Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_14.651.81ON79079034780.0
Skud_14.681.81ON75279027260.0
Suva_14.701.81ON75155824530.0
YNL272C (SEC2)1.81ON75955824480.0
NDAI0F042301.81ON70154015730.0
NCAS0A005801.81ON68952815520.0
SAKL0C02596g1.81ON73453415280.0
KAFR0D039601.81ON66452114830.0
TDEL0C062001.81ON70052914590.0
CAGL0J08228g1.81ON75251214450.0
Kpol_2000.671.81ON82452013871e-180
KLTH0F02354g1.81ON73354313621e-177
ZYRO0F16698g1.81ON77955313461e-174
Kwal_33.133891.81ON69453213331e-174
Ecym_10851.81ON70551613091e-170
AFR670W1.81ON71751812971e-168
KLLA0C02299g1.81ON65851812911e-168
TPHA0B045001.81ON73352012921e-167
KNAG0F004601.81ON65453012771e-166
TBLA0A054301.81ON79556812521e-160
TPHA0L002404.364ON732113940.014
Kpol_1026.314.46ON1005231860.15
Ecym_20615.88ON1362160840.22
Kpol_483.104.237ON1118112810.53
ADL149W5.88ON1211135781.4
KLTH0D04906g2.452ON36271761.7
Skud_9.412.235ON1359104761.9
Skud_16.1168.693ON21143722.9
CAGL0K03795g2.409ON1295122753.1
TBLA0I028904.237ON1098110726.1
NDAI0G050708.105ON23481707.2
Skud_13.3252.347ON707130709.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_14.65
         (790 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_14.65 Chr14 complement(105762..108134) [2373 bp, 790 aa] {O...  1344   0.0  
Skud_14.68 Chr14 complement(115311..117569) [2259 bp, 752 aa] {O...  1054   0.0  
Suva_14.70 Chr14 complement(121375..123630) [2256 bp, 751 aa] {O...   949   0.0  
YNL272C Chr14 complement(126805..129084) [2280 bp, 759 aa] {ON} ...   947   0.0  
NDAI0F04230 Chr6 (1031871..1033976) [2106 bp, 701 aa] {ON} Anc_1...   610   0.0  
NCAS0A00580 Chr1 complement(99945..102014) [2070 bp, 689 aa] {ON...   602   0.0  
SAKL0C02596g Chr3 complement(238404..240608) [2205 bp, 734 aa] {...   593   0.0  
KAFR0D03960 Chr4 (776847..778841) [1995 bp, 664 aa] {ON} Anc_1.8...   575   0.0  
TDEL0C06200 Chr3 (1128241..1130343) [2103 bp, 700 aa] {ON} Anc_1...   566   0.0  
CAGL0J08228g Chr10 (815653..817911) [2259 bp, 752 aa] {ON} simil...   561   0.0  
Kpol_2000.67 s2000 (144161..146635) [2475 bp, 824 aa] {ON} (1441...   538   e-180
KLTH0F02354g Chr6 complement(193705..195906) [2202 bp, 733 aa] {...   529   e-177
ZYRO0F16698g Chr6 (1382642..1384981) [2340 bp, 779 aa] {ON} weak...   523   e-174
Kwal_33.13389 s33 complement(197441..199525) [2085 bp, 694 aa] {...   518   e-174
Ecym_1085 Chr1 complement(170657..172774) [2118 bp, 705 aa] {ON}...   508   e-170
AFR670W Chr6 (1668415..1670568) [2154 bp, 717 aa] {ON} Syntenic ...   504   e-168
KLLA0C02299g Chr3 complement(194267..196243) [1977 bp, 658 aa] {...   501   e-168
TPHA0B04500 Chr2 (1059147..1061348) [2202 bp, 733 aa] {ON} Anc_1...   502   e-167
KNAG0F00460 Chr6 complement(64086..66050) [1965 bp, 654 aa] {ON}...   496   e-166
TBLA0A05430 Chr1 complement(1334141..1336528) [2388 bp, 795 aa] ...   486   e-160
TPHA0L00240 Chr12 (28408..30606) [2199 bp, 732 aa] {ON} Anc_4.36...    41   0.014
Kpol_1026.31 s1026 complement(71225..74242) [3018 bp, 1005 aa] {...    38   0.15 
Ecym_2061 Chr2 (99788..103876) [4089 bp, 1362 aa] {ON} similar t...    37   0.22 
Kpol_483.10 s483 (21646..25002) [3357 bp, 1118 aa] {ON} (21646.....    36   0.53 
ADL149W Chr4 (427096..430731) [3636 bp, 1211 aa] {ON} Syntenic h...    35   1.4  
KLTH0D04906g Chr4 complement(446504..447592) [1089 bp, 362 aa] {...    34   1.7  
Skud_9.41 Chr9 (95085..99164) [4080 bp, 1359 aa] {ON} YIL126W (R...    34   1.9  
Skud_16.116 Chr16 (208753..209388) [636 bp, 211 aa] {ON} YPL166W...    32   2.9  
CAGL0K03795g Chr11 (350378..354265) [3888 bp, 1295 aa] {ON} simi...    33   3.1  
TBLA0I02890 Chr9 (683688..686984) [3297 bp, 1098 aa] {ON} Anc_4....    32   6.1  
NDAI0G05070 Chr7 (1231923..1232627) [705 bp, 234 aa] {ON} Anc_8....    32   7.2  
Skud_13.325 Chr13 complement(557270..559393) [2124 bp, 707 aa] {...    32   9.4  

>Smik_14.65 Chr14 complement(105762..108134) [2373 bp, 790 aa] {ON}
           YNL272C (REAL)
          Length = 790

 Score = 1344 bits (3478), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 671/790 (84%), Positives = 671/790 (84%)

Query: 1   MDASEEAKRISLQVTSLSTQLIESVDKQSHLEEQLNKSLKTISSQKEAIVNYNRLKTDYE 60
           MDASEEAKRISLQVTSLSTQLIESVDKQSHLEEQLNKSLKTISSQKEAIVNYNRLKTDYE
Sbjct: 1   MDASEEAKRISLQVTSLSTQLIESVDKQSHLEEQLNKSLKTISSQKEAIVNYNRLKTDYE 60

Query: 61  ALKRTVLEKDDEVNKLREDVVKENELRTKAEDENDKLNKEVEDLTASLFDEANNMVSDAR 120
           ALKRTVLEKDDEVNKLREDVVKENELRTKAEDENDKLNKEVEDLTASLFDEANNMVSDAR
Sbjct: 61  ALKRTVLEKDDEVNKLREDVVKENELRTKAEDENDKLNKEVEDLTASLFDEANNMVSDAR 120

Query: 121 KEKYAIEILNKRLTEQLREKDTLLDTLSLQLKNLKKVMHSLDNESVVTNSSNRYSTILND 180
           KEKYAIEILNKRLTEQLREKDTLLDTLSLQLKNLKKVMHSLDNESVVTNSSNRYSTILND
Sbjct: 121 KEKYAIEILNKRLTEQLREKDTLLDTLSLQLKNLKKVMHSLDNESVVTNSSNRYSTILND 180

Query: 181 SATSSSTSLNKVPTLNSSASQDMYSGIVYSPSISSIRYDVSLYNEFLKFVAALPNCDNIK 240
           SATSSSTSLNKVPTLNSSASQDMYSGIVYSPSISSIRYDVSLYNEFLKFVAALPNCDNIK
Sbjct: 181 SATSSSTSLNKVPTLNSSASQDMYSGIVYSPSISSIRYDVSLYNEFLKFVAALPNCDNIK 240

Query: 241 ATSSESKLIRRLVNDEIQPILKIDNASGIGWLVKKTLLSLIIDGLVVMEPLSGVNATYQI 300
           ATSSESKLIRRLVNDEIQPILKIDNASGIGWLVKKTLLSLIIDGLVVMEPLSGVNATYQI
Sbjct: 241 ATSSESKLIRRLVNDEIQPILKIDNASGIGWLVKKTLLSLIIDGLVVMEPLSGVNATYQI 300

Query: 301 GYNSSSPVKQATPNMPRMFKFPLDSPPVAVHAACSFCGESRDDIIEHARMYILKTLHKAD 360
           GYNSSSPVKQATPNMPRMFKFPLDSPPVAVHAACSFCGESRDDIIEHARMYILKTLHKAD
Sbjct: 301 GYNSSSPVKQATPNMPRMFKFPLDSPPVAVHAACSFCGESRDDIIEHARMYILKTLHKAD 360

Query: 361 DGTEQVTNTYPLCHWCLLKLRQTCEIFAFLRSLKVGAWHLEKLEAQSITKGDLGKFSEVT 420
           DGTEQVTNTYPLCHWCLLKLRQTCEIFAFLRSLKVGAWHLEKLEAQSITKGDLGKFSEVT
Sbjct: 361 DGTEQVTNTYPLCHWCLLKLRQTCEIFAFLRSLKVGAWHLEKLEAQSITKGDLGKFSEVT 420

Query: 421 KRTKTDGRVSSQDKKAKRLSFMAGLGINSSSKSKQKMEVFSSEANAKPGQPTTNIQRAWL 480
           KRTKTDGRVSSQDKKAKRLSFMAGLGINSSSKSKQKMEVFSSEANAKPGQPTTNIQRAWL
Sbjct: 421 KRTKTDGRVSSQDKKAKRLSFMAGLGINSSSKSKQKMEVFSSEANAKPGQPTTNIQRAWL 480

Query: 481 QLCKLRCILHWSHIGIWAVDDSISSKIGPFVGDEDSDENRDDSISVRLQDKALWXXXXXX 540
           QLCKLRCILHWSHIGIWAVDDSISSKIGPFVGDEDSDENRDDSISVRLQDKALW      
Sbjct: 481 QLCKLRCILHWSHIGIWAVDDSISSKIGPFVGDEDSDENRDDSISVRLQDKALWKKSTGK 540

Query: 541 XXXXXXXXXXXXXDTFDFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 600
                        DTFDF                                          
Sbjct: 541 CSSSSSPGEGPKSDTFDFESEEIESGTTGESSTGESSTGESSTGESSTGESSTGESSTDD 600

Query: 601 XXXXXXXLDGSSTNGSLTXXXXXXXXXXXXXITIHGDSTPPENLHEDEGXXXXXXXXXXX 660
                  LDGSSTNGSLT             ITIHGDSTPPENLHEDEG           
Sbjct: 601 SATDESSLDGSSTNGSLTEESSAEESSPAASITIHGDSTPPENLHEDEGDDTITKDDKSS 660

Query: 661 XXXXXXXXXXXXXXXXXRKNIPKRKAARHRLQKEKLLQDLDHLEEQFMEESAINQKEPEA 720
                            RKNIPKRKAARHRLQKEKLLQDLDHLEEQFMEESAINQKEPEA
Sbjct: 661 IKSIKNNEENSNSDDEKRKNIPKRKAARHRLQKEKLLQDLDHLEEQFMEESAINQKEPEA 720

Query: 721 FDDIVKQIESSEKASTADKNFAIDNLQSTKEQNLTISNKHKEQIRENSPSSGLHAXXXXX 780
           FDDIVKQIESSEKASTADKNFAIDNLQSTKEQNLTISNKHKEQIRENSPSSGLHA     
Sbjct: 721 FDDIVKQIESSEKASTADKNFAIDNLQSTKEQNLTISNKHKEQIRENSPSSGLHASSSND 780

Query: 781 XXXXXAQEQQ 790
                AQEQQ
Sbjct: 781 DNFDDAQEQQ 790

>Skud_14.68 Chr14 complement(115311..117569) [2259 bp, 752 aa] {ON}
           YNL272C (REAL)
          Length = 752

 Score = 1054 bits (2726), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 548/790 (69%), Positives = 604/790 (76%), Gaps = 38/790 (4%)

Query: 1   MDASEEAKRISLQVTSLSTQLIESVDKQSHLEEQLNKSLKTISSQKEAIVNYNRLKTDYE 60
           MDASEEAKRIS+QVTSLSTQLIESVDKQSHLEEQLNKSLKTI+SQK AI NYN+L+TD+ 
Sbjct: 1   MDASEEAKRISIQVTSLSTQLIESVDKQSHLEEQLNKSLKTIASQKAAIENYNQLETDHN 60

Query: 61  ALKRTVLEKDDEVNKLREDVVKENELRTKAEDENDKLNKEVEDLTASLFDEANNMVSDAR 120
            LK+T+ E+DDEV KL ED+ KE +LRTKAEDENDKLN+EVEDLTASLFDEAN MV+DAR
Sbjct: 61  TLKKTLSERDDEVKKLHEDIAKETQLRTKAEDENDKLNREVEDLTASLFDEANTMVADAR 120

Query: 121 KEKYAIEILNKRLTEQLREKDTLLDTLSLQLKNLKKVMHSLDNESVVTNSSNRYSTILND 180
           +EKYAIEILNKRLTEQLREKD LL+TL+LQLKNLKKVMHSLDNES VTN+SNRYSTIL+D
Sbjct: 121 REKYAIEILNKRLTEQLREKDVLLETLTLQLKNLKKVMHSLDNESTVTNNSNRYSTILSD 180

Query: 181 SATSSSTSLNKVPTLNSSASQDMYSGIVYSPSISSIRYDVSLYNEFLKFVAALPNCDNIK 240
           SATSSSTSLNKVPTLNS ASQDMYSGIVYSP+ISSIRYD+SLYNEFLKFVAALP C+NIK
Sbjct: 181 SATSSSTSLNKVPTLNSFASQDMYSGIVYSPTISSIRYDISLYNEFLKFVAALPQCENIK 240

Query: 241 ATSSESKLIRRLVNDEIQPILKIDNASGIGWLVKKTLLSLIIDGLVVMEPLSGVNATYQI 300
           ATSSESKLIRRLVNDEIQPILKIDNASGIGWLVKKTLLSLIIDGLV++EPLSGVNATY I
Sbjct: 241 ATSSESKLIRRLVNDEIQPILKIDNASGIGWLVKKTLLSLIIDGLVIVEPLSGVNATYHI 300

Query: 301 GYNSSSPVKQATPNMPRMFKFPLDSPPVAVHAACSFCGESRDDIIEHARMYILKTLHKAD 360
           GYNSSSPVKQ+T NMP+MFKFPL+SPPVAVHAACSFCGESRDDIIEHARMY+LKTLHKAD
Sbjct: 301 GYNSSSPVKQSTANMPKMFKFPLNSPPVAVHAACSFCGESRDDIIEHARMYVLKTLHKAD 360

Query: 361 DGTEQVTNTYPLCHWCLLKLRQTCEIFAFLRSLKVGAWHLEKLEAQSITKGDLGKFSEVT 420
           DGTEQVTNTYPLCHWCLLKLRQTCEIFAFLRSLKVGAWHLEKL  Q+I KGDL KFSEVT
Sbjct: 361 DGTEQVTNTYPLCHWCLLKLRQTCEIFAFLRSLKVGAWHLEKLVMQNIAKGDLVKFSEVT 420

Query: 421 KRTKTDGRVSSQDKKAKRLSFMAGLGINSSSKSKQKMEVFSSEANAKPGQPTTNIQRAWL 480
           +RTKT+ RVSS DKK+KRLSFMAGLGINS++KSK KMEVFSSE NAKPGQPTTNIQRAWL
Sbjct: 421 QRTKTEDRVSSHDKKSKRLSFMAGLGINSTAKSKPKMEVFSSEINAKPGQPTTNIQRAWL 480

Query: 481 QLCKLRCILHWSHIGIWAVDDSISSKIGPFVGDEDSDENRDDSISVRLQDKALWXXXXXX 540
           QLCKLRCILHW+HIGIWAVDDSISSKIGP V DEDSD+N++D+ISVRLQDK LW      
Sbjct: 481 QLCKLRCILHWTHIGIWAVDDSISSKIGPLVDDEDSDDNQNDAISVRLQDKTLWKKNKGA 540

Query: 541 XXXXXXXXXXXXXDTFDFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 600
                        DTFDF                                          
Sbjct: 541 PSSSSSADESQKSDTFDFESEDTENEKTGESSS--------------------------- 573

Query: 601 XXXXXXXLDGSSTNGSLTXXXXXXXXXXXXXITIHGDSTPPENLHEDEGXXXXXXXXXXX 660
                   DG ST+GS T              T HG+S   E+L  +EG           
Sbjct: 574 --------DGLSTDGSSTDESSTEESSSTVSTTSHGNS---EDLDRNEGDDTVTNYDERS 622

Query: 661 XXXXXXXXXXXXXXXXXRKNIPKRKAARHRLQKEKLLQDLDHLEEQFMEESAINQKEPEA 720
                             +   KRKA++H +QK+KLLQDLD LEEQF EESA NQ EP++
Sbjct: 623 TNSTKKKKESVNKTDDGVRKKSKRKASQHEIQKKKLLQDLDELEEQFREESANNQDEPKS 682

Query: 721 FDDIVKQIESSEKASTADKNFAIDNLQSTKEQNLTISNKHKEQIRENSPSSGLHAXXXXX 780
            DD+ K  E  +K     ++   +   S +E NL IS+KH+EQIRENSPSS LHA     
Sbjct: 683 SDDVEKHTEFLKKPFATKEDVRKNEDLSIEESNLAISDKHQEQIRENSPSSALHASSSND 742

Query: 781 XXXXXAQEQQ 790
                AQEQQ
Sbjct: 743 DNFDDAQEQQ 752

>Suva_14.70 Chr14 complement(121375..123630) [2256 bp, 751 aa] {ON}
           YNL272C (REAL)
          Length = 751

 Score =  949 bits (2453), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 461/558 (82%), Positives = 503/558 (90%)

Query: 1   MDASEEAKRISLQVTSLSTQLIESVDKQSHLEEQLNKSLKTISSQKEAIVNYNRLKTDYE 60
           M+ASEEAKRIS+QVTSLSTQLIESVDKQSHLEEQLNKSLKTI+ QK AI NYN+LKTDY+
Sbjct: 1   MEASEEAKRISIQVTSLSTQLIESVDKQSHLEEQLNKSLKTIAGQKAAIDNYNKLKTDYD 60

Query: 61  ALKRTVLEKDDEVNKLREDVVKENELRTKAEDENDKLNKEVEDLTASLFDEANNMVSDAR 120
            LK+T+LE+D+EV KL  ++ KE +LRTKAEDE+DKLN+EVEDLTASLFDEAN+MV+DAR
Sbjct: 61  TLKKTLLERDNEVMKLNGNIAKETQLRTKAEDESDKLNREVEDLTASLFDEANHMVADAR 120

Query: 121 KEKYAIEILNKRLTEQLREKDTLLDTLSLQLKNLKKVMHSLDNESVVTNSSNRYSTILND 180
           KEKYAIEILNKRLTEQLREKD LL+TL+LQLKNLKKVMHSLDNES VTN+S RYSTIL+D
Sbjct: 121 KEKYAIEILNKRLTEQLREKDALLETLTLQLKNLKKVMHSLDNESTVTNNSGRYSTILSD 180

Query: 181 SATSSSTSLNKVPTLNSSASQDMYSGIVYSPSISSIRYDVSLYNEFLKFVAALPNCDNIK 240
           SATSSSTSLNKVPT NS  SQD+YSGIVYSP+ISSIRYD +LYNEFLKFVAALP+C+NIK
Sbjct: 181 SATSSSTSLNKVPTSNSFTSQDLYSGIVYSPTISSIRYDSNLYNEFLKFVAALPHCENIK 240

Query: 241 ATSSESKLIRRLVNDEIQPILKIDNASGIGWLVKKTLLSLIIDGLVVMEPLSGVNATYQI 300
           ATSSESKLIRRLVNDEIQPILKIDNASGIGWLVKKTLLSLIIDG+VV+EPLSGVNATYQI
Sbjct: 241 ATSSESKLIRRLVNDEIQPILKIDNASGIGWLVKKTLLSLIIDGMVVVEPLSGVNATYQI 300

Query: 301 GYNSSSPVKQATPNMPRMFKFPLDSPPVAVHAACSFCGESRDDIIEHARMYILKTLHKAD 360
           GYNSSSPVKQA PNMP+MFKFPLDSPPVAVHAACSFCGESRDDIIEHARMY+LKTLHKAD
Sbjct: 301 GYNSSSPVKQAAPNMPKMFKFPLDSPPVAVHAACSFCGESRDDIIEHARMYVLKTLHKAD 360

Query: 361 DGTEQVTNTYPLCHWCLLKLRQTCEIFAFLRSLKVGAWHLEKLEAQSITKGDLGKFSEVT 420
           DGTE VTNTYPLCHWCLLK+RQTCEIFAFLRSLKVGAWHLEK+  Q+I KGDL +FSEVT
Sbjct: 361 DGTEHVTNTYPLCHWCLLKVRQTCEIFAFLRSLKVGAWHLEKVTMQNIVKGDLERFSEVT 420

Query: 421 KRTKTDGRVSSQDKKAKRLSFMAGLGINSSSKSKQKMEVFSSEANAKPGQPTTNIQRAWL 480
           KRTK DGRVS  DK AKRLSFMAGLGINSS+KSK ++EV SSE   KPG PTTNIQRAW+
Sbjct: 421 KRTKADGRVSPHDKMAKRLSFMAGLGINSSTKSKPRVEVPSSEMTVKPGHPTTNIQRAWI 480

Query: 481 QLCKLRCILHWSHIGIWAVDDSISSKIGPFVGDEDSDENRDDSISVRLQDKALWXXXXXX 540
           QLCKLRCILHWSHIGIWAVDDSISSKIGPFV DE +DE ++D+I VRLQDK+LW      
Sbjct: 481 QLCKLRCILHWSHIGIWAVDDSISSKIGPFVDDEGTDEGQNDTIPVRLQDKSLWKKNADT 540

Query: 541 XXXXXXXXXXXXXDTFDF 558
                        DTFDF
Sbjct: 541 PLSSSSTDESQKSDTFDF 558

 Score = 82.0 bits (201), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 75/109 (68%)

Query: 682 PKRKAARHRLQKEKLLQDLDHLEEQFMEESAINQKEPEAFDDIVKQIESSEKASTADKNF 741
           PKRKA++ +LQK+KLL+DLD LEEQF EESA  Q E ++ DD+  Q+ S +   +A+K+ 
Sbjct: 643 PKRKASQRKLQKKKLLKDLDDLEEQFREESADVQDELKSSDDVKTQVVSPDNTISAEKDA 702

Query: 742 AIDNLQSTKEQNLTISNKHKEQIRENSPSSGLHAXXXXXXXXXXAQEQQ 790
            ID   S KE  L+++NKHKEQI ENSP+SGLHA          AQEQQ
Sbjct: 703 GIDEHLSNKESKLSVNNKHKEQINENSPASGLHASSSNDDNFDDAQEQQ 751

>YNL272C Chr14 complement(126805..129084) [2280 bp, 759 aa] {ON}
           SEC2Guanyl-nucleotide exchange factor for the small
           G-protein Sec4p; essential for post-Golgi vesicle
           transport and for autophagy; associates with the
           exocyst, via exocyst subunit Sec15p, on secretory
           vesicles
          Length = 759

 Score =  947 bits (2448), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 478/558 (85%), Positives = 507/558 (90%), Gaps = 1/558 (0%)

Query: 1   MDASEEAKRISLQVTSLSTQLIESVDKQSHLEEQLNKSLKTISSQKEAIVNYNRLKTDYE 60
           MDASEEAKR+S+QVTSLSTQLIESVDKQSHLEEQLNKSLKTI+SQK AI NYN+LK DY 
Sbjct: 1   MDASEEAKRVSIQVTSLSTQLIESVDKQSHLEEQLNKSLKTIASQKAAIENYNQLKEDYN 60

Query: 61  ALKRTVLEKDDEVNKLREDVVKENELRTKAEDENDKLNKEVEDLTASLFDEANNMVSDAR 120
            LKR + ++DDEV +LRED+ KENELRTKAE+E DKLNKEVEDLTASLFDEANNMV+DAR
Sbjct: 61  TLKRELSDRDDEVKRLREDIAKENELRTKAEEEADKLNKEVEDLTASLFDEANNMVADAR 120

Query: 121 KEKYAIEILNKRLTEQLREKDTLLDTLSLQLKNLKKVMHSLDNESVVTNSSNRYSTILND 180
           KEKYAIEILNKRLTEQLREKDTLLDTL+LQLKNLKKVMHSLDNES VTN+SNRYSTIL+D
Sbjct: 121 KEKYAIEILNKRLTEQLREKDTLLDTLTLQLKNLKKVMHSLDNESTVTNNSNRYSTILSD 180

Query: 181 SATSSSTSLNKVPTLNSSASQDMYSGIVYSPSISSIRYDVSLYNEFLKFVAALPNCDNIK 240
           SATSSSTSLNKVPT  S ASQD+YSGIVYSPSISSIRYD+SLYNEFLKFVAALP C+NIK
Sbjct: 181 SATSSSTSLNKVPTSYSLASQDIYSGIVYSPSISSIRYDISLYNEFLKFVAALPRCENIK 240

Query: 241 ATSSESKLIRRLVNDEIQPILKIDNASGIGWLVKKTLLSLIIDGLVVMEPLSGVNATYQI 300
           ATS+ESKLIRRLVNDEIQPILKIDNASGIGWLVKKTLLSLIIDGLVV+EPLSGVNATYQI
Sbjct: 241 ATSTESKLIRRLVNDEIQPILKIDNASGIGWLVKKTLLSLIIDGLVVVEPLSGVNATYQI 300

Query: 301 GYNSSSPVKQATPNMPRMFKFPLDSPPVAVHAACSFCGESRDDIIEHARMYILKTLHKAD 360
           GYNSSSP KQAT NMP+MFKFPLDSPPVAVHAACSFCGESRDDIIEHARMYILKTLHK D
Sbjct: 301 GYNSSSPAKQATSNMPKMFKFPLDSPPVAVHAACSFCGESRDDIIEHARMYILKTLHKTD 360

Query: 361 DGTEQVTNTYPLCHWCLLKLRQTCEIFAFLRSLKVGAWHLEKLEAQSITKGDLGKFSEVT 420
           DG EQVTNTYPLCHWCLLKLRQTCEIFAFLRSLKVGAWHLEKL  Q+ITK DL KFSEVT
Sbjct: 361 DGKEQVTNTYPLCHWCLLKLRQTCEIFAFLRSLKVGAWHLEKLTTQNITKEDLEKFSEVT 420

Query: 421 KRTKTDGRVSSQDKKAKRLSFMAGLGINSSSKSKQKMEVFSSEANAKPGQPTTNIQRAWL 480
           K TK DGRVSSQDKK KRLSFMAGLGINSS+K+K KME+FSSE NAKPGQPTTNIQRAWL
Sbjct: 421 KHTKRDGRVSSQDKKTKRLSFMAGLGINSSTKNKPKMEIFSSETNAKPGQPTTNIQRAWL 480

Query: 481 QLCKLRCILHWSHIGIWAVDDSISSKIGPFVGDEDSDENRDDSISVRLQDKALWXXXXXX 540
           QLCKLRCILHW+HIGIWAVDDSISSKIGP V D DSDE+++D+ISVRLQDKALW      
Sbjct: 481 QLCKLRCILHWTHIGIWAVDDSISSKIGPLVED-DSDEDQNDAISVRLQDKALWKQDAKR 539

Query: 541 XXXXXXXXXXXXXDTFDF 558
                        D FDF
Sbjct: 540 PFSSSSAEESQKSDAFDF 557

 Score =  104 bits (260), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 78/112 (69%)

Query: 679 KNIPKRKAARHRLQKEKLLQDLDHLEEQFMEESAINQKEPEAFDDIVKQIESSEKASTAD 738
           ++I K+KA + ++QK+KLLQDLD LEEQF EESAI+Q E E  +  VKQ  SS++AS+ D
Sbjct: 648 RSIIKKKAPQRKIQKKKLLQDLDDLEEQFREESAIDQTEFENAESNVKQNISSKRASSGD 707

Query: 739 KNFAIDNLQSTKEQNLTISNKHKEQIRENSPSSGLHAXXXXXXXXXXAQEQQ 790
           +N   DN + T + NLTI +K +EQI ENSPSSGLHA          AQEQQ
Sbjct: 708 ENSKKDNNEKTLKTNLTIGDKTQEQIGENSPSSGLHASSSNDDNFDDAQEQQ 759

>NDAI0F04230 Chr6 (1031871..1033976) [2106 bp, 701 aa] {ON} Anc_1.81
           YNL272C
          Length = 701

 Score =  610 bits (1573), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/540 (58%), Positives = 404/540 (74%), Gaps = 32/540 (5%)

Query: 2   DASEEAKRISLQVTSLSTQLIESVDKQSHLEEQLNKSLKTISSQKEAIVNYNRLKTDYEA 61
           + SEE+KRIS+QV+SLSTQLIES+ KQS LEE+LN++ +TI+SQK+++   + L+     
Sbjct: 3   ETSEESKRISIQVSSLSTQLIESIGKQSDLEEKLNQANRTITSQKKSLEQSHMLEKKSIE 62

Query: 62  LKRTVLEKDDEVNKLREDVVKENELRTKAEDENDKLNKEVEDLTASLFDEANNMVSDARK 121
           L++++  + +EVNKLRE + +E +LR  AE E +KL+KEVEDLTA+LFDEANNMV+DARK
Sbjct: 63  LEQSLTARTEEVNKLRERLTREIKLRESAEIEVEKLSKEVEDLTATLFDEANNMVADARK 122

Query: 122 EKYAIEILNKRLTEQLREKDTLLDTLSLQLKNLKKVMHSLDNESVVTNSSNRYSTILNDS 181
           E +A EILN RL  QLREKD LL+TL+LQLK+LKKV+ +++ E      +NRYS IL DS
Sbjct: 123 EAHAKEILNSRLMGQLREKDNLLETLTLQLKSLKKVLQNVETE------NNRYSMILPDS 176

Query: 182 ATSSSTSLNKVPTLNSS--ASQDMYSGIVYSPSISSIRYDVSLYNEFLKFVAALPNCDNI 239
           AT S  SL+KV T  SS  + Q M +GI+YSP+ISSIRYD+SLY EFLKF+A +P+C +I
Sbjct: 177 ATISGASLDKVTTRTSSSFSQQPMNNGIIYSPNISSIRYDLSLYEEFLKFIAVIPHCKSI 236

Query: 240 KATSSESKLIRRLVNDEIQPILKIDNASGIGWLVKKTLLSLIIDGLVVMEPLSGVNATYQ 299
           K TSS+SKLIRRL+ DEI P+LKIDNA+G+GWLVKKTLLS +++GLV++EPLSG+N  YQ
Sbjct: 237 KDTSSDSKLIRRLITDEISPVLKIDNANGLGWLVKKTLLSTMMEGLVIVEPLSGINEMYQ 296

Query: 300 IGYNSSSPVKQATP-------NMPRMFKFPLDSPPVAVHAACSFCGESRDDIIEHARMYI 352
           +G+ ++ P+   T         +P+MFKFP  SPPVAV   C+FCGE R+DIIEHARMY+
Sbjct: 297 MGH-TTPPLGMNTQEEADAQRKVPKMFKFPSSSPPVAVRDPCAFCGEERNDIIEHARMYL 355

Query: 353 LKTLHKADDGTEQVTNTYPLCHWCLLKLRQTCEIFAFLRSLKVGAWHLEKLEAQSITKGD 412
           LKT    DDGT  + NTYPLCHWCL K+RQTCEIFAFLRSLK   W+LEK+   +I+K  
Sbjct: 356 LKTQTTQDDGTLIIANTYPLCHWCLFKIRQTCEIFAFLRSLKTDIWNLEKVPLSAISKYG 415

Query: 413 LGKFSEVTKRTKTDGR-------VSSQDKKAKRLSFMAGLGINSSSK-SKQKMEVFSSEA 464
             KFSEVT  T T+G          S++KK+KR+SFMAGLG   SSK +  ++E   +  
Sbjct: 416 SSKFSEVTT-TNTNGSKKNIAATPKSENKKSKRMSFMAGLGRTHSSKITAARVEPHGNHN 474

Query: 465 NAKP-------GQPTTNIQRAWLQLCKLRCILHWSHIGIWAVDDSISSKIGPFVGDEDSD 517
           N          GQPTTNIQRAWLQLCKLR ILHW+HIGIW+VDDS+S+K+GP V  +D +
Sbjct: 475 NNNTNSPIENIGQPTTNIQRAWLQLCKLRSILHWAHIGIWSVDDSVSTKVGPEVFTQDEE 534

>NCAS0A00580 Chr1 complement(99945..102014) [2070 bp, 689 aa] {ON}
           Anc_1.81 YNL272C
          Length = 689

 Score =  602 bits (1552), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/528 (58%), Positives = 410/528 (77%), Gaps = 22/528 (4%)

Query: 2   DASEEAKRISLQVTSLSTQLIESVDKQSHLEEQLNKSLKTISSQKEAIVNYNRLKTDYEA 61
           + SEE+KRIS QVT+LSTQLIES+DKQS LEE+LN + K I+SQ+ ++  Y+ LK ++E 
Sbjct: 3   EQSEESKRISQQVTALSTQLIESIDKQSKLEEKLNHANKIIASQQPSLDKYSNLKVEFEK 62

Query: 62  LKRTVLEKDDEVNKLREDVVKENELRTKAEDENDKLNKEVEDLTASLFDEANNMVSDARK 121
           LK +  ++  E++  +  + +E ELR  AE E +KL+KEVEDLTA+LFDEANNMV+DARK
Sbjct: 63  LKISSEDQQKELDNFKVKIRRERELRENAEQEVEKLSKEVEDLTATLFDEANNMVADARK 122

Query: 122 EKYAIEILNKRLTEQLREKDTLLDTLSLQLKNLKKVMHSLDNESVVTNSSNRYSTILNDS 181
           +KY +E+LN +L EQL EKD LL+TL+LQLKNLKKV+ ++++E+     +NRYS I  DS
Sbjct: 123 DKYTVEVLNTKLVEQLHEKDNLLETLNLQLKNLKKVLQTVEDENNSLIGNNRYSIIQPDS 182

Query: 182 A--TSSSTSLNKVPTLNSSASQ---DMYSGIVYSPSISSIRYDVSLYNEFLKFVAALPNC 236
           A  +SS+TSL K+ T  SS SQ   +M +GI+YSP ISSIRYD+ LY EFLKF+A +P+C
Sbjct: 183 ATTSSSTTSLEKITTTVSSYSQNISNMANGIIYSPIISSIRYDLPLYEEFLKFIAVIPHC 242

Query: 237 DNIKATSSESKLIRRLVNDEIQPILKIDNASGIGWLVKKTLLSLIIDGLVVMEPLSGVNA 296
             IK TSS+SKLIRRLVNDEI P+LK+DNASG+GW+V+KT+LS +++GLVV+EPLSGVN 
Sbjct: 243 RTIKDTSSDSKLIRRLVNDEINPVLKLDNASGLGWIVRKTILSTMMEGLVVVEPLSGVNE 302

Query: 297 TYQIGYNSSSPVKQAT------PNMPRMFKFPLDSPPVAVHAACSFCGESRDDIIEHARM 350
           T+Q+G ++  P  +A+       +MP++FKFPL SPP+A+H  CSFCGESRDDIIEHARM
Sbjct: 303 TFQMGNSTQPPNAEASNKNESQSSMPKLFKFPLTSPPIALHEPCSFCGESRDDIIEHARM 362

Query: 351 YILKTLHKADDGTEQVTNTYPLCHWCLLKLRQTCEIFAFLRSLKVGAWHLEKLEAQSITK 410
           Y+LKT +K +DGT  VTNT+PLCHWCL K+RQTCEIFAFLRSLK G W+LEK+  +SI+ 
Sbjct: 363 YVLKTQNKQEDGTIMVTNTFPLCHWCLFKVRQTCEIFAFLRSLKTGVWNLEKVTMKSISS 422

Query: 411 GDLGKFSEVT---KRTKTDGRVSSQDKKAKRLSFMAGLGINSSSKSKQKMEVFSSEANAK 467
            D  +FS VT   ++TKT      +D+++KR+SF+ GL  NSS+ +  ++E  S+ +   
Sbjct: 423 KDSSRFSVVTSAIRQTKT------EDRRSKRMSFIGGLTKNSSAINTAQVE--STTSMEI 474

Query: 468 PGQPTTNIQRAWLQLCKLRCILHWSHIGIWAVDDSISSKIGPFVGDED 515
            G PTTNIQRAW+QLCKLR ILHW+H+GIW++DDSI+SKIGP + D D
Sbjct: 475 TGLPTTNIQRAWIQLCKLRSILHWAHVGIWSIDDSITSKIGPEIKDPD 522

>SAKL0C02596g Chr3 complement(238404..240608) [2205 bp, 734 aa] {ON}
           similar to uniprot|P17065 Saccharomyces cerevisiae
           YNL272C SEC2 Guanyl-nucleotide exchange factor for the
           small G-protein Sec4p located on cytoplasmic vesicles
           essential for post-Golgi vesicle transport
          Length = 734

 Score =  593 bits (1528), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/534 (54%), Positives = 389/534 (72%), Gaps = 14/534 (2%)

Query: 1   MDASEEAKRISLQVTSLSTQLIESVDKQSHLEEQLNKSLKTISSQKEAIVNYNRLKTDYE 60
           M   EE+KR+S+Q++SLSTQLIESVDKQS LEEQL K+ KTI+SQ E+  +Y  L+   E
Sbjct: 1   MSDQEESKRVSMQLSSLSTQLIESVDKQSRLEEQLRKAKKTIASQSESAASYESLREQLE 60

Query: 61  ALKRTVLEKDDEVNKLREDVVKENELRTKAEDENDKLNKEVEDLTASLFDEANNMVSDAR 120
             ++ +  +  E  +L   +  E   R  A+D+ D+LNKEVEDLTASLFDEANNMV+DAR
Sbjct: 61  KAQQELASRSRESAELERKLAAETTARKMAQDKIDQLNKEVEDLTASLFDEANNMVADAR 120

Query: 121 KEKYAIEILNKRLTEQLREKDTLLDTLSLQLKNLKKVMHSLDNESVVTNSSNRYSTIL-N 179
           +EK+ +E+ N +L EQL EKD LL+TL +QLKNLKKV++SL++E+     + R S  L +
Sbjct: 121 REKHDVEVRNSKLHEQLHEKDALLETLEMQLKNLKKVLYSLEDENSSLAKTKRNSAFLSS 180

Query: 180 DSATSSSTSLNKVPTLNSSASQ-DMYSGIVYSPSISSIRYDVSLYNEFLKFVAALPNCDN 238
           D+ATSS+ SL K  T  +S  +     G+++SP + S+RYD+ LYNEFLKFVA LP C +
Sbjct: 181 DTATSSNVSLEKTATGGTSLGELSGAGGVLFSPVLQSLRYDLGLYNEFLKFVAMLPICRS 240

Query: 239 IKATSSESKLIRRLVNDEIQPILKIDNASGIGWLVKKTLLSLIIDGLVVMEPLSGVNATY 298
           IK T++ESKL+RRL++DEIQP+L++DNASG+GWLV+++L+SL+IDGLVV+EPLSGVN TY
Sbjct: 241 IKGTTTESKLLRRLMHDEIQPVLRLDNASGLGWLVRRSLMSLMIDGLVVVEPLSGVNETY 300

Query: 299 QIGYNSSSPVKQATPN-------MPRMFKFPLDSPPVAVHAACSFCGESRDDIIEHARMY 351
           ++GY  SSP   A  N          ++ +P DSPPVA+H AC+FC ESR+DI+EH R+Y
Sbjct: 301 RMGY--SSPQLHAQQNAHFGQERAAHLYNYPTDSPPVAIHEACAFCSESRNDILEHGRLY 358

Query: 352 ILKTLHKADDGTEQVTNTYPLCHWCLLKLRQTCEIFAFLRSLKVGAWHLEKLEAQSITKG 411
           +LKTL + +DGT + TN YPLCH+CLLK+RQTCEIFAFLRSLK G WHLEK+   SI  G
Sbjct: 359 VLKTLQRNEDGTTETTNQYPLCHYCLLKVRQTCEIFAFLRSLKEGVWHLEKVTLTSIATG 418

Query: 412 DLGKFSEVTKRTKTDGRVSSQDKKAKRLSFMAGLGINSSSKSKQKMEVFSSEANAKPGQP 471
              KFSEVTK   T    + +D K+KR+SFMAGL   S++K    +E   + A  + GQP
Sbjct: 419 GSSKFSEVTKTPHTS--AAKEDAKSKRMSFMAGLSRPSTTKLMPTVEGAPNFA-GQSGQP 475

Query: 472 TTNIQRAWLQLCKLRCILHWSHIGIWAVDDSISSKIGPFVGDEDSDENRDDSIS 525
            TNIQRAW QLCKLR  LHW+HIG+W+++DS++ +IGP + +E +++    S S
Sbjct: 476 VTNIQRAWAQLCKLRASLHWAHIGVWSIEDSVALRIGPLMPEEKTEQVEGSSAS 529

>KAFR0D03960 Chr4 (776847..778841) [1995 bp, 664 aa] {ON} Anc_1.81
           YNL272C
          Length = 664

 Score =  575 bits (1483), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/521 (57%), Positives = 390/521 (74%), Gaps = 14/521 (2%)

Query: 2   DASEEAKRISLQVTSLSTQLIESVDKQSHLEEQLNKSLKTISSQKEAIVNYNRLKTDYEA 61
           D +EE  RIS QVTSLSTQL+ES+ ++S LEE+L    K   SQ+ +I  Y+ LK DY+ 
Sbjct: 3   DLAEENNRISAQVTSLSTQLMESIQRESELEEKLKHLKKVALSQEGSIAKYDILKADYDK 62

Query: 62  LKRTVLEKDDEVNKLREDVVKENELRTKAEDENDKLNKEVEDLTASLFDEANNMVSDARK 121
           LK TV E++ E+  L+ ++ +E++LR+ AE E   L++EVEDLTASLF EAN+MV+DAR+
Sbjct: 63  LKTTVSERNREIQNLQVNLKEESKLRSSAEAEVATLSQEVEDLTASLFAEANDMVADARR 122

Query: 122 EKYAIEILNKRLTEQLREKDTLLDTLSLQLKNLKKVMHSLDNESVVTNSSNRYSTILNDS 181
           EK+  EILN +L EQLREKDTLL TL LQLKNLKKV+ + ++E+V   +S+     L   
Sbjct: 123 EKHITEILNTKLVEQLREKDTLLQTLDLQLKNLKKVLQNFEDENVTNKASSIAPDFLGSE 182

Query: 182 ATSSSTSLNKVPTLNSSASQDMYSGIVYSPSISSIRYDVSLYNEFLKFVAALPNCDNIKA 241
             S+S SL       S+   D  +  VYSP IS+IRYD++LYNEFLKF+A LP C N+K 
Sbjct: 183 QKSASASL-------SNEVGDPSNKGVYSPYISTIRYDLALYNEFLKFIAVLPYCKNLKD 235

Query: 242 TSSESKLIRRLVNDEIQPILKIDNASGIGWLVKKTLLSLIIDGLVVMEPLSGVNATYQIG 301
           TSSESKL+RRL+NDEIQPIL+ID+A+GIGWL KK++L+L+IDGLVV+EPLSGVN  YQ+G
Sbjct: 236 TSSESKLMRRLINDEIQPILRIDSANGIGWLAKKSMLTLMIDGLVVIEPLSGVNENYQLG 295

Query: 302 YNSSSPVKQATPNM-----PRMFKFPLDSPPVAVHAACSFCGESRDDIIEHARMYILKTL 356
           + SSS  +   P+M       +F +P DSPPVAVH  CSFCGE+RDDI+EHARM++LKT 
Sbjct: 296 HVSSSD-QSNRPSMESKRESHLFNYPTDSPPVAVHEPCSFCGENRDDILEHARMHVLKTQ 354

Query: 357 HKADDGTEQVTNTYPLCHWCLLKLRQTCEIFAFLRSLKVGAWHLEKLEAQSITKGDLGKF 416
            K++DG+  VTN+YPLC WCL K+RQTCEIFAFLRSLK+G W+LEK+   SI KG+  KF
Sbjct: 355 SKSEDGSITVTNSYPLCSWCLTKVRQTCEIFAFLRSLKIGTWNLEKVTLNSIAKGESNKF 414

Query: 417 SEVTKRTKTDGRVSSQDKKAKRLSFMAGLGINSSSKSKQKMEVFSSEANAKPGQPTTNIQ 476
           +EVT+  K++    S +KK KR SFM GLGIN+SS    ++EV +S      GQPTTNIQ
Sbjct: 415 TEVTRAIKSNKHGKSDEKKLKRKSFMVGLGINASSNLTPQVEVGASTI-GNAGQPTTNIQ 473

Query: 477 RAWLQLCKLRCILHWSHIGIWAVDDSISSKIGPFVGDEDSD 517
           RAW+QLCKLR +LHW+++GIW+VD+SIS KIGP V D++++
Sbjct: 474 RAWVQLCKLRSMLHWTYMGIWSVDESISLKIGPQVKDDNNE 514

>TDEL0C06200 Chr3 (1128241..1130343) [2103 bp, 700 aa] {ON} Anc_1.81
           YNL272C
          Length = 700

 Score =  566 bits (1459), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/529 (55%), Positives = 398/529 (75%), Gaps = 26/529 (4%)

Query: 5   EEAKRISLQVTSLSTQLIESVDKQSHLEEQLNKSLKTISSQKEAIVNYNRLKTDYEALKR 64
           EE++R+S+Q++SLSTQLIES+DKQ  LEEQLN++ +TI SQ+ ++ +YN LK+ ++ ++ 
Sbjct: 6   EESRRVSVQISSLSTQLIESIDKQFQLEEQLNQAKRTIQSQRNSLDSYNDLKSKFDGVES 65

Query: 65  TVLEKDDEVNKLREDVVKENELRTKAEDENDKLNKEVEDLTASLFDEANNMVSDARKEKY 124
           ++  K+  + +L+E++VKE  LRT AE   D LNKE+EDLTASLFDEAN MV+ ARKE Y
Sbjct: 66  SLQTKNQIIEELKEELVKEKTLRTTAERNVDDLNKEIEDLTASLFDEANKMVATARKESY 125

Query: 125 AIEILNKRLTEQLREKDTLLDTLSLQLKNLKKVMHSLDNESVVTNSSNRYSTILNDSATS 184
            IEI N +L EQL EKD +L+TL+LQLKNLKKV+ +L+ ES  T+S +R S + ND++T 
Sbjct: 126 TIEIKNNKLKEQLDEKDMILETLNLQLKNLKKVIQNLEKES-TTHSGSRSSFVGNDNST- 183

Query: 185 SSTSLNKVPTLNSSASQDMYSGIVYSPSISSIRYDVSLYNEFLKFVAALPNCDNIKATSS 244
           SS SLNK  T N   S ++  G +YSP+I+S+RYD++LY EFLKF+A LP C+ +K TSS
Sbjct: 184 SSISLNKTSTSN---SDELSLGPIYSPNITSVRYDLNLYTEFLKFIAVLPYCETLKDTSS 240

Query: 245 ESKLIRRLVNDEIQPILKIDNASGIGWLVKKTLLSLIIDGLVVMEPLSGVNATYQIGYNS 304
           +SKL+RRLVNDEIQP L++DNASG+GW+V++TL+SL+++GLVV+EPLSG+N  +Q GY  
Sbjct: 241 DSKLLRRLVNDEIQPALRLDNASGLGWIVRRTLMSLMMEGLVVVEPLSGLNENFQYGY-- 298

Query: 305 SSPVKQATPNMPRM-------FKFPLDSPPVAVHAACSFCGESRDDIIEHARMYILKTLH 357
           +SPV  ++   P M       F +P DSPP+AVH  CSFC E+RDD+IEHARMY+LKT  
Sbjct: 299 TSPVLPSSSFNPSMGGKDSHLFSYPSDSPPIAVHDKCSFCSEARDDVIEHARMYVLKTQT 358

Query: 358 KADDGTEQVTNTYPLCHWCLLKLRQTCEIFAFLRSLKVGAWHLEKLEAQSITKGDLGKFS 417
           + +DG+  VTN++PLC +CLLK+RQTCEIFAFLRSLK+GAW+LEK+    I KG+  +FS
Sbjct: 359 RIEDGSLVVTNSFPLCRYCLLKVRQTCEIFAFLRSLKLGAWNLEKVTLTKIAKGESSEFS 418

Query: 418 EVTKRTKTDGRVSSQDKKAKRLSFMAGL-GINSSSKSKQKMEVFSSEANAKPGQPTTNIQ 476
           +V     ++G      K+ KRL  M+ + G N SSK   ++++   +     G PTTNIQ
Sbjct: 419 QV-----SNGNHKGPQKEEKRLQRMSLITGKNQSSKLAPQVDIPVDQI----GAPTTNIQ 469

Query: 477 RAWLQLCKLRCILHWSHIGIWAVDDSISSKIGPFVGDEDSDENRDDSIS 525
           RAWLQLCKLR  LHW+HIGIW+V+D+++ KIGPFV +E  DEN D+ IS
Sbjct: 470 RAWLQLCKLRITLHWAHIGIWSVEDAVTQKIGPFVKEE--DENDDEPIS 516

>CAGL0J08228g Chr10 (815653..817911) [2259 bp, 752 aa] {ON} similar
           to uniprot|P17065 Saccharomyces cerevisiae YNL272c SEC2
           protein transport protein
          Length = 752

 Score =  561 bits (1445), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/512 (54%), Positives = 374/512 (73%), Gaps = 8/512 (1%)

Query: 2   DASEEAKRISLQVTSLSTQLIESVDKQSHLEEQLNKSLKTISSQKEAIVNYNRLKTDYEA 61
           D  EE+ RIS+QV++LSTQLIES+D+QS LE++L  +   I+ QK  +  +  LK   + 
Sbjct: 3   DPIEESNRISVQVSTLSTQLIESIDRQSELEKRLRDAQIIINKQKHVMHEFETLKQKNKE 62

Query: 62  LKRTVLEKDDEVNKLREDVVKENELRTKAEDENDKLNKEVEDLTASLFDEANNMVSDARK 121
           L       ++++  L   + +E   R  AE E DKL +EVEDLTASLFDEANNMVSDAR+
Sbjct: 63  LSDGQQSFEEKIRALSAQLEEEKSKRLAAEKEVDKLGQEVEDLTASLFDEANNMVSDARR 122

Query: 122 EKYAIEILNKRLTEQLREKDTLLDTLSLQLKNLKKVMHSLDNESVVTNSSNRYSTILNDS 181
           EK+ IEI N RL E L+EKDT+L+TL+LQLKNLKKV+ ++D+ES +  ++N  S I  ++
Sbjct: 123 EKHDIEIQNSRLQETLKEKDTVLETLNLQLKNLKKVLQTVDSESSI--NANIRSPISTEN 180

Query: 182 ATSSSTSLNKVPTLNSSASQDMYSGIVYSPSISSIRYDVSLYNEFLKFVAALPNCDNIKA 241
           +T++S S NK+    S  S       ++SP ++++RYD SLYNEFLKF+A LP+  ++KA
Sbjct: 181 STTTSASGNKLTRRQSQLSISHNESPLFSPYVTTLRYDQSLYNEFLKFLAVLPSSSSLKA 240

Query: 242 TSSESKLIRRLVNDEIQPILKIDNASGIGWLVKKTLLSLIIDGLVVMEPLSGVNATYQIG 301
           TS+ESKL++RLV+DEIQP+LKIDNASGIGWLV+K+LL+ +++G VV+EPLSG+N  YQ+G
Sbjct: 241 TSTESKLLKRLVSDEIQPVLKIDNASGIGWLVRKSLLTSMMEGQVVVEPLSGINEAYQLG 300

Query: 302 YNSSSPVKQ-ATPNMPRMFKFPLDSPPVAVHAACSFCGESRDDIIEHARMYILKTLHKAD 360
           Y +   V Q     MP MF FPL+SPP+AV   C+FC E RDDIIEHARMY++KT +K +
Sbjct: 301 YETKEHVSQNEGEEMPHMFNFPLNSPPIAVRDPCAFCAEQRDDIIEHARMYVMKTFNKEN 360

Query: 361 DGTEQVTNTYPLCHWCLLKLRQTCEIFAFLRSLKVGAWHLEKLEAQSITKGD-LGKFSEV 419
           DG+  +TN++PLCHWCL+K+RQTCEIFAFLRSLK+G WHLEK+   +I+KG+ L KFSEV
Sbjct: 361 DGSTTITNSFPLCHWCLMKVRQTCEIFAFLRSLKLGTWHLEKVTLNTISKGESLSKFSEV 420

Query: 420 TKRTKTDGRVSSQDKKAKRLSFMAGLGINSSSKSKQKMEVFSSEANAKPGQPTTNIQRAW 479
           TK   T+G  S+++KK+ R SF+  L   S  KS   +E        K GQPT+NIQRAW
Sbjct: 421 TK--STNGSTSNEEKKSNRKSFIPSLPKGSPKKSSPVVETHID--TTKAGQPTSNIQRAW 476

Query: 480 LQLCKLRCILHWSHIGIWAVDDSISSKIGPFV 511
           + LCKLR +LHW+H+GIW ++DSIS K+GP  
Sbjct: 477 VHLCKLRSMLHWAHVGIWNMEDSISLKMGPIT 508

>Kpol_2000.67 s2000 (144161..146635) [2475 bp, 824 aa] {ON}
           (144161..146635) [2475 nt, 825 aa]
          Length = 824

 Score =  538 bits (1387), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 272/520 (52%), Positives = 376/520 (72%), Gaps = 14/520 (2%)

Query: 2   DASEEAKRISLQVTSLSTQLIESVDKQSHLEEQLNKSLKTISSQKEAIVNYNRLKTDYEA 61
           D+S+E+KR S+Q+T+LSTQL+ES++KQ+ LE++L +S +TI  Q+ AI  YN LK  Y+ 
Sbjct: 3   DSSDESKRFSIQLTTLSTQLMESINKQTQLEDKLQRSRRTIMEQQTAIEQYNDLKVKYDQ 62

Query: 62  LKRTVLEKDDEVNKLREDVVKENELRTKAEDENDKLNKEVEDLTASLFDEANNMVSDARK 121
           L +       ++ KL  +  +E++LR  AE + D+LNKEVE+LTASLFDEANNMV+DAR+
Sbjct: 63  LDKNFNVTKVKIAKLENESKEEHKLRLSAEQKVDELNKEVEELTASLFDEANNMVADARR 122

Query: 122 EKYAIEILNKRLTEQLREKDTLLDTLSLQLKNLKKVMHSLDNESVVTNSSNRYSTILNDS 181
               I+I N++L E L EKDT+L+T++LQLKNLK V+H L N+      SNR S I   S
Sbjct: 123 GAQEIDIKNRKLVEMLHEKDTILETMNLQLKNLKNVLHDLQNDPANIAVSNRNSLISTTS 182

Query: 182 ATSSSTSLNKVPTLNSSASQDMYSGIVYSPSISSIRYDVSLYNEFLKFVAALPNCDNIKA 241
           A+SSS SL K  T NS+ + D+ S  +Y+P + ++RYD+ LYNEFLKF+A LP C++IK 
Sbjct: 183 ASSSSVSLKKTITSNSTTNIDLLSNAIYTPKVPAVRYDLYLYNEFLKFIAVLPFCESIKH 242

Query: 242 TSSESKLIRRLVNDEIQPILKIDNASGIGWLVKKTLLSLIIDGLVVMEPLSGVNATYQIG 301
           T+SESKL+RRL+NDEIQP+L++DNASG+GW+VK+TL++L+I+GLVV+EPLSGVN  Y+  
Sbjct: 243 TTSESKLLRRLINDEIQPVLRLDNASGLGWIVKRTLMNLMIEGLVVIEPLSGVNENYR-- 300

Query: 302 YNSSSPVKQATPNM-PR-------MFKFPLDSPPVAVHAACSFCGESRDDIIEHARMYIL 353
           ++SS+PV     N  P+       +FK+P +SPP+AVH  C+FCGE+R+D++EHARMY+L
Sbjct: 301 FSSSAPVSNVNSNNDPKLTSKNDHLFKYPSNSPPIAVHEPCAFCGENRNDVLEHARMYML 360

Query: 354 KTLHKADDGTEQVTNTYPLCHWCLLKLRQTCEIFAFLRSLKVGAWHLEKLEAQSITKGDL 413
           KT  K +D T  +TN +PLC  CL+K+RQTCEIFAFLRSLK+GAW+LEK+   +I KGD 
Sbjct: 361 KTQTKNEDNTLSITNQFPLCQMCLIKVRQTCEIFAFLRSLKLGAWNLEKVTLSTIAKGDS 420

Query: 414 GKFSEVTKRTKTDGRVSSQD----KKAKRLSFMAGLGINSSSKSKQKMEVFSSEANAKPG 469
            KFS VT  T +  +   ++    K  KR S MAG GI+S S +       S     + G
Sbjct: 421 KKFSSVTAATSSISKSKIEEKFDSKLMKRRSIMAGFGISSISNTTTTKSETSVGVVDQSG 480

Query: 470 QPTTNIQRAWLQLCKLRCILHWSHIGIWAVDDSISSKIGP 509
            PTTNIQRAW+ L KLR +LHW+HIGIW  D+++++K+ P
Sbjct: 481 LPTTNIQRAWVHLSKLRSMLHWAHIGIWNTDNAVTTKLRP 520

>KLTH0F02354g Chr6 complement(193705..195906) [2202 bp, 733 aa] {ON}
           similar to uniprot|P17065 Saccharomyces cerevisiae
           YNL272C SEC2 Guanyl-nucleotide exchange factor for the
           small G-protein Sec4p located on cytoplasmic vesicles
           essential for post-Golgi vesicle transport
          Length = 733

 Score =  529 bits (1362), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 273/543 (50%), Positives = 380/543 (69%), Gaps = 34/543 (6%)

Query: 1   MDASEEAKRISLQVTSLSTQLIESVDKQSHLEEQLNKSLKTISSQKEAIVNYNRLKTDYE 60
           M   EE+KR+S+QV+SLSTQLIES+DKQSHLEEQL ++ K I+SQ+E++ NY  L+   E
Sbjct: 1   MTEEEESKRVSVQVSSLSTQLIESIDKQSHLEEQLLQARKVIASQRESLQNYEDLRQQLE 60

Query: 61  ALKRTVLEKDDEVNKLREDVVKENELRTKAEDENDKLNKEVEDLTASLFDEANNMVSDAR 120
             +  +  +  +  K++E++      +  AE E D+LNKEVEDLTASLFDEANNMV+DAR
Sbjct: 61  QAESNLKSERSQNIKIQEELQAARSGKLTAEGEIDRLNKEVEDLTASLFDEANNMVADAR 120

Query: 121 KEKYAIEILNKRLTEQLREKDTLLDTLSLQLKNLKKVMHSLDNESVVTNSSNRYSTILND 180
           +E +++++ N +L EQL+EK+TLL+TL +QLKNLKKV+++L+ ES     SN+ S    D
Sbjct: 121 RETHSVQVKNSKLAEQLQEKETLLETLEIQLKNLKKVLYNLEEESNDRLKSNQASVAAED 180

Query: 181 S-ATSSSTSLNK-VPTLNSSASQDMYSGIVYSPSISSIRYDVSLYNEFLKFVAALPNCDN 238
           S A+SS ++L K +  LN +AS    S  ++SP + S+RYD+ LYNEFLKF+AALP C +
Sbjct: 181 SVASSSESALEKTMNALNGTASPP--SPALFSPLLKSLRYDLVLYNEFLKFIAALPQCAS 238

Query: 239 IKATSSESKLIRRLVNDEIQPILKIDNASGIGWLVKKTLLSLIIDGLVVMEPLSGVNATY 298
           I+ ++S SKL+RRL++DEIQP+L++DNASGIGW +++ L+SL+IDG +V+EP+SG+N TY
Sbjct: 239 IRDSTSYSKLLRRLIHDEIQPVLRLDNASGIGWYLRRNLMSLMIDGSIVVEPVSGINETY 298

Query: 299 QIGYNSSSPVKQATPNM--------PRMFKFPLDSPPVAVHAACSFCGESRDDIIEHARM 350
           ++G+ SS    +A P          P ++ +P DSPPVA+ + CSFC ESR+DI+EH R+
Sbjct: 299 RVGHMSSQ--VEAVPQFQGPEQQSRPHLYNYPADSPPVAIESPCSFCSESRNDILEHGRL 356

Query: 351 YILKTLHKADDGTEQVTNTYPLCHWCLLKLRQTCEIFAFLRSLKVGAWHLEKLEAQSITK 410
           Y+LKTL K ++G  + ++ +PLCH+CLLK+RQTCEIFAFLRSLK GAWH   LEA +I+K
Sbjct: 357 YVLKTLQKMENGITETSSQFPLCHYCLLKVRQTCEIFAFLRSLKSGAWH---LEAVTISK 413

Query: 411 GDLGKFSEVTKRTKTDGRVSS------QDKKAKRLSFMAGLGINSSSKSKQKMEVFSSEA 464
            +   FS  T        + S       D+K+KR+SFMAGL      K+   +E     A
Sbjct: 414 TN-NAFSVQTNSVSNSPTLESPPDKMKPDRKSKRMSFMAGLSKTLPLKTSYTVE----SA 468

Query: 465 NAKPGQ---PTTNIQRAWLQLCKLRCILHWSHIGIWAVDDSISSKIGPFVGDEDSDENRD 521
           +  P Q   PTTNIQRAW QLCKLR  LHW+HIGIW ++D + +K+GP V     D   +
Sbjct: 469 SPCPEQITTPTTNIQRAWAQLCKLRSSLHWAHIGIWTLEDVVETKVGPVVA---VDRPGN 525

Query: 522 DSI 524
           DSI
Sbjct: 526 DSI 528

>ZYRO0F16698g Chr6 (1382642..1384981) [2340 bp, 779 aa] {ON} weakly
           similar to uniprot|P17065 Saccharomyces cerevisiae
           YNL272C SEC2 Guanyl-nucleotide exchange factor for the
           small G-protein Sec4p located on cytoplasmic vesicles
           essential for post-Golgi vesicle transport
          Length = 779

 Score =  523 bits (1346), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 269/553 (48%), Positives = 386/553 (69%), Gaps = 49/553 (8%)

Query: 5   EEAKRISLQVTSLSTQLIESVDKQSHLEEQLNKSLKTISSQKEAIVNYNRLKTDYEALKR 64
           EE++R+S Q+ SLSTQLIES+++QS LE++LN++ K I     A+  Y +LK ++  L++
Sbjct: 8   EESRRVSTQIMSLSTQLIESIERQSTLEKELNQANKIIEGHGGAMQEYEKLKKNFAELEK 67

Query: 65  TVLEKDDEVNKLREDVVKENELRTKAEDENDKLNKEVEDLTASLFDEANNMVSDARKEKY 124
               KD ++NKLRE++ K+ E RT+A+   DKLN EVE+LTASLFDEANNMV+DARK  +
Sbjct: 68  RESNKDAQLNKLREELRKQKEARTEADSNADKLNHEVEELTASLFDEANNMVADARKASH 127

Query: 125 AIEILNKRLTEQLREKDTLLDTLSLQLKNLKKVMHSLDNESVVTNSSNRYSTILNDSATS 184
           A E+ N +L EQL E+D LL+TL+LQL++LKKV+ +LD++S+   +S +  T+ N S  +
Sbjct: 128 ATELRNAKLVEQLHERDALLETLNLQLRHLKKVIQTLDDDSM---ASEQVKTLANASDNA 184

Query: 185 S-STSLNKVPTLNSSASQDMYS--GIVYSPSISSIRYDVSLYNEFLKFVAALPNCDNIKA 241
           + + SL+K   L+SS  + + +  G ++SP+I+++RYD+ LY+EFLKF+A LP+  +IK 
Sbjct: 185 NLAASLSK--NLSSSHGRQIEAPLGPIFSPNITAVRYDLGLYHEFLKFLAVLPDYQDIKD 242

Query: 242 TSSESKLIRRLVNDEIQPILKIDNASGIGWLVKKTLLSLIIDGLVVMEPLSGVNATYQIG 301
           T+S+SKL+RRLVNDEIQP+LK++NASG+GW++K+TL++L+I+GLV +EP+SG+N  +Q G
Sbjct: 243 TASDSKLLRRLVNDEIQPVLKLENASGLGWILKRTLVNLMIEGLVAVEPISGLNEMHQYG 302

Query: 302 YNS------------------SSPVKQATP------NMPR---------MFKFPLDSPPV 328
           Y S                  +SP   +        N  R         +F +P DSPPV
Sbjct: 303 YASPMLNQHSKMGGNNSNSLENSPATTSNTSTTTKRNHSRSSSMTKSLNLFNYPSDSPPV 362

Query: 329 AVHAACSFCGESRDDIIEHARMYILKTLHKADDGTEQVTNTYPLCHWCLLKLRQTCEIFA 388
           A+   C+ CGE RDD++EHAR++ILKT  +ADDGT  V NT+PLC +C+LK+RQTCEIFA
Sbjct: 363 ALREKCAICGECRDDLVEHARLHILKTQSRADDGTVTVNNTFPLCKYCVLKIRQTCEIFA 422

Query: 389 FLRSLKVGAWHLEKLEAQSITKGDLGKFSEVT----KRTKTDGRVSSQDKKAKRLSFMAG 444
           FLRSLK+GAW LEK+   S++KGD  +FS+V+       K +     +++K  R SFMAG
Sbjct: 423 FLRSLKLGAWKLEKVSLTSVSKGDSKEFSQVSMVNSNEDKPNRDSKKENRKTARKSFMAG 482

Query: 445 LGINSSSKSKQKMEVFSSEANAKPGQPTTNIQRAWLQLCKLRCILHWSHIGIWAVDDSIS 504
           +   +S  +    EV  S+A    G PTTNIQ AW+QLC+LR +LHW+HIGIW VDD I+
Sbjct: 483 MNALNSKNTTVTPEVPVSQA----GAPTTNIQWAWIQLCRLRSMLHWTHIGIWNVDDCIT 538

Query: 505 SKIGPFVGDEDSD 517
           SKIGP V ++ S+
Sbjct: 539 SKIGPLVINDGSN 551

>Kwal_33.13389 s33 complement(197441..199525) [2085 bp, 694 aa] {ON}
           YNL272C (SEC2) - GDP/GTP exchange factor for Sec4p
           [contig 118] FULL
          Length = 694

 Score =  518 bits (1333), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 263/532 (49%), Positives = 375/532 (70%), Gaps = 33/532 (6%)

Query: 1   MDASEEAKRISLQVTSLSTQLIESVDKQSHLEEQLNKSLKTISSQKEAIVNYNRLKTDYE 60
           M   EE+KR+S+QV+SLSTQLIES+DKQSHLEEQL ++ K ISSQ++A+         YE
Sbjct: 1   MTEEEESKRVSVQVSSLSTQLIESIDKQSHLEEQLLQARKVISSQRDAL-------KSYE 53

Query: 61  ALKRTVLEKDDEVNKLREDVVKENELRTKAE-------DENDKLNKEVEDLTASLFDEAN 113
           ++ + + E + E+  +R    K+ E    A+       DE  +LNKEVE+LTASLFDEAN
Sbjct: 54  SVGKRLEETEAELESVRAQNAKDKEALKAAQSETEAAKDEVSRLNKEVEELTASLFDEAN 113

Query: 114 NMVSDARKEKYAIEILNKRLTEQLREKDTLLDTLSLQLKNLKKVMHSLDNESVVTNSSNR 173
           NMV+DARKE ++I++ N +LTEQL+EK +LL+TL +QLKNLKKV++ L+ ES     SNR
Sbjct: 114 NMVADARKETHSIQVKNIKLTEQLQEKSSLLETLEIQLKNLKKVLYDLEEESNSRLQSNR 173

Query: 174 YSTI--LNDSATSSSTSL-NKVPTLNSSASQDMYSGIVYSPSISSIRYDVSLYNEFLKFV 230
              +   ++S  SS+ +L N +  LN +A     + +++SP + S+RYD++LYNEFLKF+
Sbjct: 174 SPVMDTSDNSTVSSAIALENTMHALNGTARSP--NNVLFSPVLKSLRYDLNLYNEFLKFI 231

Query: 231 AALPNCDNIKATSSESKLIRRLVNDEIQPILKIDNASGIGWLVKKTLLSLIIDGLVVMEP 290
           AALP   +IK T+SESKL+RRLV+DEIQP+L++DNASG+GW  K++L++L++DGLVV+EP
Sbjct: 232 AALPTSASIKDTASESKLLRRLVHDEIQPLLRLDNASGLGWYFKRSLMTLMMDGLVVVEP 291

Query: 291 LSGVNATYQIGYNSSSPVKQATPNMPR--------MFKFPLDSPPVAVHAACSFCGESRD 342
           +SG+N TY++ +  +S V+      PR        ++ +P DSPPVA+   CSFC ESR+
Sbjct: 292 VSGINETYRVSH--ASGVENTKLQRPRSEQRIEGHLYNYPADSPPVAIQDPCSFCSESRN 349

Query: 343 DIIEHARMYILKTLHKADDGTEQVTNTYPLCHWCLLKLRQTCEIFAFLRSLKVGAWHLEK 402
           DI+EH R+Y+L+TL K ++GT +V + +PLCH+CLLK+RQTCEIFAFLRSLK GAWHLE 
Sbjct: 350 DILEHGRLYVLRTLQKTEEGTTEVNSQFPLCHYCLLKVRQTCEIFAFLRSLKSGAWHLES 409

Query: 403 LEAQSITKGDLGKF---SEVTKRTKTDGRVSSQDKKAKRLSFMAGLGINSSSKSKQKMEV 459
           +   + ++    +F   S+++   +   R    D+K+KRLS MAGL  +  SK+   +E 
Sbjct: 410 VTVDANSQRSSTEFKSQSKLSTPERGSERKVKSDRKSKRLSIMAGLTKSFPSKTSYAIEE 469

Query: 460 FSSEANAKPGQPTTNIQRAWLQLCKLRCILHWSHIGIWAVDDSISSKIGPFV 511
            +  +N++   PTTNIQ AW QLCKLR  LHW+HIGIW++ DS+ +K+GP  
Sbjct: 470 -TPGSNSQVTTPTTNIQIAWAQLCKLRSTLHWTHIGIWSIGDSVETKLGPMT 520

>Ecym_1085 Chr1 complement(170657..172774) [2118 bp, 705 aa] {ON}
           similar to Ashbya gossypii AFR670W
          Length = 705

 Score =  508 bits (1309), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 255/516 (49%), Positives = 365/516 (70%), Gaps = 17/516 (3%)

Query: 5   EEAKRISLQVTSLSTQLIESVDKQSHLEEQLNKSLKTISSQKEAIVNYNRLKTDYEALKR 64
           EE+KRIS+QV+SLSTQLIES+DKQS LEE LN++ K +S+QK++I  ++ LK      K+
Sbjct: 15  EESKRISIQVSSLSTQLIESIDKQSRLEEHLNQAKKALSAQKDSISQFDSLKQQLSDTKK 74

Query: 65  TVLEKDDEVNKLREDVVKENELRTKAEDENDKLNKEVEDLTASLFDEANNMVSDARKEKY 124
            +   ++E+   R ++V+  E+R  AE   +KLNKE+EDLT SLFDEAN+MV++ARKEK+
Sbjct: 75  QLAYTEEELAVKRRELVEAQEVRVAAERAAEKLNKEIEDLTTSLFDEANSMVANARKEKH 134

Query: 125 AIEILNKRLTEQLREKDTLLDTLSLQLKNLKKVMHSLDNESVVTNSSNRYSTILNDSATS 184
            +E+LN +L EQLREKD LLDTLS+QL+NLK+V++ +++E    NS  +  +I+ + +  
Sbjct: 135 DVEVLNSKLQEQLREKDMLLDTLSIQLRNLKEVLYKVEDEHNTLNSYRQ--SIIMEGSNG 192

Query: 185 SSTSLNKVPTLNSSASQDMYS--GIVYSPSISSIRYDVSLYNEFLKFVAALPNCDNIKAT 242
           S+ SL+K    N     D +    +++SP   S+RYD+ LY E+L+F+A LP C  IK T
Sbjct: 193 SNASLDKEALGNPGLIYDHHHHMNLLFSPLAQSLRYDIPLYTEYLRFLAVLPMCKGIKDT 252

Query: 243 SSESKLIRRLVNDEIQPILKIDNASGIGWLVKKTLLSLIIDGLVVMEPLSGVNATYQIGY 302
             +SK +RRLV DEIQP+L++D ASG+GWLV++ L++L+IDGLVV+EPLSG+N TY+IGY
Sbjct: 253 RHDSKFLRRLVLDEIQPVLRLDAASGLGWLVRRNLMNLMIDGLVVVEPLSGINETYRIGY 312

Query: 303 NS--SSPVKQATPNMPRMFKFPLDSPPVAVHAACSFCGESRDDIIEHARMYILKTLHKAD 360
            S  S+  K    +  +MF +P +SPPVA+   C+FC ESR+DI+EH R+Y+LKTL K +
Sbjct: 313 ASPQSNSHKVTEVDNAKMFNYPSNSPPVAIQDPCAFCSESRNDILEHGRLYVLKTLQKNE 372

Query: 361 DGTEQVTNTYPLCHWCLLKLRQTCEIFAFLRSLKVGAWHLEKLEAQSITKGDLGKFSEVT 420
           DG+      YPLCH+CLLK+RQTCEIFAFLRSLK GAW+LE +       G   +F++V 
Sbjct: 373 DGSTTSETQYPLCHYCLLKVRQTCEIFAFLRSLKSGAWNLENVTLSCARPGS-DEFTKVD 431

Query: 421 KRTKTDGRVSSQDKKA-----KRLSFMAGLG-INSSSKSKQKMEVFSSEANAKPGQPTTN 474
           + + T+   S+ +K+A     KRLSFM+GL   +SS++   ++E  +  +  K G P+TN
Sbjct: 432 RNSTTN---SASNKEANSTSSKRLSFMSGLSRTSSSTRMTPRIETVTDFSERK-GLPSTN 487

Query: 475 IQRAWLQLCKLRCILHWSHIGIWAVDDSISSKIGPF 510
           +QR+W+ LCKLR  LHW HIG+W ++DSI  K+ P 
Sbjct: 488 VQRSWVHLCKLRASLHWCHIGVWTLEDSIQLKVAPM 523

>AFR670W Chr6 (1668415..1670568) [2154 bp, 717 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL272C (SEC2)
          Length = 717

 Score =  504 bits (1297), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 244/518 (47%), Positives = 365/518 (70%), Gaps = 15/518 (2%)

Query: 1   MDASEEAKRISLQVTSLSTQLIESVDKQSHLEEQLNKSLKTISSQKEAIVNYNRLKTDYE 60
           M   EE +RIS+QV+SLSTQLIES+DKQS LEEQL  + K +++QK+ +      + + +
Sbjct: 10  MSEQEENRRISVQVSSLSTQLIESIDKQSRLEEQLQHAKKALAAQKDVVKQCESARGEAQ 69

Query: 61  ALKRTVLEKDDEVNKLREDVVKENELRTKAEDENDKLNKEVEDLTASLFDEANNMVSDAR 120
            L+  + ++D E+ +  E++ +  + R  AE   ++LNKE+EDLT SLFDEAN MVS AR
Sbjct: 70  QLRSQLADRDTELERQGEELEEARKARLAAELAVERLNKEIEDLTTSLFDEANRMVSKAR 129

Query: 121 KEKYAIEILNKRLTEQLREKDTLLDTLSLQLKNLKKVMHSLDNESVVTNSSNRYSTILND 180
           KEK+ +E  N RL EQLREKD LLDTL++QLKNLK V++ +++E    N+ +R  +++ D
Sbjct: 130 KEKHVVEQHNARLQEQLREKDMLLDTLTIQLKNLKDVLYKVEDEQ---NTRSRRQSVM-D 185

Query: 181 SATSSSTSLNKVPTLNSSASQDMYSGIVYSPSISSIRYDVSLYNEFLKFVAALPNCDNIK 240
           S   S TSL+ V    S+    + SG++++P++ S+RYD+ +Y E+L+F+A LP C +I+
Sbjct: 186 SVNPSHTSLD-VDGYASAFDNMLSSGLLFTPAVQSLRYDIPMYTEYLRFLAVLPMCKSIR 244

Query: 241 ATSSESKLIRRLVNDEIQPILKIDNASGIGWLVKKTLLSLIIDGLVVMEPLSGVNATYQI 300
            T  +SK +RRLV+DEIQP+L++D+A+G+GWLV++ L++L+I+GLVV+EPLSG+N TY++
Sbjct: 245 DTRHDSKFLRRLVSDEIQPVLRLDSATGLGWLVRRNLMNLMIEGLVVVEPLSGINETYRM 304

Query: 301 GYNSS---SPVKQATPNMPRMFKFPLDSPPVAVHAACSFCGESRDDIIEHARMYILKTLH 357
           GY S    S  K + P   +MF +P++SPPVA+ A C+FC E+R+DI+EH R+Y+LKTL 
Sbjct: 305 GYASPQTHSHSKSSEPAAVKMFTYPVNSPPVAIEAPCAFCSEARNDILEHGRLYVLKTLQ 364

Query: 358 KADDGTEQVTNTYPLCHWCLLKLRQTCEIFAFLRSLKVGAWHLEKLEAQSITKGDLGKFS 417
           K + G     N YPLCH+CLLK+RQTCEIFAFLRSLK G+W+LE +   S  K +   F+
Sbjct: 365 KTETGELLTENQYPLCHFCLLKVRQTCEIFAFLRSLKTGSWNLENV-TLSCAKQESDAFT 423

Query: 418 EVTKRTKTDGRV----SSQDKKAKRLSFMAGLG-INSSSKSKQKMEVFSSEANAKPGQPT 472
           ++    +    +    +S    +KRLSFM+ L  ++++SK+  ++E   ++ N K G P 
Sbjct: 424 QIPNSVQASPVIHRDENSITSSSKRLSFMSSLSRVSTTSKTTPRIEAV-TDFNEKKGLPP 482

Query: 473 TNIQRAWLQLCKLRCILHWSHIGIWAVDDSISSKIGPF 510
           TN+QR+W+ LCKLR  LHWSHIG+W +DD++ +K+ P 
Sbjct: 483 TNVQRSWVHLCKLRASLHWSHIGVWTLDDAVQTKVVPL 520

>KLLA0C02299g Chr3 complement(194267..196243) [1977 bp, 658 aa] {ON}
           similar to uniprot|P17065 Saccharomyces cerevisiae
           YNL272C SEC2 Guanyl-nucleotide exchange factor for the
           small G-protein Sec4p located on cytoplasmic vesicles
           essential for post-Golgi vesicle transport
          Length = 658

 Score =  501 bits (1291), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 262/518 (50%), Positives = 363/518 (70%), Gaps = 36/518 (6%)

Query: 1   MDASEEAKRISLQVTSLSTQLIESVDKQSHLEEQLNKSLKTISSQKEAIVNYNRLKTDYE 60
           M   EE+KRISLQVTSLSTQLIES+DKQS LEEQL  + KTIS+Q+    +YN LK + +
Sbjct: 1   MADQEESKRISLQVTSLSTQLIESIDKQSQLEEQLLVAKKTISTQQNIANSYNELKQELQ 60

Query: 61  ALKRTVLEKDDEVNKLREDVVKENELRTKAEDENDKLNKEVEDLTASLFDEANNMVSDAR 120
           +LK   L+ + +  K +    K+ E+   AE +   LN+E+EDLTASLFDEANNMV+DAR
Sbjct: 61  SLK---LQYETDKTKFK----KQEEICADAEKKVATLNQEIEDLTASLFDEANNMVADAR 113

Query: 121 KEKYAIEILNKRLTEQLREKDTLLDTLSLQLKNLKKVMHSLDNE-----SVVTNSSNRYS 175
           KE+ A+EILN +L EQL+EKD LLDTLS+QLKNLK V++  +N+     +V  + S   S
Sbjct: 114 KEQNAVEILNSKLKEQLKEKDLLLDTLSMQLKNLKNVLYKFENDFNSSKNVSLSDSATSS 173

Query: 176 TILNDSATSSSTSLNKVPTLNSSASQDMYSGIVYSPSISSIRYDVSLYNEFLKFVAALPN 235
           T   D +T++ TS+N     ++S S   + G+++SP + S+RYDV LY E+LKF+A LP 
Sbjct: 174 TTSIDRSTTNLTSVN-----DNSLS---FQGVLFSPLLHSLRYDVPLYTEYLKFLAVLPQ 225

Query: 236 CDNIKATSSESKLIRRLVNDEIQPILKIDNASGIGWLVKKTLLSLIIDGLVVMEPLSGVN 295
           C+N++ T+SESKL+RRL+N EI P+L++DNASG+GWLVK+ L++L+++GLV +EP+SG+N
Sbjct: 226 CENLQQTTSESKLLRRLINYEISPVLRLDNASGVGWLVKRNLMNLMMEGLVSIEPISGIN 285

Query: 296 ATYQIGYNSSSPVKQATPNM----PRMFKFPLDSPPVAVHAACSFCGESRDDIIEHARMY 351
            TY+ GY  SSP    +P +      +F  P++SPPVA+   C+FCGE+R+DI+EH R+Y
Sbjct: 286 ETYRTGY--SSPSIPDSPEVENKDSHLFSRPVNSPPVAMVEPCAFCGENRNDILEHGRLY 343

Query: 352 ILKTLHKADDGTEQVTNTYPLCHWCLLKLRQTCEIFAFLRSLKVGAWHLEKLEAQSITKG 411
           I KT  K ++G  ++TN +P+CH+CLLKLRQ CEIFAFLRSL+ GAWHLEK+   SI +G
Sbjct: 344 IFKTYQKLENGKNELTNQFPVCHYCLLKLRQVCEIFAFLRSLRSGAWHLEKVALASIHQG 403

Query: 412 DLGKFSEVTKRTKTDGRVSSQDKKAKRLSFMAGLGINSSSKSKQKMEVFSSEANAKPGQP 471
            +  +SEVTK        S    K+KRLS   GL     S+S   +     +   K G P
Sbjct: 404 KVNAYSEVTK-------ASRPKMKSKRLSIFQGL---KQSQSSTPIIENGPQFADKNGLP 453

Query: 472 TTNIQRAWLQLCKLRCILHWSHIGIWAVDDSISSKIGP 509
           TTNIQR+W +L +LR  L WSHIG+W++D+S+++ I P
Sbjct: 454 TTNIQRSWARLSQLRASLQWSHIGVWSLDESVATDIAP 491

>TPHA0B04500 Chr2 (1059147..1061348) [2202 bp, 733 aa] {ON} Anc_1.81
           YNL272C
          Length = 733

 Score =  502 bits (1292), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 262/520 (50%), Positives = 361/520 (69%), Gaps = 19/520 (3%)

Query: 4   SEEAKRISLQVTSLSTQLIESVDKQSHLEEQLNKSLKTISSQKEAIVNYNRLKTDYEALK 63
           S+E KR+S+Q+TSLSTQL+ES++KQS LE++L +S K I  QK  I  YN L+  Y+ L 
Sbjct: 5   SDEDKRVSVQLTSLSTQLLESIEKQSSLEDKLRQSRKIIEEQKTTITQYNELRIKYDQLD 64

Query: 64  RTVLEKDDEVNKLREDVVKENELRTKAEDENDKLNKEVEDLTASLFDEANNMVSDARKEK 123
           +   +K  ++ +L + +  E   + +AE + D+LNKEVE+LTASLFDEANNMV+DARKE 
Sbjct: 65  KNFSKKKVDLQRLEQQLQAEKLGKAEAERKVDELNKEVEELTASLFDEANNMVADARKET 124

Query: 124 YAIEILNKRLTEQLREKDTLLDTLSLQLKNLKKVMHSLDNESVVTNSSNRYSTIL----- 178
            +IE  NK+LTEQL EKDT+L+TL+LQLKNLK V+  L  ES ++  +N   ++      
Sbjct: 125 DSIETKNKKLTEQLLEKDTILETLNLQLKNLKTVLQDLQTESSMSIINNGNISLKGDVPL 184

Query: 179 -NDSATSSSTSLNKVPTLNSSAS-QDMYSGIVYSPSISSIRYDVSLYNEFLKFVAALPNC 236
            N++  SSS SL K+ T  S  S Q++ +  +++P I++IRYD  LYNEFLKFVA LP+C
Sbjct: 185 SNENGGSSSHSLKKMSTTTSFQSQQEVVNYAIFTPKITNIRYDTFLYNEFLKFVAVLPHC 244

Query: 237 DNIKATSSESKLIRRLVNDEIQPILKIDNASGIGWLVKKTLLSLIIDGLVVMEPLSGVNA 296
           ++IK TS+ESKL+RRL++DEI P+L++D ++G+GWL K+TL++ I++GLVV+EPLSG+N 
Sbjct: 245 NSIKNTSAESKLLRRLISDEIHPVLRLDTSNGLGWLTKRTLMNQIVEGLVVIEPLSGINE 304

Query: 297 TYQIG--YNSSSPVKQATPNM---PRMFKFPLDSPPVAVHAACSFCGESRDDIIEHARMY 351
           TY+    Y  S        +     +MF FP DSPP+AV   C+FC ESR D I HARMY
Sbjct: 305 TYRQSALYEVSISKSSIKSDQITKAKMFNFPADSPPIAVRDPCAFCDESRSDCIGHARMY 364

Query: 352 ILKTLHKADDGTEQVTNTYPLCHWCLLKLRQTCEIFAFLRSLKVGAWHLEKLEAQSITKG 411
           +LKT  + DD T  +TN YPLC  CL+K+RQTC+IFAFLRSLK G W LEK+   +I+KG
Sbjct: 365 MLKTQTRNDDDTLSITNQYPLCQACLIKVRQTCDIFAFLRSLKSGVWQLEKVTLSTISKG 424

Query: 412 DLGKFSEVTK-RTKTDGRVSSQDKKAKRLSFMAGLGINSSSKSKQKMEVFSSEANAKP-G 469
           D   F +V + + K + + ++Q+KK KR S ++ LG + SS    K+     +   +P G
Sbjct: 425 DTSSFLKVAENQFKQNEKATAQEKKQKRKSIISSLGKSHSSYVNAKL-----DCTVEPVG 479

Query: 470 QPTTNIQRAWLQLCKLRCILHWSHIGIWAVDDSISSKIGP 509
            P+TNIQRAWLQLCKLR ILHWSHIGI   +D ++S   P
Sbjct: 480 LPSTNIQRAWLQLCKLRSILHWSHIGISNTEDCVTSTFAP 519

>KNAG0F00460 Chr6 complement(64086..66050) [1965 bp, 654 aa] {ON}
           Anc_1.81 YNL272C
          Length = 654

 Score =  496 bits (1277), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 254/530 (47%), Positives = 364/530 (68%), Gaps = 20/530 (3%)

Query: 1   MDASEEAKRISLQVTSLSTQLIESVDKQSHLEEQLNKSLKTISSQKEAIVNYNRLKTDYE 60
           +D ++E+KRISLQ+TS+STQL+ES+  QS LEE+LN++ K  ++ KE  V+Y+ LK    
Sbjct: 13  VDTADESKRISLQITSMSTQLMESIQNQSLLEEKLNRANKAAAALKEQTVHYDELKGRVA 72

Query: 61  ALKRTVLEKDDEVNKLREDVVKENELRTKAEDENDKLNKEVEDLTASLFDEANNMVSDAR 120
            L+ ++  +D+E+  L+  + +E   R  ++   ++L  EVEDLTASLF EANNMV+DAR
Sbjct: 73  KLEASLTNRDEEMAALKSALAEEKSKRAASDKSVEELQSEVEDLTASLFSEANNMVADAR 132

Query: 121 KEKYAIEILNKRLTEQLREKDTLLDTLSLQLKNLKKVMHSLDNESVVTNSSNRYSTILND 180
           KEK+  EILN++L E + EKD  L+T+ +QLK+L+K++  +D   V + S+   S++   
Sbjct: 133 KEKHTTEILNRKLLEAVNEKDNALETMKIQLKHLRKMLEKVD---VGSPSATGRSSMT-- 187

Query: 181 SATSSSTSLNKVPTLNSSASQ-DMYSGIVYSPSISSIRYDVSLYNEFLKFVAALPNCDNI 239
           SA + + SL  + T +S+ SQ D    +VYSPS+ S+RYD+SLY+EFLKF+ +LP C  I
Sbjct: 188 SADTDTNSLKGIVTRSSNQSQSDTAPLVVYSPSVGSVRYDLSLYSEFLKFLVSLPRCTQI 247

Query: 240 KATSSESKLIRRLVNDEIQPILKIDNASGIGWLVKKTLLSLIIDGLVVMEPLSGVNATYQ 299
           + T SESKL+RRL+NDEI PIL+ID+A GIGW+ KK+L++++++G+V++EP SGVN  YQ
Sbjct: 248 RDTESESKLVRRLINDEIAPILRIDSAPGIGWMAKKSLMNVMLEGMVIIEPNSGVNENYQ 307

Query: 300 IGYNSSSPVKQA-TPNMPRMFKFPLDSPPVAVHAACSFCGESRDDIIEHARMYILKTLHK 358
            G++S S  + +   + P +F +P DSPP+A   +C+ CGESR DI EH R++ +K   K
Sbjct: 308 HGHSSPSISQHSLGKSQPHLFSYPADSPPIASFESCALCGESRSDIYEHERLHKMKIQQK 367

Query: 359 ADDGTEQVTNTYPLCHWCLLKLRQTCEIFAFLRSLKVGAWHLEKLEAQ-SITKGDLGKF- 416
            DDGT +V N YPLC WCLL++RQTCEIF+FLRSLK G W LE ++ + S T     KF 
Sbjct: 368 RDDGTLEVVNLYPLCLWCLLRVRQTCEIFSFLRSLKTGVWGLETIKTRGSPTSAKSKKFD 427

Query: 417 --SEVTKRTKTDGRVSSQDKKAKRLSFMAGLGIN---SSSKSKQKMEVF--SSEANAKPG 469
             +   +R KT    +    + KR+S+MAGLG+N   SSS +   + +   S+    K G
Sbjct: 428 LNNAPIRRNKTKNSAN----RTKRMSWMAGLGLNTPTSSSSAPNDVSLMEPSTTFTDKNG 483

Query: 470 QPTTNIQRAWLQLCKLRCILHWSHIGIWAVDDSISSKIGPFVGDEDSDEN 519
            P TNI+RAWLQLCKLR ILHW+HIGIW+V D++  KIGP   D D  E+
Sbjct: 484 LPNTNIKRAWLQLCKLRSILHWAHIGIWSVSDALDLKIGPITTDPDDAED 533

>TBLA0A05430 Chr1 complement(1334141..1336528) [2388 bp, 795 aa]
           {ON} Anc_1.81 YNL272C
          Length = 795

 Score =  486 bits (1252), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 265/568 (46%), Positives = 371/568 (65%), Gaps = 56/568 (9%)

Query: 4   SEEAKRISLQVTSLSTQLIESVDKQSHLEEQLNKSLKTISSQKEAIVNYNRLKTDYEALK 63
           ++E++R++ QVT LSTQL+ES+ KQS LE++LN++ K +++QK  I   +++K    AL+
Sbjct: 7   ADESQRVTDQVTLLSTQLMESISKQSQLEDKLNQANKKLAAQKLTIEKNSQIKATGSALQ 66

Query: 64  RTVLEKDDEVNKLREDVVKENELRTKAEDENDKLNKEVEDLTASLFDEANNMVSDARKEK 123
           +   + + ++     ++VKE +LR KAE E   LNKEVEDLTASLFDEAN+MV+DARKEK
Sbjct: 67  KNANDLESQLKIANAELVKERQLREKAEGECTALNKEVEDLTASLFDEANHMVADARKEK 126

Query: 124 YAIEILNKRLTEQLREKDTLLDTLSLQLKNLKKVMHSLDNESVVTNSSNRYSTILND-SA 182
            A+E+ N +L EQL+EKDT+L+TL LQLKNLKKV+    +E    +S+N+ +++L++ + 
Sbjct: 127 AAVELRNTKLMEQLKEKDTVLETLELQLKNLKKVLQEFQDE----DSNNKRNSMLSEVTI 182

Query: 183 TSSSTSLNKVPTLNSSASQDMYSGIVYSPSISSIRYDVSLYNEFLKFVAALPNCDNIKAT 242
            S S+     PT+ S+ + + ++ I+YSP+IS IRYD+ LY EFLKFVA LP   NIK T
Sbjct: 183 HSGSSQRAGSPTIISTTNSESFANIIYSPNISDIRYDLPLYGEFLKFVAVLPFVKNIKQT 242

Query: 243 SSESKLIRRLVNDEIQPILKIDNASGIGWLVKKTLLSLIIDGLVVMEPLSGVNATYQIGY 302
           +++SKL+RRLVNDEIQP+L++DNA G+GW+VK+TLL+ +++GLV++EPLSGVN  Y    
Sbjct: 243 TNDSKLLRRLVNDEIQPVLRLDNADGLGWVVKRTLLTQMMEGLVMVEPLSGVNELYTHSR 302

Query: 303 NSSSPVKQATPNMPR-----------------MFKFPLDSPPVAVHAACSFCGESRDDII 345
           N  S     T    R                 +F FP +SPPVAVH  C+FC E RDD +
Sbjct: 303 NRRSATSNNTTGSTRDISGKDTNGSSNQKNSHLFNFPTNSPPVAVHEPCAFCNEKRDDSV 362

Query: 346 EHARMYILKTLHKADDGTEQVTNTYPLCHWCLLKLRQTCEIFAFLRSLKVGAWHLEKLEA 405
           +HAR+++LKT  +++ G   VTN +PLC  C+LK+RQT EIFAFLRSL +G W LEK+  
Sbjct: 363 QHARIHLLKTQSRSETGKITVTNQFPLCQSCVLKVRQTGEIFAFLRSLALGTWKLEKIAI 422

Query: 406 QSITKGDLGKFSEVTKRTKTDGRVSS-------QDKKAKRLSFMAGLGI--NSSSKSKQK 456
            +++K D          TK  G  +S       + KKAKR SF+ GL +   +S  +   
Sbjct: 423 ANLSKSD---------PTKIKGSPASPTKDKEKEKKKAKRKSFIKGLNMAQTASVLNPAT 473

Query: 457 MEVFSSEANAKP------------GQPTTNIQRAWLQLCKLRCILHWSHIGIWAVDDSIS 504
              F  +    P            GQPTTNIQRAWLQLCKLRC+LHWSH+GIW++DDSI 
Sbjct: 474 SNPFFQQTQTNPVGDTSLTDVDTFGQPTTNIQRAWLQLCKLRCMLHWSHMGIWSLDDSIE 533

Query: 505 SKIGPFVGDE----DSDENRDDSISVRL 528
           +K  P    E    D D+N D+  S +L
Sbjct: 534 AKFAPLSISESNIKDLDQNTDNFTSSQL 561

>TPHA0L00240 Chr12 (28408..30606) [2199 bp, 732 aa] {ON} Anc_4.364
           YJR134C
          Length = 732

 Score = 40.8 bits (94), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 36/113 (31%), Positives = 65/113 (57%), Gaps = 8/113 (7%)

Query: 66  VLEKDDEVNKLR---EDVVKENELRTKAEDENDKLNKEVEDLTASLFDEANNMVSDARKE 122
           + EK++ VN+L+   ED++  N+L+ +  +  ++L +E +DL   L    N M    RK 
Sbjct: 182 IKEKEESVNQLKKEKEDLL--NQLKKEKVEAQNQLKRERDDLNFQLTKGKNEMEKGERKF 239

Query: 123 KYAIEILNKRLTE---QLREKDTLLDTLSLQLKNLKKVMHSLDNESVVTNSSN 172
           K  I+ LNK LT+    L + +T LDT++ +L +LK  + +L+ E+ +  + N
Sbjct: 240 KEEIKKLNKSLTKYEVTLADTETKLDTMNYELNSLKDKVDNLEKENEIVKTKN 292

>Kpol_1026.31 s1026 complement(71225..74242) [3018 bp, 1005 aa] {ON}
           complement(71225..74242) [3018 nt, 1006 aa]
          Length = 1005

 Score = 37.7 bits (86), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 65/231 (28%), Positives = 110/231 (47%), Gaps = 24/231 (10%)

Query: 43  SSQKEAIVNYNRLKTDYEALKRTVLEKDDEVNKLREDVVKENELRTKAEDENDKLNKEVE 102
           S QKE  ++ + L  +   LK+++   + + NKL++DV+K NE  +K +++N+ L+ +V 
Sbjct: 525 SKQKELNISIDSLTKNVSELKKSLDAAETQKNKLQQDVLKSNESLSKLKNDNNSLSSQVR 584

Query: 103 DLTASLFDEANNMVSDARKEKYA--IEILNKRLTEQLREKDTLLDTL---SLQLKNLKKV 157
           +LT     EAN   +  +KEK    +E   K+  EQ     T LD +   + QLKN   +
Sbjct: 585 ELTLLKKSEANLKTNVNQKEKTIAYLEDQVKKYNEQSNSNKTSLDIMQKETEQLKNKIDL 644

Query: 158 MHSLDNE---SVVTNSSNRYSTILNDSATSSSTSL--NKVPTLNS--SASQDMYSGIVYS 210
           M   +NE   S   N+ +  S I  +   S   S+   K  TL S  S S D    I   
Sbjct: 645 MKKQNNELQISATKNNDSFESYIKENGKLSERLSVLQEKYDTLQSLKSNSNDQVESIQRQ 704

Query: 211 PSISSIRYD------VSLYNEFLKFVAALPNCDNIKATSSESKLIRRLVND 255
               +++        +SL +E  ++  A      I+  + E+  +RRL++D
Sbjct: 705 CEELTVKLKEANKRILSLEDELSEYANA------IQEKTREASTMRRLISD 749

>Ecym_2061 Chr2 (99788..103876) [4089 bp, 1362 aa] {ON} similar to
            Ashbya gossypii ADL149W
          Length = 1362

 Score = 37.0 bits (84), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 47/160 (29%), Positives = 74/160 (46%), Gaps = 31/160 (19%)

Query: 20   QLIESVDKQSHLEEQLNKSLKTISSQKEAIV-NYNRLKTDYEALKRTVLEKDDEVNKLRE 78
            QLI  +DK S   E + K    I++  E ++ NY  L+ DY+++   +L K +E+N L +
Sbjct: 1199 QLI--IDKLSKQVEDVQKENMEITTLHEELLHNYESLQKDYDSISAELLTKQNEINYLEK 1256

Query: 79   DV---------------VKENELRTKAEDENDKLNKEVEDLTASLFDEANNM-------- 115
            +                + ++EL  K + EN KL +++ED T S   E  N         
Sbjct: 1257 NYKSSLSSVTNSSKALQLSQHELE-KLKQENVKLREQIEDFTLSPSTERGNYNHSKSDDP 1315

Query: 116  -VSDARKEKYAIEI--LNKRLTEQLREKDTLLDTLSLQLK 152
             +S      Y + I  L   L    +E+D+L D L LQLK
Sbjct: 1316 PMSSFNNAHYDLRIKDLKAELYITSQERDSLKDEL-LQLK 1354

>Kpol_483.10 s483 (21646..25002) [3357 bp, 1118 aa] {ON}
           (21646..25002) [3357 nt, 1119 aa]
          Length = 1118

 Score = 35.8 bits (81), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 59/112 (52%), Gaps = 9/112 (8%)

Query: 36  NKSLKTISSQKEAIVNYNRLKTDYEALKRTVLEKDDEVNKLREDVVKENELRT---KAED 92
           N+  K +  Q+E   N NR K+  E L+RT+ + D+E     E     +ELRT   K E+
Sbjct: 390 NRYDKELQKQEEVKENINRTKSRIEVLERTIEKLDEESRN--ESGTNRDELRTRLLKLEE 447

Query: 93  ENDKLNKEVEDLTASLFD---EANNMVSDARKE-KYAIEILNKRLTEQLREK 140
            N ++++    LT  L D   E  N++S+ RKE K+ +E + ++  E  R K
Sbjct: 448 SNKEIDESRSILTTQLQDKETEYENLISNNRKELKFQMEEIKRKKIELDRGK 499

>ADL149W Chr4 (427096..430731) [3636 bp, 1211 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YHR158C (KEL1) and
            YGR238C (KEL2)
          Length = 1211

 Score = 34.7 bits (78), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 64/135 (47%), Gaps = 34/135 (25%)

Query: 47   EAIVNYNRLKTDYEALKRTVLEKDDEVNKLREDV---------------VKENELRTKAE 91
            E + NY  L+ DY+AL   ++ K +EV+ L ++                + + EL  K +
Sbjct: 1074 ELLRNYESLQQDYKALNDELVSKQNEVSYLEQNYKSSLSSVNNASKALELSQREL-GKLK 1132

Query: 92   DENDKLNKEVEDLTAS------------LFDEANNMVSDARKEKYAIEI--LNKRLTEQL 137
            +EN KL +++EDLT S            L D+    ++DA    Y + I  L   L    
Sbjct: 1133 NENTKLKEQLEDLTLSPSIDGRSKFANTLTDDPLGSLNDAH---YNLRIKDLKAELFIVR 1189

Query: 138  REKDTLLDTLSLQLK 152
            +E+D+L D L LQLK
Sbjct: 1190 QERDSLKDEL-LQLK 1203

>KLTH0D04906g Chr4 complement(446504..447592) [1089 bp, 362 aa] {ON}
           similar to uniprot|Q03175 Saccharomyces cerevisiae
           YMR101C SRT1 Cis-prenyltransferase involved in dolichol
           synthesis
          Length = 362

 Score = 33.9 bits (76), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 39  LKTISSQKEAIVNYNRLKTDYEALKRTVLEKDDEVNKLREDVVKE-NELRTKAEDENDKL 97
           +KT+S+   +I N+NR + + + L   + EK DEV +  +D   E   LR     E  ++
Sbjct: 127 VKTVSAYAFSIENFNRPQEEVDTLTSLLAEKLDEVARRAQDCNSELFGLRLCVVGERSRI 186

Query: 98  NKEVEDLTASL 108
           +KE+ D  +S+
Sbjct: 187 SKELNDRISSV 197

>Skud_9.41 Chr9 (95085..99164) [4080 bp, 1359 aa] {ON} YIL126W
           (REAL)
          Length = 1359

 Score = 33.9 bits (76), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 48/104 (46%), Gaps = 12/104 (11%)

Query: 132 RLTEQLREKDTLLDTLSLQLK---NLKKVMHSLDNESVVTNSSNRYSTILNDSATSSSTS 188
           R+T+ LR+ +T LD+LS  ++   N  KV+H    E +      R  T   + A      
Sbjct: 400 RITQLLRQTNTFLDSLSEAVRAQQNEAKVLHG--EEVLSITDEEREKTDYYEVAHRIKEK 457

Query: 189 LNKVPTLNSSASQDMYSGIVYSPSISSIRYDVSLYNEFLKFVAA 232
           ++K P++       +  GI+    I  + + VSLYN  L  + A
Sbjct: 458 VDKQPSI-------LVGGILKEYQIRGLEWMVSLYNNHLNGILA 494

>Skud_16.116 Chr16 (208753..209388) [636 bp, 211 aa] {ON} YPL166W
           (REAL)
          Length = 211

 Score = 32.3 bits (72), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 20/43 (46%), Positives = 25/43 (58%)

Query: 377 LLKLRQTCEIFAFLRSLKVGAWHLEKLEAQSITKGDLGKFSEV 419
           L K+ +T E F   R+ K+ A HLE L+ Q   K DL KFS V
Sbjct: 55  LSKILETPEFFLRKRTYKLFAKHLELLQIQLDKKRDLEKFSNV 97

>CAGL0K03795g Chr11 (350378..354265) [3888 bp, 1295 aa] {ON} similar
            to uniprot|Q04217 Saccharomyces cerevisiae YMR128w ECM16
          Length = 1295

 Score = 33.5 bits (75), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 56/122 (45%), Gaps = 21/122 (17%)

Query: 74   NKLREDVVKENELRTKAEDENDKLNKEVEDLTASLFDEANNMVSDARKEKYAIEILNKRL 133
            NK R+D V+ N LR K  DE +KL +++  +            S+  KE  AI I N+ L
Sbjct: 1049 NKQRDDFVRSNFLRRKVMDEIEKLRRQLTYIVK----------SNTSKESIAINITNEDL 1098

Query: 134  TEQLREKDTLLDTLSLQLKNLKKVMHSLDNESVVTNSSNRYSTILNDSATSSSTSLNKVP 193
               L  +        +QLK LK+++     + V   +   Y     ++  ++ T +NK+P
Sbjct: 1099 RTDLPSE--------IQLKMLKQMICVGFIDKVAIRADALYP---EEAKITNRTVINKIP 1147

Query: 194  TL 195
             L
Sbjct: 1148 YL 1149

>TBLA0I02890 Chr9 (683688..686984) [3297 bp, 1098 aa] {ON} Anc_4.237
           YLR383W
          Length = 1098

 Score = 32.3 bits (72), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 24/110 (21%), Positives = 55/110 (50%), Gaps = 11/110 (10%)

Query: 3   ASEEAKRISLQVTSLSTQLIESVDKQSHLEEQLNKSLKTISS----QKEAIVNYNRLKTD 58
           A +E +RI   + S  T L         L+E +N  L+        +  A   Y  +K +
Sbjct: 754 AKDEYQRIQNAIVSYETAL-------EGLKENMNTLLEKARPLNDIRDTAQKTYRNIKKE 806

Query: 59  YEALKRTVLEKDDEVNKLREDVVKENELRTKAEDENDKLNKEVEDLTASL 108
           +EALK+ + ++D  + + ++D+  +N+ + + +++ D++   + DL + +
Sbjct: 807 FEALKQELEDRDIRIRRYKDDITIQNDEKARIQEKIDRVQSNINDLMSGI 856

>NDAI0G05070 Chr7 (1231923..1232627) [705 bp, 234 aa] {ON} Anc_8.105
           YFR008W
          Length = 234

 Score = 31.6 bits (70), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 42/81 (51%), Gaps = 4/81 (4%)

Query: 689 HRLQKEKLLQDLDHLEEQFMEESAINQKEPEAFDDIVKQIESSEKASTADKNFAI----D 744
           ++LQK+K+L+++D L  + +  S  N K+ E   DIV   +  EK    D +  I    D
Sbjct: 64  NKLQKQKILRNIDSLSNKLIANSHSNTKKIETQQDIVLFTKFIEKRIGNDNSKIIFNPDD 123

Query: 745 NLQSTKEQNLTISNKHKEQIR 765
            +Q   ++ L I  K  EQ+R
Sbjct: 124 KIQLENDKELIILQKQNEQLR 144

>Skud_13.325 Chr13 complement(557270..559393) [2124 bp, 707 aa] {ON}
           YMR163C (REAL)
          Length = 707

 Score = 31.6 bits (70), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 62/130 (47%), Gaps = 14/130 (10%)

Query: 115 MVSDARKEKYAIEILNKRLTEQLREKDTLLDTLSLQLKNLKKVMHSLDNESVVTNS---S 171
           MV   +K+K +I+   +R+T  L+  + LL  + + L + K+++++L  ES  TN    S
Sbjct: 397 MVRMQQKKKNSIDTF-QRVTNLLKGLNPLLSAVLISLNDHKQILYALPGESWPTNGGEKS 455

Query: 172 NRYSTILNDSATSSSTSLNKVPTLNSSASQDMYSGI--VYSPSISSIRYDVSLYNEFLKF 229
           N+YS   +D    +   + K+   N   + D+ +GI   Y  ++           E ++F
Sbjct: 456 NKYSFSKSDEVFQALNYVKKIE--NDLLAVDVQNGITETYKSNVQ------DKLEELIRF 507

Query: 230 VAALPNCDNI 239
              L  C+N 
Sbjct: 508 WKGLKTCNNF 517

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.127    0.350 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 70,735,941
Number of extensions: 3039744
Number of successful extensions: 22883
Number of sequences better than 10.0: 1364
Number of HSP's gapped: 23780
Number of HSP's successfully gapped: 1929
Length of query: 790
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 672
Effective length of database: 39,950,811
Effective search space: 26846944992
Effective search space used: 26846944992
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 70 (31.6 bits)