLDXXXXXXXXXXXXXXXDNISLNEEVTFFEKAKRYIGNKHLYTEFLKIL 721
            Y +  VRPEIDLD               D + L EE  FF+K K+YIGNK +Y EFLK+L
Sbjct: 825  YEENAVRPEIDLDPSLVPIVPEPTQPIEDTLPLVEETNFFDKVKKYIGNKTIYAEFLKVL 884

Query: 722  NLYSQDILDLDDLVEKVDFYLGSNKELFSWFKNFVGYQERTKFIENIVHEKHRLDLDLCE 781
            NLYS D+L++D+LVEK+ +YL  N+ELFSWFKNFVGY E+ K IENIVHEKH+LDLDLCE
Sbjct: 885  NLYSVDLLEVDELVEKIKYYLNDNEELFSWFKNFVGYVEKPKHIENIVHEKHKLDLDLCE 944

Query: 782  AFGPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFK 841
            A GPSYK+LPK+DT MPCSGRD+MCWE+LNDEWVGHPVWASEDSGFIAHRK   ++   +
Sbjct: 945  ACGPSYKKLPKTDTLMPCSGRDEMCWEILNDEWVGHPVWASEDSGFIAHRKINTKKPYLR 1004

Query: 842  IEEERHEYDFYIESNLRTIQCLETIVNKIENMTENEKVNFKLPPGLGHTSMTIYKKVIRK 901
            ++++ HEYDFYIESNLRTIQ LETI +KI NMTENEK NFKLP GLGHT+ TIYKKVIRK
Sbjct: 1005 LKKKVHEYDFYIESNLRTIQTLETIASKIANMTENEKCNFKLPDGLGHTTSTIYKKVIRK 1064

Query: 902  VYDKERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLD 961
            VYDKERGFEIIDALHE+PA+  PVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLD
Sbjct: 1065 VYDKERGFEIIDALHEYPAIAVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLD 1124

Query: 962  HLGLTFKQADKKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQLDFDFPDKNIFCDIL 1021
            HLGLTFKQADKKLLTTKQLISEISSIKVDQT+K++HWLTPKPKSQLDF+ PDK+I  DIL
Sbjct: 1125 HLGLTFKQADKKLLTTKQLISEISSIKVDQTHKRMHWLTPKPKSQLDFNLPDKDIIFDIL 1184

Query: 1022 YLADSFISHTTAYSNPDKERLKDLLKYXXXXXXXXXXXXXXXXXQ----AYKQXXXXXXX 1077
               + F+ HT+ YSNP+KERL D +KY                        K        
Sbjct: 1185 SFVEIFVEHTSTYSNPEKERLIDFMKYFTSLFFSIPLEEIKEAISKRDITEKNDEKLEDK 1244

Query: 1078 XXXXXXXXXRKRSYQQEMTLLDILHRSRYQKLKRSKDEDGKVPQLSEAPDXXXXXXXXXX 1137
                     ++ S    ++L DIL R++YQ+LK   D D      +   D          
Sbjct: 1245 QKNGEENSKKRTSRDITLSLEDILQRTKYQRLKYGDDSDEVDGHGNRHDD--QKLLEEEE 1302

Query: 1138 XXXXXAKNPWLTGNLVEEANSQGMIQNRGIFNLFANTNIYIFFRHWTTIYERLLEIKQMN 1197
                 AK PWL G LVEEAN+QG I +R IFN+F+NTN+YIF RH TT+YERL EIKQMN
Sbjct: 1303 LLRQEAKKPWLLGTLVEEANAQGEIMHRNIFNMFSNTNMYIFIRHLTTMYERLHEIKQMN 1362

Query: 1198 EKVTKEINTRSTVTFAKDLDLLSNQLSEMGLDFIGEDAYKQVLKLSRRLINGDLEHQWFE 1257
            +KV++EI+ R    FAKDL+L+S QL+EMGLDF   D Y+Q+L L +RLI GDLEHQWFE
Sbjct: 1363 DKVSREISGRKISKFAKDLNLISTQLTEMGLDFSEGDVYQQLLVLCKRLILGDLEHQWFE 1422

Query: 1258 ESLRQAYNNRAFKLYTIDKVTQSLVKHAHTLMTDAKTAEIMALFVKDRNVTTTSAKGQII 1317
            ESLRQA+NN+AFKLYT+DKVTQ+LVKHAHT+++D KT EIMALF KDR   +TS+K QI+
Sbjct: 1423 ESLRQAFNNKAFKLYTLDKVTQALVKHAHTIISDLKTTEIMALFEKDRTKNSTSSKDQIL 1482

Query: 1318 YRLQVRSHMSNTENMFRIEFDKRTLHVSIQYIALDDLTLKEPKEDEDKWKYYVTSYALPH 1377
            YRLQ R+ M++ ENMFRIE++  T H+ IQYIALDDLT+K+ K  E+KWKYY+TSYAL H
Sbjct: 1483 YRLQTRARMTHNENMFRIEYNNTTKHICIQYIALDDLTVKDAKTLEEKWKYYITSYALSH 1542

Query: 1378 PTEGVLHEKLKIPFLERLIEFGQDIDGKDVDE--------KFSPEGISVSTLKIKIQPTT 1429
            PTEG+  E ++IPFLER+IE  Q  + ++ D+        K+SPEGIS STLKIKI P  
Sbjct: 1543 PTEGIFQENIQIPFLERIIEEEQLYEDEETDDQKQTKSLMKYSPEGISGSTLKIKIDPQN 1602

Query: 1430 YKLDIENGSYDVFTRKSANKYPTVANDDTHKEVVVQKKELISRFLDCAVHLRNDLNESQK 1489
            Y L+IE GS+D+F+RKS N++P     D+    + + K  + +FL+  +  +  +++ Q 
Sbjct: 1603 YCLNIEEGSFDIFSRKSLNQFPVKLTQDSKYGTMPKLKNTVEKFLNSKMGWKRAISKDQM 1662

Query: 1490 ISMQEKFESLKD 1501
             S++ K++ L +
Sbjct: 1663 ESIESKWDHLSN 1674

 Score =  291 bits (744), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 174/320 (54%), Positives = 200/320 (62%), Gaps = 58/320 (18%)

Query: 229 YRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPI 288
           YRPLNVKDALSYLEQVKFQF+SRPD+YN FLDIMKDFKSQAIDTPGVI RVS+LF  YP 
Sbjct: 299 YRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIARVSSLFHDYPS 358

Query: 289 LIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTTTVNNNISPPERGTIDAQEPSSLPEAD 348
           LIQGFNTFLPQGYRIECS+NP+ PI V TPMGTTTV+  +        + Q   SLP+  
Sbjct: 359 LIQGFNTFLPQGYRIECSSNPNLPITVITPMGTTTVSGVLETSVTENQNHQLQHSLPQP- 417

Query: 349 GNGTQRSHNVP---------MVPSNVYHSEQNQ---------DQQQVLPLSAT-STGLPS 389
            + T  + NV          M PSN+    Q Q         +     P+S + S+ +PS
Sbjct: 418 -STTASASNVDSKVSSISGIMGPSNITEQSQQQQRHHPQQLINVNDSAPISGSISSTVPS 476

Query: 390 ---------------------------IQQSEIPVH------HQIPQIQ----PLAVQED 412
                                        Q+  P+        Q P +     PL    +
Sbjct: 477 NVEPTNMNAAANAAISAASALPNTNTPKSQTTPPIATAGTATQQFPMVSSVSPPLQELPE 536

Query: 413 VKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQN 472
            ++  DVEFSQAISYVNKIK RFA+QP IYKHFLEILQTYQREQKPINEVY+QVT LFQ 
Sbjct: 537 QRRTQDVEFSQAISYVNKIKNRFANQPYIYKHFLEILQTYQREQKPINEVYSQVTVLFQE 596

Query: 473 APDLLEDFKKFLPDSSASAN 492
           APDLLEDFKKFLPDSSA+ N
Sbjct: 597 APDLLEDFKKFLPDSSANNN 616

>Kwal_56.22462 s56 complement(139779..144404) [4626 bp, 1541 aa] {ON}
            YOL004W (SIN3) - DNA binding protein involved in
            transcriptional regulation [contig 185] FULL
          Length = 1541

 Score = 1036 bits (2678), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 531/921 (57%), Positives = 645/921 (70%), Gaps = 31/921 (3%)

Query: 551  FLYPASSYYGHSNNRGIPQQNLPPIGSFSPPTNGSTVHENYQDQQHMQPPHL-MPLPSMV 609
            F +PAS +Y H   R    QNLPP+G+FSPP NG   +E   +   +QPP L  P     
Sbjct: 563  FNHPAS-FYQHQQARA---QNLPPLGNFSPPINGRD-NEAQVNLPAVQPPALDFPPQQQS 617

Query: 610  QHGANIVHQGIANENLPLSDLRTSLTEQYAXXXXXXXXXXXXXXXXXXANSQYGDVPVRP 669
            Q   ++V QG+ N +LP+SD+R  +   +A                   + QY +   RP
Sbjct: 618  QSHRHVVAQGMTNNSLPVSDMRGPVDGGFAPQPLYSQ------------DVQYMEPTSRP 665

Query: 670  EIDLDXXXXXXXXXXXXXXXDNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDIL 729
            EIDLD               ++ +L EE +FF+KAK+Y+GNK +YTEFLKILNL+SQD++
Sbjct: 666  EIDLDPSLVPVIPEPIRPLENDSTLIEETSFFDKAKKYMGNKQVYTEFLKILNLFSQDLI 725

Query: 730  DLDDLVEKVDFYLGSNKELFSWFKNFVGYQERTKFIENIVHEKHRLDLDLCEAFGPSYKR 789
            D D+LV+KV+ YLG N ELF WFK+FV Y ER K IEN+VHEKHRLDLDLCEA  PSYK+
Sbjct: 726  DTDELVDKVEHYLGGNSELFDWFKSFVNYVERPKHIENVVHEKHRLDLDLCEACCPSYKK 785

Query: 790  LPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEY 849
            LPK+DTFMPC GRD+MCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEY
Sbjct: 786  LPKADTFMPCCGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEY 845

Query: 850  DFYIESNLRTIQCLETIVNKIENMTENEKVNFKLPPGLGHTSMTIYKKVIRKVYDKERGF 909
            D+YIE+NLRTIQ LETI NKI NMT  EK  FKLPPGLGHTS TIYKKVIRKVYDK+RGF
Sbjct: 846  DYYIEANLRTIQLLETIANKISNMTVEEKKTFKLPPGLGHTSTTIYKKVIRKVYDKDRGF 905

Query: 910  EIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQ 969
            EIIDALHE+PAV+ P+VL+RLKQKDEEWRRAQREWNKVWRELEQKVF+KSLDHLGLTFKQ
Sbjct: 906  EIIDALHENPAVSVPIVLRRLKQKDEEWRRAQREWNKVWRELEQKVFYKSLDHLGLTFKQ 965

Query: 970  ADKKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQLDFDFPDKNIFCDILYLADSFIS 1029
            ADKKLLT KQLISEISSIK+DQ NK+I+  T KPKSQLDFD  DK +  DIL L D+FI 
Sbjct: 966  ADKKLLTAKQLISEISSIKIDQANKRIYPFTSKPKSQLDFDISDKGVLFDILNLVDTFID 1025

Query: 1030 HTTAYSNPDKERLKDLLKYXXXXXXXXXXXXXXXXXQAYKQXXXXXXXXXXXXXXXXRKR 1089
            H+T YSNPDKE+L    +                  + +K                 RKR
Sbjct: 1026 HSTTYSNPDKEKLSAFFRGFLSIFFSIPLTDLDNPSEEHK----------VENGDSTRKR 1075

Query: 1090 SYQQEMTLLDILHRSRYQKLKR-SKDEDGKVPQLSEAPDXXXXXXXXXXXXXXXAKNPWL 1148
            S   +    D+L     Q  K+ S+ ED       +                  AK PWL
Sbjct: 1076 SRDDDQFFRDLLKSKHKQAKKKTSQQEDESTSDDQDTAAKTSPDLEYEEAVRLDAKKPWL 1135

Query: 1149 TGNLVEEANSQGMIQNRGIFNLFANTNIYIFFRHWTTIYERLLEIKQMNEKVTKEINTRS 1208
             GN+++EAN+ G + NR  +N+FANTNIY+FFRH TT+Y+RL E K +NE+VTKEIN+R 
Sbjct: 1136 LGNILDEANNHGFVSNRKTYNMFANTNIYVFFRHLTTMYQRLSEAKNINEEVTKEINSRK 1195

Query: 1209 TVTFAKDLDLLSNQLSEMGLDFIGEDAYKQVLKLSRRLINGDLEHQWFEESLRQAYNNRA 1268
             V FAKDL+L S QLS+MGLDF G DAY+Q+L L +RLI  D+EHQWFEESLRQAY N+A
Sbjct: 1196 VVQFAKDLNLASTQLSDMGLDFKGADAYEQLLALCKRLIQSDIEHQWFEESLRQAYKNKA 1255

Query: 1269 FKLYTIDKVTQSLVKHAHTLMTDAKTAEIMALFVKDRNVTTTSAKGQIIYRLQVRSHMSN 1328
            FK+YT+DKV QSLVKHAH+++TDAKTAEIM LF KDR   TTS + QI+YRLQVRS M  
Sbjct: 1256 FKIYTVDKVIQSLVKHAHSIITDAKTAEIMILFEKDRKAPTTSTREQILYRLQVRSCMGL 1315

Query: 1329 TENMFRIEFDKRTLHVSIQYIALDDLTLKEPKEDEDKWKYYVTSYALPHPTEGVLHEKLK 1388
            TENMFRIE +  + HVSIQ++A+DDLTL +P   +D+W+YY+TSY+L HPTEGV HE++K
Sbjct: 1316 TENMFRIELNSTSAHVSIQFVAVDDLTLNQPNSLKDQWQYYLTSYSLSHPTEGVPHEEIK 1375

Query: 1389 IPFLERLIEFGQDIDGKDVDEKFSPEGISVSTLKIKIQPTTYKLDIENGSYDVFTRKSAN 1448
             PFLE+ +    D D  +  E +SP G SVS L+I+I P +Y L IE  S D+FTR + N
Sbjct: 1376 APFLEKTLR--DDGDSDEDSEWYSPGGQSVSQLRIQINPESYALQIEPNSKDLFTRSTVN 1433

Query: 1449 KYPTVANDDTHKEVVVQKKEL 1469
            K+PT   + + ++    +K L
Sbjct: 1434 KHPTKIGEASGRDAKTMQKSL 1454

 Score =  284 bits (727), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 163/273 (59%), Positives = 193/273 (70%), Gaps = 21/273 (7%)

Query: 229 YRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPI 288
           YRPLN KDALSYLEQVKFQF++RPD+YN FLDIMKD+KSQAIDT GVIER+STLF+GYP+
Sbjct: 249 YRPLNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFKGYPV 308

Query: 289 LIQGFNTFLPQGYRIECSTNPDDP--IRVTTPMGTT---TVNNNISPPERGTIDAQEPSS 343
           LIQG NTFLPQGY+IEC++NP DP  I+VTTP  TT   ++++N      G   A  P++
Sbjct: 309 LIQGLNTFLPQGYKIECTSNPHDPHSIKVTTPFDTTRELSLDHNTGGSAVGGHLAG-PAT 367

Query: 344 LPEADGNGTQRSHNVPMVPSNVYHSEQNQDQQQV-LPLSATSTG-----LPSIQQSEIPV 397
           +       +     +P   + V  SE  Q++  V LP SA           S  Q EI  
Sbjct: 368 V-------STSPSQIPRQETAV--SETKQEETPVDLPASAAFAQDQVHHAESDTQREIQK 418

Query: 398 HHQIPQIQPLAVQEDVKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQK 457
             Q+ Q Q        + N DVEFS AISYVNKIKTRFADQPDIYKHFLEILQTYQREQK
Sbjct: 419 SAQLQQSQQDQQYATNRPNGDVEFSHAISYVNKIKTRFADQPDIYKHFLEILQTYQREQK 478

Query: 458 PINEVYAQVTHLFQNAPDLLEDFKKFLPDSSAS 490
           PI+EVY QVT LFQNAPDLL+DFKKFLPD++A+
Sbjct: 479 PIHEVYTQVTSLFQNAPDLLDDFKKFLPDATAA 511

>KLLA0C06182g Chr3 (544281..548840) [4560 bp, 1519 aa] {ON} similar to
            uniprot|Q75CF0 Ashbya gossypii ACL004W ACL004Wp and
            weakly similar to YOL004W uniprot|P22579 Saccharomyces
            cerevisiae YOL004W SIN3 DNA binding protein involved in
            transcriptional regulation
          Length = 1519

 Score = 1021 bits (2640), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 524/953 (54%), Positives = 651/953 (68%), Gaps = 45/953 (4%)

Query: 571  NLPPIGSFSPPTNGSTVHENYQDQQHMQPPHLMPLPSMVQHGAN-------IVHQGIANE 623
            NLPP+G+FS     S       +  HM       LPSM QH A        +V QG++N+
Sbjct: 572  NLPPLGNFSASGQASPA-----ENSHM-------LPSMHQHIAGGHVIPQHVVTQGMSNQ 619

Query: 624  NLPLSDLRTSLTEQYAXXXXXXXXXXXXXXXXXXANSQYGDVPV-RPEIDLDXXXXXXXX 682
            ++P+S++R+++   Y                      QY + P+ RPEIDLD        
Sbjct: 620  DIPVSEMRSTMNGTY---NQVEYIQGAPGYPQPLEGVQYMEAPMARPEIDLDPSLVPVVP 676

Query: 683  XXXXXXXDNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILDLDDLVEKVDFYL 742
                   D I+L +EVTFFE+ KR+IGNK +Y EFLKILNLYSQD+L   +LV KV+FYL
Sbjct: 677  EPIQPPEDAIALGDEVTFFERVKRFIGNKQVYAEFLKILNLYSQDLLTTSELVSKVEFYL 736

Query: 743  GSNKELFSWFKNFVGYQERTKFIENIVHEKHRLDLDLCEAFGPSYKRLPKSDTFMPCSGR 802
             S+KELF WFK+FVGYQE+ K IENIVHEKHRLDLDLCEA GPSYK+LPK DTFMPCSGR
Sbjct: 737  HSSKELFDWFKSFVGYQEKPKHIENIVHEKHRLDLDLCEACGPSYKKLPKDDTFMPCSGR 796

Query: 803  DDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQC 862
            D+MCWEVLNDEWVGHPVWASEDSGFIAHRKNQYE+TLFK+EEERHEYDFYIESNLRTIQ 
Sbjct: 797  DEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEDTLFKVEEERHEYDFYIESNLRTIQT 856

Query: 863  LETIVNKIENMTENEKVNFKLPPGLGHTSMTIYKKVIRKVYDKERGFEIIDALHEHPAVT 922
            LETI NKI NMT  EK NFKLPPGLGHTS+TIYKKV+RKVYDK+RGFEIIDALHEHPAVT
Sbjct: 857  LETIANKIANMTNEEKNNFKLPPGLGHTSLTIYKKVVRKVYDKDRGFEIIDALHEHPAVT 916

Query: 923  APVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQADKKLLTTKQLIS 982
             P+VLKRLKQKDEEWRRAQREWNKVWRELEQKV++KSLDHLGLTFKQADKKLLTTKQL+S
Sbjct: 917  VPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLLS 976

Query: 983  EISSIKVDQTNKKIHWLTPKPKSQLDFDFPDKNIFCDILYLADSFISHTTAYSNPDKERL 1042
            EISSIKVDQTNK+IH LTPKPKSQLDF+  D+ +  DIL L  +F+    +YSN DK +L
Sbjct: 977  EISSIKVDQTNKRIHPLTPKPKSQLDFEINDREVLYDILDLVFTFVKTNASYSNSDKIKL 1036

Query: 1043 KDLLK-----YXXXXXXXXXXXXXXXXXQAYKQXXXXXXXXXXXXXXXXRKRSYQQEMTL 1097
                K     +                    ++                R  S +    +
Sbjct: 1037 DHFFKAFISLFFSYPIKDVNEAVSERSSITDQENGEEDSNKSDSEKSNKRTLSDEDSYLM 1096

Query: 1098 LDILHRSRYQKLKRSKDEDGKVPQLSEAPDXXXXXXXXXXXXXXXAKNPWLTGNLVEEAN 1157
             DIL R++  K   S++        S   D               A  PWL G+L++EAN
Sbjct: 1097 KDILRRTKNAKTSNSEENQNSSSVKSNEED-------ETELLAKEAAKPWLLGSLIDEAN 1149

Query: 1158 SQGMIQNRGIFNLFANTNIYIFFRHWTTIYERLLEIKQMNEKVTKEINTRSTVTFAKDLD 1217
            + G++ +R IFNLF NT IY+FFRH  T+YERLLE+K+++ +VT EI  R  V FA DL+
Sbjct: 1150 NSGIVSDRHIFNLFTNTTIYVFFRHLNTLYERLLEVKKIDAEVTDEIKNRKIVQFASDLN 1209

Query: 1218 LLSNQLSEMGLDFIGEDAYKQVLKLSRRLINGDLEHQWFEESLRQAYNNRAFKLYTIDKV 1277
            L+S QL++MGL F    AY ++L+LS+RLI GDL+HQWFEESLRQAY N+AFK+YTIDKV
Sbjct: 1210 LISTQLADMGLAFKDTKAYGELLRLSKRLITGDLDHQWFEESLRQAYKNKAFKIYTIDKV 1269

Query: 1278 TQSLVKHAHTLMTDAKTAEIMALFVKDRNVTTTSAKGQIIYRLQVRSHMSNTENMFRIEF 1337
             QSLVKHAH+++TD K A +M LF +DR    T+AK QI+YRL+VR+ M  +ENMFRIE+
Sbjct: 1270 VQSLVKHAHSIITDPKNAMVMVLFEQDRLKRDTTAKDQILYRLKVRNTMGESENMFRIEY 1329

Query: 1338 DKRTLHVSIQYIALDDLTLKEPKEDEDKWKYYVTSYALPHPTEGVLHEKLKIPFLERLIE 1397
            +  + HVSIQY+A+DDLTLKEP+  ++KW YYVTSY+L HPTEG+  E +  PFL ++IE
Sbjct: 1330 NTDSSHVSIQYVAVDDLTLKEPQNMKEKWDYYVTSYSLSHPTEGITQEDISQPFLGKIIE 1389

Query: 1398 F-GQDIDGKDVDEKFSPEGISVSTLKIKIQPTTYKLDIENGSYDVFTRKSANKYPTVAND 1456
               + +D ++ ++KFSPEG+S S LK+ I P TY+L  E GS DVFTRKS NK+P+  + 
Sbjct: 1390 KEAEYLDDEEQNDKFSPEGVSQSKLKVNIHPETYELTFECGSTDVFTRKSVNKFPSSQS- 1448

Query: 1457 DTHKEVVVQKKELISRFLDCAVHLRNDLNESQKISMQEKFESLKDTTAKLNVD 1509
                    Q    + +FL+ +   + +L+       + K + LK+   KL +D
Sbjct: 1449 -------TQPASKMDKFLNSSKGWKKNLSTEIIGRAESKMKILKE-QGKLEID 1493

 Score =  183 bits (465), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 82/94 (87%), Positives = 90/94 (95%)

Query: 229 YRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPI 288
           YRPLNVKDALSYLEQVKFQFSSRPD+YN FLDIMKDFKSQAIDTPGVI+RV+TLF+G+P 
Sbjct: 201 YRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIQRVTTLFQGFPN 260

Query: 289 LIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTT 322
           LIQGFNTFLP GY+IECSTNP+DPI+VTTP GTT
Sbjct: 261 LIQGFNTFLPHGYKIECSTNPNDPIKVTTPFGTT 294

>CAGL0J11594g Chr10 complement(1126896..1129709) [2814 bp, 937 aa]
            {ON} weakly similar to uniprot|P22579 Saccharomyces
            cerevisiae YOL004w SIN3 transcription regulatory protein
          Length = 937

 Score =  239 bits (609), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 133/327 (40%), Positives = 201/327 (61%), Gaps = 29/327 (8%)

Query: 708  IGNKHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNKELFSWFKNFVG-YQERTKFIE 766
            + ++ +Y EFLK++NL++Q ++DL+   ++   + GS+  L + F N +  Y++      
Sbjct: 214  VYDESIYPEFLKLMNLFAQSLIDLNTFTKRAYIFFGSHNGLKTAFGNIMSEYKD------ 267

Query: 767  NIVHEKHR-----LDLDLCEAF----GPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGH 817
              +H++ +      D D  E F    GPSYKRL   +T   C GRD +C EVLNDEWVGH
Sbjct: 268  --IHQRMKPTLKSNDFDDIEDFSTESGPSYKRLSGFETRASCHGRDRLCHEVLNDEWVGH 325

Query: 818  PVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESN----LRTIQCLETIVNKIENM 873
            PVWASE+ GFIAH+KNQYEETLFK+EEERHEYDF++ S     ++  +  +++    ++ 
Sbjct: 326  PVWASEEVGFIAHKKNQYEETLFKVEEERHEYDFFLLSVEHLIVKFTEYEKSLQLSKDDG 385

Query: 874  TENEKVNFKLPPGLGHTSMTIYKKVIRKVYDKERGFEIIDALHEHPAVTAPVVLKRLKQK 933
                +V+    P +   S+T  +KVIR++Y  E G  +IDA+  +P    P +LK  K+K
Sbjct: 386  RRRNRVSSPKEPMISLNSIT--EKVIRRLYGIEHGNILIDAIKTNPEKVVPTILKTAKEK 443

Query: 934  DEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTN 993
             ++W  A+ EWNK WRE+EQK ++KSLDHLGL FK A+K+ L  KQL+ E  S K D+  
Sbjct: 444  YQQWNSAKNEWNKAWREVEQKAYYKSLDHLGLPFKNAEKRFLNDKQLLLEYKSEKQDKLL 503

Query: 994  KKIHWLTPKPKSQLDFDFPDKNIFCDI 1020
            K+ H+       +  ++F DK++  D+
Sbjct: 504  KE-HY----DNYEYKYEFFDKSVLYDV 525

 Score =  123 bits (309), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 90/282 (31%), Positives = 144/282 (51%), Gaps = 11/282 (3%)

Query: 1164 NRGIFNLFANTNIYIFFRHWTTIYERLLEIKQMNEKVTKEINT--RSTVTFAKDLDLLSN 1221
            NR   N+F + NI   F +  T+YER  ++K     + K++ T  R     AK L LL  
Sbjct: 619  NRQNINIFCDINIMSLFHYIQTLYERYNDVKIAETTILKDLRTKKRRPSLLAKSLKLLPM 678

Query: 1222 QLSEMGLDFIGEDAYKQVLKLSRRLINGDLEHQWFEESLRQAYNNRAFKLYTIDKVTQSL 1281
            QLS+ GL+   +D Y+ +   S++ ++G+L+HQWFEESLR  + N+A+KLYTID+V +++
Sbjct: 679  QLSDNGLELGQDDGYEWIKTTSKKFLSGNLDHQWFEESLRINFENKAYKLYTIDRVIRNI 738

Query: 1282 VKHAHTLMTDAKTAEIMALFVKDRNVTTTSAKGQIIYRLQVRSHMSNTENMFRIEFDKRT 1341
            +    T+       +I+ L V +    TT+   Q+ YR +VR  M    +MFR+E  + +
Sbjct: 739  LGVITTISQTPSLLQILDLLVDNMKKLTTTKLQQLTYRTKVRMLMDGVGDMFRLEIVRDS 798

Query: 1342 LHVSIQYIALDDLTLKEPKEDEDKWKYYVTSYALPHPTEGVLHEKLKIPF--LERLIEFG 1399
              +  QYI +DDL   +  +++ +   Y   Y     T+ +  + L  P+  L  L    
Sbjct: 799  NAIYGQYIGVDDLLHAQLDKNKLEHSLYCQEYLSADATKYLDTDGLNTPYYSLNLLKREE 858

Query: 1400 QDIDGKDVDEKFSPEGISVSTLKIKIQPTTYKLDIENGSYDV 1441
            Q+I        F    I    L + I P  Y +DI  GS D+
Sbjct: 859  QNI-------PFMNGNIYKPHLSVNINPLDYVVDIAPGSIDI 893

>Suva_15.170 Chr15 (290805..291290) [486 bp, 161 aa] {ON}  YOL004W
           (REAL)
          Length = 161

 Score =  121 bits (303), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 77/119 (64%), Gaps = 14/119 (11%)

Query: 1   MSQVWHNPNSQSNDVATSNDAAGSNERNERNEKEPLLXXXXXXXXXXXXRITLPSLSALN 60
           MSQVWHNPNSQSN+ +T+NDAA SNER E   KEP L            RITLPSLSALN
Sbjct: 1   MSQVWHNPNSQSNEASTANDAASSNERTE---KEPPLQGAQPSFVQPQQRITLPSLSALN 57

Query: 61  NKEENGRDSNGQL-----------PLASHGTHILGYPPTHPNIIPSITSDSTFKQSHEY 108
            K+E+ R+ NG             PLASH T ILGYPP H N++PSIT+DS  KQ H+Y
Sbjct: 58  AKDEDRREGNGNGNGNGQQQQQQQPLASHSTRILGYPPAHSNVMPSITTDSALKQPHDY 116

>Kpol_1064.53 s1064 (95468..96937) [1470 bp, 489 aa] {ON}
           (95468..96937) [1470 nt, 490 aa]
          Length = 489

 Score = 42.4 bits (98), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 38/69 (55%), Gaps = 3/69 (4%)

Query: 707 YIGNKHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNKELFSWFKNFVGYQ---ERTK 763
           Y G K++Y ++LK+LN   QD   + D VE  D     + ++  +  N + YQ   ER K
Sbjct: 80  YTGLKNMYQDYLKVLNQLKQDKAAVRDEVEASDDKPEESSDVLEYIVNELPYQQPTERKK 139

Query: 764 FIENIVHEK 772
           +I+N +H K
Sbjct: 140 YIDNFIHSK 148

>KAFR0A04880 Chr1 complement(964742..965776) [1035 bp, 344 aa] {ON} 
          Length = 344

 Score = 34.7 bits (78), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 62/141 (43%), Gaps = 27/141 (19%)

Query: 1145 NPWLTGNLVEEANSQGMIQNRGIFNLFANTNIYIFFRHWTTIYERLLE----IKQMNEKV 1200
            N WL  N+           N G++ +   T    F  +  T+Y +L E    +K + + +
Sbjct: 186  NSWLQENI-----------NMGVYKIGLATKQSEFESNLATLYRKLNECEDHLKGVYKDI 234

Query: 1201 TKEINTRSTVTFAKDLDLLSNQLSEMGLDFIG-----EDAYKQVLKLSRRLINGDLE--H 1253
             KE+   + V   K   L  NQ+++  + F       + ++ Q LK + R+I  D    H
Sbjct: 235  EKEVGKNNKVEILKKFYLFGNQITDTDIRFYTTAIRFDSSHAQHLKCNWRIIRDDYPYIH 294

Query: 1254 QWFEESLRQAY-NNRAFKLYT 1273
             W    LR  Y N++AF+L T
Sbjct: 295  LW----LRNLYWNHKAFRLTT 311

>CAGL0H05071g Chr8 (486899..490231) [3333 bp, 1110 aa] {ON} similar
           to uniprot|Q12749 Saccharomyces cerevisiae YLR383w RHC18
          Length = 1110

 Score = 33.9 bits (76), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 45/103 (43%), Gaps = 10/103 (9%)

Query: 357 NVPMVPSNVYHSE-----QNQDQQQVLPLSATSTGLPSIQQSEIPVHHQIPQIQPLAVQE 411
           N+P +  N+   E     Q Q  Q++ P +  S  LP  Q+    +  +I  IQ   +QE
Sbjct: 859 NIPKIADNIRVLEDGVGLQKQKAQEICPRAELSNDLPHSQE---EIKQEITNIQQ-KLQE 914

Query: 412 DVKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQR 454
             +K + +   Q +   N  KT+F D    YK   E+L    R
Sbjct: 915 -AEKMMGMSQQQIVDNYNNAKTKFIDASKKYKVIEEVLGKLTR 956

>ADR150C Chr4 complement(969444..970697) [1254 bp, 417 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR067C
          Length = 417

 Score = 33.1 bits (74), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 51/188 (27%), Positives = 82/188 (43%), Gaps = 23/188 (12%)

Query: 308 NPDDPIRVTTPMGTTTVNNNISPPERGTIDAQEPSSLPEADGNGTQRSHNVPMVPSNVYH 367
           N D  IR+  P  TT  N+N S    G++ A+  SS        +QR    P  P+   H
Sbjct: 152 NEDVMIRLRLPGSTTRKNSNASV---GSVGARASSSRKSEGSGSSQRCK--PEEPAQKTH 206

Query: 368 SEQNQDQQQVLPLSATSTGLPSIQQSEIPVHHQIPQIQPLAVQEDVKKNVDVEFSQAISY 427
           S   +   +VL L      +PS   S      + P+ +PL V+ED + + ++     + Y
Sbjct: 207 S-HTKKLHKVLAL------VPSRSSST----SKAPE-KPL-VEEDSEGDYELSEQDVLKY 253

Query: 428 VNKIKTRFADQPDIYKHFLEIL--QTYQR-EQKPINEVYAQVTHLFQ--NAPDLLEDFKK 482
            + +  R    P + K   E +  +T+++ EQ  I      +THL    +  D +ED  K
Sbjct: 254 QSMLAKRAMGGPLLTKRLREEMDNKTHKKVEQCNIRVRLPDLTHLEACFDKDDTMEDVYK 313

Query: 483 FLPDSSAS 490
            +  S AS
Sbjct: 314 LVSQSLAS 321

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.132    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 154,412,035
Number of extensions: 6946125
Number of successful extensions: 25308
Number of sequences better than 10.0: 72
Number of HSP's gapped: 25889
Number of HSP's successfully gapped: 152
Length of query: 1566
Length of database: 53,481,399
Length adjustment: 123
Effective length of query: 1443
Effective length of database: 39,377,481
Effective search space: 56821705083
Effective search space used: 56821705083
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 73 (32.7 bits)