Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_14.3112.284ON63763730830.0
YNL020C (ARK1)2.284ON63864422630.0
Skud_14.3092.284ON63961221480.0
Suva_14.3272.284ON63260819950.0
KAFR0H033302.284ON36931912851e-173
NCAS0G038102.284ON66135612911e-170
SAKL0E07722g2.284ON79130912941e-169
KAFR0J013702.284ON78038812861e-168
NDAI0G006402.284ON62130912631e-166
Smik_9.842.284ON80839612651e-164
KNAG0H020202.284ON59234512381e-163
Suva_9.1042.284ON80535712561e-163
YIL095W (PRK1)2.284ON81034912491e-162
Kwal_27.115422.284ON79130912461e-161
KLLA0E08405g2.284ON77737212421e-161
NCAS0B062602.284ON72332312371e-161
Skud_9.782.284ON80931512401e-160
NDAI0B035602.284ON75634312221e-158
CAGL0G02607g2.284ON68831412021e-156
Kpol_1003.352.284ON71330911911e-154
KLTH0G10318g2.284ON79031411961e-154
TPHA0C033802.284ON69731311881e-154
TBLA0B059302.284ON71730611841e-153
ZYRO0A01848g2.284ON70431411641e-150
Ecym_33232.284ON74830911671e-150
ADL217W2.284ON75037111511e-148
CAGL0J03432g2.284ON62231011341e-147
Kpol_1039.332.284ON70131410911e-139
TBLA0B069402.284ON144330811251e-137
KNAG0A054302.284ON78831210531e-133
TPHA0D015402.284ON7073209911e-124
KAFR0A010403.273ON9123477913e-93
Kpol_251.43.273ON8383127751e-91
SAKL0D03234g3.273ON8583057579e-89
TBLA0E025903.273ON10613167651e-88
NDAI0A057003.273ON11573557653e-88
KNAG0H012203.273ON9133247554e-88
KNAG0J008203.273ON10913227609e-88
CAGL0H10208g3.273ON10273197543e-87
KLTH0C07260g3.273ON9013147414e-86
NCAS0A105903.273ON10953257477e-86
Kpol_1052.223.273ON11013077442e-85
Kwal_27.109453.273ON9353147346e-85
KAFR0C004303.273ON9493217293e-84
ZYRO0E06864g3.273ON11153177311e-83
Suva_4.2973.273ON11073177302e-83
Smik_2.1913.273ON11083817302e-83
Ecym_26503.273ON8943067202e-83
CAGL0K11990g3.273ON9913227252e-83
TDEL0D035203.273ON10493157273e-83
TPHA0A040303.273ON10543467264e-83
Skud_2.1793.273ON10903867222e-82
TPHA0M011203.273ON7883197056e-82
AGR027C3.273ON9613137121e-81
YBR059C (AKL1)3.273ON11083177161e-81
KLLA0F18612g3.273ON8143077032e-81
TBLA0I019303.273ON13613147043e-79
SAKL0A03344g6.262ON3643502672e-24
Kwal_56.242746.262ON3463372511e-22
KLTH0H03080g6.262ON3463342387e-21
KAFR0A050906.31ON6683092457e-21
Suva_16.706.262ON3643482273e-19
YPL236C (ENV7)6.262ON3643322263e-19
KNAG0F002901.52ON11253222333e-19
TPHA0F024306.31ON7983142299e-19
Smik_1.793.177ON9742872299e-19
YAR019C (CDC15)3.177ON9742872281e-18
Smik_11.1392.479ON15342342291e-18
TDEL0A067506.262ON3723012221e-18
YKL101W (HSL1)2.479ON15183322281e-18
Ecym_73922.479ON14343582262e-18
ZYRO0E07876g6.262ON3693372175e-18
NCAS0B044906.222ON3492032166e-18
Skud_16.426.262ON3643342166e-18
KAFR0D012207.86ON10552182226e-18
Kpol_1072.198.668ON8962942226e-18
Skud_1.723.177ON9742872227e-18
Skud_11.1262.479ON15182342227e-18
KNAG0F001701.24ON5433742189e-18
Ecym_21536.262ON3633462131e-17
Suva_11.1232.479ON15262342201e-17
Suva_16.1608.668ON9182912182e-17
TBLA0A047207.86ON12622282173e-17
Kpol_1065.36.222ON3762892103e-17
Smik_6.4416.262ON3643422095e-17
CAGL0K08514g2.479ON14892192156e-17
KLLA0C01650g1.52ON11123002146e-17
TDEL0A025502.479ON13692132147e-17
KNAG0A065402.479ON14321982147e-17
Kpol_1023.266.31ON7393012128e-17
Kwal_55.215455.406ON8652232128e-17
NCAS0A002801.24ON5352842109e-17
TBLA0A071501.52ON13913182139e-17
ZYRO0G03366g2.479ON16162062139e-17
KNAG0D048107.86ON14401772131e-16
Kpol_1037.206.31ON7043062111e-16
ZYRO0F18062g1.24ON4712612072e-16
Suva_1.863.177ON9742872102e-16
Suva_2.7031.24ON4851952072e-16
ABL034W2.479ON14253032102e-16
KLTH0F16676g5.406ON8782232092e-16
TDEL0H036407.86ON12371802102e-16
Skud_16.1328.668ON9242942083e-16
NCAS0C041008.141ON9053352083e-16
Ecym_10581.52ON11643012083e-16
TDEL0A027202.496ON9152872083e-16
TBLA0B004906.31ON7872822074e-16
SAKL0C01716g1.52ON12153222084e-16
SAKL0E02860g2.479ON13772972074e-16
SAKL0H06754g8.668ON8842072064e-16
SAKL0E01584g6.31ON6953422064e-16
CAGL0F00913g7.86ON12062012075e-16
Smik_4.8031.24ON4901992045e-16
KAFR0G012001.24ON5072792036e-16
KAFR0D049505.406ON10082552066e-16
Smik_13.1596.31ON7052932056e-16
YMR001C (CDC5)6.31ON7052932048e-16
NCAS0A057702.479ON14613372058e-16
AFR696C1.52ON11423202058e-16
NCAS0C016708.668ON8962072041e-15
TBLA0I011502.479ON17453122041e-15
KNAG0E008506.31ON7113082021e-15
TDEL0C067801.24ON4682332001e-15
ZYRO0D05500g7.86ON12621762031e-15
ACL006W6.31ON7083022012e-15
KLTH0C10912g6.31ON6973142012e-15
NDAI0F016006.222ON4122041982e-15
NDAI0C026806.31ON7502842012e-15
KAFR0D032002.479ON14482042022e-15
KAFR0G026906.31ON7132942012e-15
YDR523C (SPS1)1.24ON4901991992e-15
Skud_4.7971.24ON4851951982e-15
KAFR0C014403.92ON10952702012e-15
NDAI0H024707.86ON14111802012e-15
KLTH0F01672g1.52ON11643222012e-15
YPL150W8.668ON9012922002e-15
YDR507C (GIN4)1.52ON11423332012e-15
KLLA0E21693g5.406ON10162872012e-15
KAFR0D041001.52ON11173202003e-15
Skud_13.1546.31ON7052841993e-15
CAGL0E05720g6.222ON3582891943e-15
KLLA0B02332g6.222ON3612771943e-15
Ecym_10301.24ON4402771963e-15
TPHA0G016308.668ON8712131994e-15
TDEL0G043806.31ON7223001984e-15
Skud_3.391.52ON10172001994e-15
Ecym_30356.31ON7403021984e-15
Suva_13.1636.31ON7052841984e-15
ZYRO0E07018g6.222ON3672041934e-15
NDAI0D027502.479ON15152111994e-15
TBLA0B082503.92ON13471961994e-15
CAGL0J11638g6.31ON7462991975e-15
Smik_6.3478.668ON9172921985e-15
KLLA0F13552g2.479ON12672081985e-15
AFL101C6.222ON3672911927e-15
KAFR0K007007.86ON13811921977e-15
TPHA0E036401.52ON11372191977e-15
TPHA0J004206.31ON7072931967e-15
Kpol_2002.241.24ON4872671948e-15
NCAS0F015807.86ON13821801969e-15
Smik_4.7673.92ON7581951951e-14
TPHA0G032002.479ON15342191961e-14
Kpol_431.92.479ON15521991961e-14
Skud_4.7831.52ON11353321951e-14
KLLA0C12485g3.92ON9252231951e-14
NCAS0D021006.31ON7262861941e-14
Smik_3.541.52ON10322001951e-14
AFR724C1.24ON4402781911e-14
ZYRO0F07194g8.668ON9382001941e-14
Smik_4.7891.52ON11363331941e-14
ZYRO0B01166g2.496ON9632871941e-14
CAGL0L11550g5.406ON10722041942e-14
Ecym_35863.92ON10771941942e-14
Kwal_33.131121.24ON5052831912e-14
NDAI0E012908.654ON7292391932e-14
TBLA0A035705.406ON9752291932e-14
YDR490C (PKH1)3.92ON7661961922e-14
CAGL0M02299g8.668ON8932081922e-14
NCAS0B086001.52ON11173231922e-14
NCAS0I004707.86ON10822281922e-14
Suva_15.2975.406ON10742091922e-14
Suva_2.6871.52ON11282191923e-14
KLLA0F07623g7.86ON12292331923e-14
ZYRO0C07480g6.31ON7742711913e-14
Kwal_26.77882.479ON12673041923e-14
KNAG0A030408.654ON6442041903e-14
NDAI0F045201.24ON4892151893e-14
Kwal_26.78612.496ON9552771913e-14
Kwal_56.224766.31ON6972941903e-14
Kwal_26.87098.654ON8292191904e-14
TPHA0E038501.24ON4822011884e-14
KLTH0D05566g2.479ON11282981904e-14
CAGL0H06259g7.86ON13361921904e-14
KLTH0D10714g8.654ON8722191904e-14
KNAG0F029006.31ON6493221895e-14
CAGL0K05709g1.52ON11032201905e-14
NDAI0C017005.406ON10202211896e-14
Kpol_1031.105.406ON11272091896e-14
ACL104C5.406ON9472081896e-14
Ecym_26407.86ON13251811896e-14
Ecym_55055.406ON10032011887e-14
TPHA0G032902.496ON9732361887e-14
TBLA0A074601.24ON5162141868e-14
KAFR0K002806.222ON3602041838e-14
Kpol_2002.461.52ON11232191889e-14
Kwal_47.183075.591ON6211941869e-14
CAGL0G04609g3.92ON9652961879e-14
Kpol_1040.207.86ON12971761889e-14
Kwal_26.87518.668ON8482031871e-13
TDEL0C064901.52ON11532191871e-13
NDAI0E023908.668ON8831951871e-13
TBLA0B023103.92ON8191881871e-13
NDAI0A038702.496ON8952181871e-13
Skud_8.1635.406ON10762091861e-13
KLLA0C06138g6.31ON7083021851e-13
Skud_4.7643.92ON7561961851e-13
TDEL0E053106.222ON3741961821e-13
ACR133C8.668ON8512051851e-13
NCAS0C041208.140ON9152641851e-13
YCL024W (KCC4)1.52ON10371981852e-13
KLTH0C09548g3.92ON9931941852e-13
YOL045W (PSK2)7.86ON11011841852e-13
Kwal_26.71547.86ON12131791852e-13
TPHA0E028206.222ON3842181812e-13
SAKL0G01848g5.406ON8852591842e-13
Skud_1.447.86ON13561771852e-13
KNAG0L005207.86ON3681741802e-13
SAKL0A04246g6.222ON4002051812e-13
YCR073C (SSK22)6.341ON13312911842e-13
KNAG0J016708.668ON10091981842e-13
KAFR0A037308.654ON7882431832e-13
Smik_4.3678.279ON10663061843e-13
KNAG0K023703.60ON8831981833e-13
Kpol_1044.37.86ON9321791833e-13
Suva_16.3823.338ON3982381803e-13
Smik_8.1805.406ON10732091833e-13
KNAG0B043205.406ON10272441833e-13
NCAS0B014708.654ON7272121823e-13
ACR281C7.86ON12591811833e-13
SAKL0B09856g7.86ON12742311833e-13
TBLA0B039708.654ON12082121833e-13
TDEL0D053203.92ON10572291833e-13
Suva_3.1901.52ON10242001833e-13
ZYRO0A06446g5.406ON9432441824e-13
NCAS0A055706.371ON9182901824e-13
Smik_1.507.86ON13571771824e-13
SAKL0H07084g8.654ON9192101824e-13
CAGL0J03872g8.654ON6612011815e-13
YAL017W (PSK1)7.86ON13561771825e-13
NDAI0A006601.52ON10222201815e-13
NOTE: 1 genes in the same pillar as Smik_14.311 were not hit in these BLAST results
LIST: TDEL0G02150

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_14.311
         (637 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_14.311 Chr14 complement(558013..559926) [1914 bp, 637 aa] {...  1192   0.0  
YNL020C Chr14 complement(595623..597539) [1917 bp, 638 aa] {ON} ...   876   0.0  
Skud_14.309 Chr14 complement(566344..568263) [1920 bp, 639 aa] {...   832   0.0  
Suva_14.327 Chr14 complement(578572..580470) [1899 bp, 632 aa] {...   773   0.0  
KAFR0H03330 Chr8 complement(635910..637019) [1110 bp, 369 aa] {O...   499   e-173
NCAS0G03810 Chr7 complement(703842..705827) [1986 bp, 661 aa] {O...   501   e-170
SAKL0E07722g Chr5 complement(625066..627441) [2376 bp, 791 aa] {...   503   e-169
KAFR0J01370 Chr10 complement(250424..252766) [2343 bp, 780 aa] {...   499   e-168
NDAI0G00640 Chr7 (139655..141520) [1866 bp, 621 aa] {ON} Anc_2.284    491   e-166
Smik_9.84 Chr9 (162983..165409) [2427 bp, 808 aa] {ON} YIL095W (...   491   e-164
KNAG0H02020 Chr8 complement(357248..359026) [1779 bp, 592 aa] {O...   481   e-163
Suva_9.104 Chr9 (178011..180428) [2418 bp, 805 aa] {ON} YIL095W ...   488   e-163
YIL095W Chr9 (183937..186369) [2433 bp, 810 aa] {ON}  PRK1Protei...   485   e-162
Kwal_27.11542 s27 complement(841389..843764) [2376 bp, 791 aa] {...   484   e-161
KLLA0E08405g Chr5 complement(756205..758538) [2334 bp, 777 aa] {...   483   e-161
NCAS0B06260 Chr2 complement(1180650..1182821) [2172 bp, 723 aa] ...   481   e-161
Skud_9.78 Chr9 (160531..162960) [2430 bp, 809 aa] {ON} YIL095W (...   482   e-160
NDAI0B03560 Chr2 complement(892839..895109) [2271 bp, 756 aa] {O...   475   e-158
CAGL0G02607g Chr7 complement(240244..242310) [2067 bp, 688 aa] {...   467   e-156
Kpol_1003.35 s1003 (89266..91407) [2142 bp, 713 aa] {ON} (89266....   463   e-154
KLTH0G10318g Chr7 (872129..874501) [2373 bp, 790 aa] {ON} simila...   465   e-154
TPHA0C03380 Chr3 (740939..743032) [2094 bp, 697 aa] {ON} Anc_2.2...   462   e-154
TBLA0B05930 Chr2 (1400163..1402316) [2154 bp, 717 aa] {ON} Anc_2...   460   e-153
ZYRO0A01848g Chr1 (152134..154248) [2115 bp, 704 aa] {ON} simila...   452   e-150
Ecym_3323 Chr3 (618386..620632) [2247 bp, 748 aa] {ON} similar t...   454   e-150
ADL217W Chr4 (321491..323743) [2253 bp, 750 aa] {ON} Syntenic ho...   447   e-148
CAGL0J03432g Chr10 (330031..331899) [1869 bp, 622 aa] {ON} simil...   441   e-147
Kpol_1039.33 s1039 complement(102096..104201) [2106 bp, 701 aa] ...   424   e-139
TBLA0B06940 Chr2 (1639189..1643520) [4332 bp, 1443 aa] {ON} Anc_...   437   e-137
KNAG0A05430 Chr1 complement(800787..803153) [2367 bp, 788 aa] {O...   410   e-133
TPHA0D01540 Chr4 complement(316471..318594) [2124 bp, 707 aa] {O...   386   e-124
KAFR0A01040 Chr1 complement(197612..200350) [2739 bp, 912 aa] {O...   309   3e-93
Kpol_251.4 s251 (5802..8318) [2517 bp, 838 aa] {ON} (5802..8318)...   303   1e-91
SAKL0D03234g Chr4 (262365..264941) [2577 bp, 858 aa] {ON} some s...   296   9e-89
TBLA0E02590 Chr5 complement(651679..654864) [3186 bp, 1061 aa] {...   299   1e-88
NDAI0A05700 Chr1 (1288604..1292077) [3474 bp, 1157 aa] {ON} Anc_...   299   3e-88
KNAG0H01220 Chr8 (209884..212625) [2742 bp, 913 aa] {ON} Anc_3.2...   295   4e-88
KNAG0J00820 Chr10 complement(137927..141202) [3276 bp, 1091 aa] ...   297   9e-88
CAGL0H10208g Chr8 complement(996853..999936) [3084 bp, 1027 aa] ...   295   3e-87
KLTH0C07260g Chr3 (626334..629039) [2706 bp, 901 aa] {ON} simila...   290   4e-86
NCAS0A10590 Chr1 complement(2108142..2111429) [3288 bp, 1095 aa]...   292   7e-86
Kpol_1052.22 s1052 (72364..75669) [3306 bp, 1101 aa] {ON} (72364...   291   2e-85
Kwal_27.10945 s27 (565717..568524) [2808 bp, 935 aa] {ON} YBR059...   287   6e-85
KAFR0C00430 Chr3 complement(88561..91410) [2850 bp, 949 aa] {ON}...   285   3e-84
ZYRO0E06864g Chr5 complement(516731..520078) [3348 bp, 1115 aa] ...   286   1e-83
Suva_4.297 Chr4 complement(523650..526973) [3324 bp, 1107 aa] {O...   285   2e-83
Smik_2.191 Chr2 complement(338792..342118) [3327 bp, 1108 aa] {O...   285   2e-83
Ecym_2650 Chr2 complement(1257641..1260325) [2685 bp, 894 aa] {O...   281   2e-83
CAGL0K11990g Chr11 complement(1156224..1159199) [2976 bp, 991 aa...   283   2e-83
TDEL0D03520 Chr4 (647828..650977) [3150 bp, 1049 aa] {ON} Anc_3....   284   3e-83
TPHA0A04030 Chr1 (901665..904829) [3165 bp, 1054 aa] {ON} Anc_3....   284   4e-83
Skud_2.179 Chr2 complement(325193..328465) [3273 bp, 1090 aa] {O...   282   2e-82
TPHA0M01120 Chr13 complement(223548..225914) [2367 bp, 788 aa] {...   276   6e-82
AGR027C Chr7 complement(763303..766188) [2886 bp, 961 aa] {ON} S...   278   1e-81
YBR059C Chr2 complement(356861..360187) [3327 bp, 1108 aa] {ON} ...   280   1e-81
KLLA0F18612g Chr6 (1711131..1713575) [2445 bp, 814 aa] {ON} some...   275   2e-81
TBLA0I01930 Chr9 complement(436511..440596) [4086 bp, 1361 aa] {...   275   3e-79
SAKL0A03344g Chr1 complement(305149..306243) [1095 bp, 364 aa] {...   107   2e-24
Kwal_56.24274 s56 (932404..933444) [1041 bp, 346 aa] {ON} YPL236...   101   1e-22
KLTH0H03080g Chr8 complement(274038..275078) [1041 bp, 346 aa] {...    96   7e-21
KAFR0A05090 Chr1 (1011918..1013924) [2007 bp, 668 aa] {ON}             99   7e-21
Suva_16.70 Chr16 complement(110631..111725) [1095 bp, 364 aa] {O...    92   3e-19
YPL236C Chr16 complement(101608..102702) [1095 bp, 364 aa] {ON} ...    92   3e-19
KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52...    94   3e-19
TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {O...    93   9e-19
Smik_1.79 Chr1 complement(149839..152763) [2925 bp, 974 aa] {ON}...    93   9e-19
YAR019C Chr1 complement(172211..175135) [2925 bp, 974 aa] {ON}  ...    92   1e-18
Smik_11.139 Chr11 (235511..240115) [4605 bp, 1534 aa] {ON} YKL10...    93   1e-18
TDEL0A06750 Chr1 (1179818..1180936) [1119 bp, 372 aa] {ON} Anc_6...    90   1e-18
YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}  HSL1Nim1...    92   1e-18
Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON...    92   2e-18
ZYRO0E07876g Chr5 (616134..617243) [1110 bp, 369 aa] {ON} simila...    88   5e-18
NCAS0B04490 Chr2 (814474..815523) [1050 bp, 349 aa] {ON} Anc_8.141     88   6e-18
Skud_16.42 Chr16 complement(75193..76287) [1095 bp, 364 aa] {ON}...    88   6e-18
KAFR0D01220 Chr4 (246927..250094) [3168 bp, 1055 aa] {ON} Anc_7....    90   6e-18
Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON} (44906....    90   6e-18
Skud_1.72 Chr1 (141337..144261) [2925 bp, 974 aa] {ON} YAR019C (...    90   7e-18
Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL10...    90   7e-18
KNAG0F00170 Chr6 (13778..15409) [1632 bp, 543 aa] {ON} Anc_1.24 ...    89   9e-18
Ecym_2153 Chr2 complement(287697..288788) [1092 bp, 363 aa] {ON}...    87   1e-17
Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL10...    89   1e-17
Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150...    89   2e-17
TBLA0A04720 Chr1 (1168895..1172683) [3789 bp, 1262 aa] {ON} Anc_...    88   3e-17
Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON} ...    86   3e-17
Smik_6.441 Chr6 (721619..722713) [1095 bp, 364 aa] {ON} YPL236C ...    85   5e-17
CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]...    87   6e-17
KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} simil...    87   6e-17
TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2....    87   7e-17
KNAG0A06540 Chr1 (1002435..1006733) [4299 bp, 1432 aa] {ON} Anc_...    87   7e-17
Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON} (51805....    86   8e-17
Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {...    86   8e-17
NCAS0A00280 Chr1 (40406..42013) [1608 bp, 535 aa] {ON} Anc_1.24        86   9e-17
TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON} Anc_...    87   9e-17
ZYRO0G03366g Chr7 (261014..265864) [4851 bp, 1616 aa] {ON} simil...    87   9e-17
KNAG0D04810 Chr4 (867817..872139) [4323 bp, 1440 aa] {ON} Anc_7....    87   1e-16
Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON} (41658....    86   1e-16
ZYRO0F18062g Chr6 complement(1494752..1496167) [1416 bp, 471 aa]...    84   2e-16
Suva_1.86 Chr1 complement(150761..153685) [2925 bp, 974 aa] {ON}...    86   2e-16
Suva_2.703 Chr2 complement(1238496..1239953) [1458 bp, 485 aa] {...    84   2e-16
ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic h...    86   2e-16
KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]...    85   2e-16
TDEL0H03640 Chr8 complement(600211..603924) [3714 bp, 1237 aa] {...    86   2e-16
Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150...    85   3e-16
NCAS0C04100 Chr3 (834997..837714) [2718 bp, 905 aa] {ON} Anc_8.141     85   3e-16
Ecym_1058 Chr1 (105835..109329) [3495 bp, 1164 aa] {ON} similar ...    85   3e-16
TDEL0A02720 Chr1 complement(491618..494365) [2748 bp, 915 aa] {O...    85   3e-16
TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}...    84   4e-16
SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} simil...    85   4e-16
SAKL0E02860g Chr5 complement(228726..232859) [4134 bp, 1377 aa] ...    84   4e-16
SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} simila...    84   4e-16
SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {...    84   4e-16
CAGL0F00913g Chr6 (97023..100643) [3621 bp, 1206 aa] {ON} simila...    84   5e-16
Smik_4.803 Chr4 complement(1408345..1409817) [1473 bp, 490 aa] {...    83   5e-16
KAFR0G01200 Chr7 (273238..274761) [1524 bp, 507 aa] {ON} Anc_1.2...    83   6e-16
KAFR0D04950 Chr4 (971956..974982) [3027 bp, 1008 aa] {ON} Anc_5....    84   6e-16
Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {...    84   6e-16
YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON} ...    83   8e-16
NCAS0A05770 Chr1 (1132854..1137239) [4386 bp, 1461 aa] {ON} Anc_...    84   8e-16
AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON...    84   8e-16
NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {O...    83   1e-15
TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {...    83   1e-15
KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {O...    82   1e-15
TDEL0C06780 Chr3 complement(1236767..1238173) [1407 bp, 468 aa] ...    82   1e-15
ZYRO0D05500g Chr4 (473262..477050) [3789 bp, 1262 aa] {ON} weakl...    83   1e-15
ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic ho...    82   2e-15
KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly...    82   2e-15
NDAI0F01600 Chr6 complement(392424..393662) [1239 bp, 412 aa] {O...    81   2e-15
NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {O...    82   2e-15
KAFR0D03200 Chr4 (628993..633339) [4347 bp, 1448 aa] {ON} Anc_2....    82   2e-15
KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {O...    82   2e-15
YDR523C Chr4 complement(1485566..1487038) [1473 bp, 490 aa] {ON}...    81   2e-15
Skud_4.797 Chr4 complement(1405618..1407075) [1458 bp, 485 aa] {...    81   2e-15
KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {...    82   2e-15
NDAI0H02470 Chr8 complement(597707..601942) [4236 bp, 1411 aa] {...    82   2e-15
KLTH0F01672g Chr6 (127277..130771) [3495 bp, 1164 aa] {ON} simil...    82   2e-15
YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein ki...    82   2e-15
YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON...    82   2e-15
KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa...    82   2e-15
KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {...    82   3e-15
Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {...    81   3e-15
CAGL0E05720g Chr5 (569265..570341) [1077 bp, 358 aa] {ON} simila...    79   3e-15
KLLA0B02332g Chr2 complement(206863..207948) [1086 bp, 361 aa] {...    79   3e-15
Ecym_1030 Chr1 (56043..57365) [1323 bp, 440 aa] {ON} similar to ...    80   3e-15
TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.6...    81   4e-15
TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.3...    81   4e-15
Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W (R...    81   4e-15
Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON} s...    81   4e-15
Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {...    81   4e-15
ZYRO0E07018g Chr5 (531316..532419) [1104 bp, 367 aa] {ON} simila...    79   4e-15
NDAI0D02750 Chr4 (639802..644349) [4548 bp, 1515 aa] {ON} Anc_2....    81   4e-15
TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]...    81   4e-15
CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa...    80   5e-15
Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON...    81   5e-15
KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa...    81   5e-15
AFL101C Chr6 complement(249144..250247) [1104 bp, 367 aa] {ON} S...    79   7e-15
KAFR0K00700 Chr11 complement(153981..158126) [4146 bp, 1381 aa] ...    80   7e-15
TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {...    80   7e-15
TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON...    80   7e-15
Kpol_2002.24 s2002 (48405..49868) [1464 bp, 487 aa] {ON} (48405....    79   8e-15
NCAS0F01580 Chr6 complement(313801..317949) [4149 bp, 1382 aa] {...    80   9e-15
Smik_4.767 Chr4 complement(1353354..1355630) [2277 bp, 758 aa] {...    80   1e-14
TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2....    80   1e-14
Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}...    80   1e-14
Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa] ...    80   1e-14
KLLA0C12485g Chr3 (1060167..1062944) [2778 bp, 925 aa] {ON} simi...    80   1e-14
NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31      79   1e-14
Smik_3.54 Chr3 (80309..83407) [3099 bp, 1032 aa] {ON} YCL024W (R...    80   1e-14
AFR724C Chr6 complement(1770338..1771660) [1323 bp, 440 aa] {ON}...    78   1e-14
ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {...    79   1e-14
Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa] ...    79   1e-14
ZYRO0B01166g Chr2 complement(97168..100059) [2892 bp, 963 aa] {O...    79   1e-14
CAGL0L11550g Chr12 (1232015..1235233) [3219 bp, 1072 aa] {ON} si...    79   2e-14
Ecym_3586 Chr3 complement(1112070..1115303) [3234 bp, 1077 aa] {...    79   2e-14
Kwal_33.13112 s33 (76807..78324) [1518 bp, 505 aa] {ON} YDR523C ...    78   2e-14
NDAI0E01290 Chr5 complement(255593..257782) [2190 bp, 729 aa] {O...    79   2e-14
TBLA0A03570 Chr1 (892930..895857) [2928 bp, 975 aa] {ON} Anc_5.4...    79   2e-14
YDR490C Chr4 complement(1431968..1434268) [2301 bp, 766 aa] {ON}...    79   2e-14
CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} simil...    79   2e-14
NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON} Anc_...    79   2e-14
NCAS0I00470 Chr9 (74336..77584) [3249 bp, 1082 aa] {ON} Anc_7.86       79   2e-14
Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074...    79   2e-14
Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa] ...    79   3e-14
KLLA0F07623g Chr6 (720246..723935) [3690 bp, 1229 aa] {ON} simil...    79   3e-14
ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly...    78   3e-14
Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101...    79   3e-14
KNAG0A03040 Chr1 complement(372150..374084) [1935 bp, 644 aa] {O...    78   3e-14
NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa] ...    77   3e-14
Kwal_26.7861 s26 complement(544126..546993) [2868 bp, 955 aa] {O...    78   3e-14
Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {...    78   3e-14
Kwal_26.8709 s26 (907885..910374) [2490 bp, 829 aa] {ON} YPL141C...    78   4e-14
TPHA0E03850 Chr5 complement(810694..812142) [1449 bp, 482 aa] {O...    77   4e-14
KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakl...    78   4e-14
CAGL0H06259g Chr8 (615045..619055) [4011 bp, 1336 aa] {ON} simil...    78   4e-14
KLTH0D10714g Chr4 (880389..883007) [2619 bp, 872 aa] {ON} simila...    78   4e-14
KNAG0F02900 Chr6 (549477..551426) [1950 bp, 649 aa] {ON}               77   5e-14
CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa]...    78   5e-14
NDAI0C01700 Chr3 complement(367077..370139) [3063 bp, 1020 aa] {...    77   6e-14
Kpol_1031.10 s1031 (25064..28447) [3384 bp, 1127 aa] {ON} (25064...    77   6e-14
ACL104C Chr3 complement(157357..160200) [2844 bp, 947 aa] {ON} S...    77   6e-14
Ecym_2640 Chr2 complement(1232617..1236594) [3978 bp, 1325 aa] {...    77   6e-14
Ecym_5505 Chr5 (1027605..1030616) [3012 bp, 1003 aa] {ON} simila...    77   7e-14
TPHA0G03290 Chr7 (702953..705874) [2922 bp, 973 aa] {ON} Anc_2.4...    77   7e-14
TBLA0A07460 Chr1 (1848207..1849757) [1551 bp, 516 aa] {ON} Anc_1...    76   8e-14
KAFR0K00280 Chr11 complement(64906..65988) [1083 bp, 360 aa] {ON...    75   8e-14
Kpol_2002.46 s2002 (95107..98478) [3372 bp, 1123 aa] {ON} (95107...    77   9e-14
Kwal_47.18307 s47 complement(776521..778386) [1866 bp, 621 aa] {...    76   9e-14
CAGL0G04609g Chr7 complement(437162..440059) [2898 bp, 965 aa] {...    77   9e-14
Kpol_1040.20 s1040 (57057..60950) [3894 bp, 1297 aa] {ON} (57057...    77   9e-14
Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {O...    77   1e-13
TDEL0C06490 Chr3 complement(1191461..1194922) [3462 bp, 1153 aa]...    77   1e-13
NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {O...    77   1e-13
TBLA0B02310 Chr2 (539362..541821) [2460 bp, 819 aa] {ON} Anc_3.9...    77   1e-13
NDAI0A03870 Chr1 (867910..870597) [2688 bp, 895 aa] {ON} Anc_2.496     77   1e-13
Skud_8.163 Chr8 (290415..293645) [3231 bp, 1076 aa] {ON} YHR102W...    76   1e-13
KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} simila...    76   1e-13
Skud_4.764 Chr4 complement(1351725..1353995) [2271 bp, 756 aa] {...    76   1e-13
TDEL0E05310 Chr5 (972769..973893) [1125 bp, 374 aa] {ON} Anc_6.2...    75   1e-13
ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON} S...    76   1e-13
NCAS0C04120 Chr3 complement(840008..842755) [2748 bp, 915 aa] {O...    76   1e-13
YCL024W Chr3 (79162..82275) [3114 bp, 1037 aa] {ON}  KCC4Protein...    76   2e-13
KLTH0C09548g Chr3 (792218..795199) [2982 bp, 993 aa] {ON} simila...    76   2e-13
YOL045W Chr15 (243497..246802) [3306 bp, 1101 aa] {ON}  PSK2One ...    76   2e-13
Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045...    76   2e-13
TPHA0E02820 Chr5 complement(589816..590970) [1155 bp, 384 aa] {O...    74   2e-13
SAKL0G01848g Chr7 (154547..157204) [2658 bp, 885 aa] {ON} weakly...    75   2e-13
Skud_1.44 Chr1 (95573..99643) [4071 bp, 1356 aa] {ON} YAL017W (R...    76   2e-13
KNAG0L00520 Chr12 (79786..80892) [1107 bp, 368 aa] {ON} Anc_7.86...    74   2e-13
SAKL0A04246g Chr1 complement(396019..397221) [1203 bp, 400 aa] {...    74   2e-13
YCR073C Chr3 complement(242588..246583) [3996 bp, 1331 aa] {ON} ...    75   2e-13
KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa] ...    75   2e-13
KAFR0A03730 Chr1 (761946..764312) [2367 bp, 788 aa] {ON} Anc_8.6...    75   2e-13
Smik_4.367 Chr4 (655941..659141) [3201 bp, 1066 aa] {ON} YDR122W...    75   3e-13
KNAG0K02370 Chr11 complement(475088..477739) [2652 bp, 883 aa] {...    75   3e-13
Kpol_1044.3 s1044 (4910..5845,5849..7711) [2799 bp, 932 aa] {ON}...    75   3e-13
Suva_16.382 Chr16 (673009..674205) [1197 bp, 398 aa] {ON} YPR054...    74   3e-13
Smik_8.180 Chr8 (292993..296214) [3222 bp, 1073 aa] {ON} YHR102W...    75   3e-13
KNAG0B04320 Chr2 complement(821265..824348) [3084 bp, 1027 aa] {...    75   3e-13
NCAS0B01470 Chr2 (241003..243186) [2184 bp, 727 aa] {ON} Anc_8.654     75   3e-13
ACR281C Chr3 complement(864528..868307) [3780 bp, 1259 aa] {ON} ...    75   3e-13
SAKL0B09856g Chr2 complement(830531..834355) [3825 bp, 1274 aa] ...    75   3e-13
TBLA0B03970 Chr2 complement(904167..907793) [3627 bp, 1208 aa] {...    75   3e-13
TDEL0D05320 Chr4 complement(965082..968255) [3174 bp, 1057 aa] {...    75   3e-13
Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 a...    75   3e-13
ZYRO0A06446g Chr1 complement(513126..515957) [2832 bp, 943 aa] {...    75   4e-13
NCAS0A05570 Chr1 (1093653..1096409) [2757 bp, 918 aa] {ON} Anc_6...    75   4e-13
Smik_1.50 Chr1 (103132..107205) [4074 bp, 1357 aa] {ON} YAL017W ...    75   4e-13
SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {...    75   4e-13
CAGL0J03872g Chr10 (368472..370457) [1986 bp, 661 aa] {ON} simil...    74   5e-13
YAL017W Chr1 (120225..124295) [4071 bp, 1356 aa] {ON}  PSK1One o...    75   5e-13
NDAI0A00660 Chr1 (121773..124841) [3069 bp, 1022 aa] {ON} Anc_1.52     74   5e-13
KLLA0C08525g Chr3 (744554..749209) [4656 bp, 1551 aa] {ON} simil...    75   5e-13
TPHA0H01630 Chr8 (371333..374443) [3111 bp, 1036 aa] {ON} Anc_5....    74   5e-13
TPHA0D02840 Chr4 (591733..593637) [1905 bp, 634 aa] {ON}               74   5e-13
KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {...    74   5e-13
TPHA0H02630 Chr8 complement(614048..618151) [4104 bp, 1367 aa] {...    74   5e-13
Suva_2.666 Chr2 complement(1183839..1186133) [2295 bp, 764 aa] {...    74   5e-13
Smik_15.122 Chr15 (209665..212970) [3306 bp, 1101 aa] {ON} YOL04...    74   5e-13
TBLA0B08520 Chr2 complement(2038517..2041321) [2805 bp, 934 aa] ...    74   5e-13
YPL209C Chr16 complement(156490..157593) [1104 bp, 367 aa] {ON} ...    73   6e-13
KLLA0C04191g Chr3 (384198..386591) [2394 bp, 797 aa] {ON} weakly...    74   6e-13
SAKL0C00946g Chr3 (84995..86689) [1695 bp, 564 aa] {ON} similar ...    74   6e-13
KLLA0B13607g Chr2 (1191592..1194561) [2970 bp, 989 aa] {ON} simi...    74   6e-13
KLLA0A07403g Chr1 (661261..663900) [2640 bp, 879 aa] {ON} simila...    74   6e-13
KLTH0F00946g Chr6 (73412..74950) [1539 bp, 512 aa] {ON} similar ...    73   7e-13
KLTH0H03982g Chr8 complement(363432..364628) [1197 bp, 398 aa] {...    73   7e-13
TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa] ...    74   7e-13
Smik_8.42 Chr8 complement(74075..76894) [2820 bp, 939 aa] {ON} Y...    74   8e-13
Skud_8.39 Chr8 complement(76730..79501) [2772 bp, 923 aa] {ON} Y...    74   8e-13
Skud_10.119 Chr10 (215299..219744) [4446 bp, 1481 aa] {ON} YJL09...    74   8e-13
Suva_3.110 Chr3 complement(160016..164146) [4131 bp, 1376 aa] {O...    74   9e-13
KLLA0F14190g Chr6 (1311121..1315137) [4017 bp, 1338 aa] {ON} uni...    74   9e-13
Suva_15.124 Chr15 (215781..219101) [3321 bp, 1106 aa] {ON} YOL04...    74   9e-13
KNAG0D00210 Chr4 complement(22721..25222) [2502 bp, 833 aa] {ON}...    73   9e-13
CAGL0I07513g Chr9 (722045..725275) [3231 bp, 1076 aa] {ON} simil...    74   9e-13
NDAI0K02100 Chr11 complement(469575..472304) [2730 bp, 909 aa] {...    74   9e-13
CAGL0M02519g Chr13 complement(290723..292993) [2271 bp, 756 aa] ...    73   1e-12
KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} simi...    73   1e-12
Kpol_1072.29 s1072 complement(61987..64668) [2682 bp, 893 aa] {O...    73   1e-12
Sklu_YGOB_Anc_2.496 Chr5 (185447..187306) [1860 bp, 619 aa] {ON}...    73   1e-12
Suva_6.169 Chr6 complement(300200..304654) [4455 bp, 1484 aa] {O...    74   1e-12
NDAI0E02320 Chr5 (480203..483001) [2799 bp, 932 aa] {ON}               73   1e-12
KAFR0H02510 Chr8 complement(476574..479213) [2640 bp, 879 aa] {O...    73   1e-12
Kpol_1012.6 s1012 (11581..13467) [1887 bp, 628 aa] {ON} (11581.....    73   1e-12
NDAI0G03450 Chr7 (822716..825562) [2847 bp, 948 aa] {ON} Anc_8.141     73   1e-12
TDEL0F04060 Chr6 (749896..753276) [3381 bp, 1126 aa] {ON} Anc_8....    73   1e-12
YHL007C Chr8 complement(95118..97937) [2820 bp, 939 aa] {ON}  ST...    73   1e-12
Skud_15.112 Chr15 (202308..205613) [3306 bp, 1101 aa] {ON} YOL04...    73   1e-12
NDAI0G04290 Chr7 complement(1030530..1033871) [3342 bp, 1113 aa]...    73   1e-12
NDAI0F01340 Chr6 complement(327928..329148) [1221 bp, 406 aa] {O...    72   1e-12
Ecym_8339 Chr8 (684113..686875) [2763 bp, 920 aa] {ON} similar t...    73   1e-12
KLTH0G05214g Chr7 (423793..425754) [1962 bp, 653 aa] {ON} weakly...    72   1e-12
KLTH0D06006g Chr4 complement(532589..535453) [2865 bp, 954 aa] {...    73   1e-12
KNAG0D00830 Chr4 complement(130823..131986) [1164 bp, 387 aa] {O...    72   1e-12
Suva_1.50 Chr1 (96474..100556) [4083 bp, 1360 aa] {ON} YAL017W (...    73   2e-12
Skud_7.92 Chr7 complement(169006..170697) [1692 bp, 563 aa] {ON}...    72   2e-12
YDL159W Chr4 (172481..174028) [1548 bp, 515 aa] {ON}  STE7Signal...    72   2e-12
Ecym_2194 Chr2 complement(381633..382733) [1101 bp, 366 aa] {ON}...    71   2e-12
TBLA0I00280 Chr9 (42870..46820) [3951 bp, 1316 aa] {ON} Anc_2.49...    73   2e-12
KNAG0D01090 Chr4 complement(183319..184437) [1119 bp, 372 aa] {O...    71   2e-12
CAGL0H01639g Chr8 (158967..160532) [1566 bp, 521 aa] {ON} simila...    72   2e-12
Kwal_56.24091 s56 (845680..846825) [1146 bp, 381 aa] {ON} YPL209...    71   2e-12
NCAS0C04940 Chr3 (1006185..1009535) [3351 bp, 1116 aa] {ON} Anc_...    72   2e-12
YJL095W Chr10 (247255..251691) [4437 bp, 1478 aa] {ON}  BCK1Mito...    73   2e-12
Smik_16.296 Chr16 (542962..544128) [1167 bp, 388 aa] {ON} YPR054...    71   2e-12
CAGL0M11396g Chr13 (1122109..1125687) [3579 bp, 1192 aa] {ON} si...    72   2e-12
KLTH0D02486g Chr4 (247566..251237) [3672 bp, 1223 aa] {ON} simil...    72   2e-12
Smik_6.339 Chr6 (538177..540774) [2598 bp, 865 aa] {ON} YPL141C ...    72   2e-12
TDEL0A06000 Chr1 (1053427..1055799) [2373 bp, 790 aa] {ON} Anc_8...    72   2e-12
TDEL0C02110 Chr3 (364853..366340) [1488 bp, 495 aa] {ON} Anc_7.3...    71   3e-12
CAGL0C03509g Chr3 complement(350846..353533) [2688 bp, 895 aa] {...    72   3e-12
KAFR0A08360 Chr1 complement(1677561..1680050) [2490 bp, 829 aa] ...    72   3e-12
ABR014W Chr2 (417708..420623) [2916 bp, 971 aa] {ON} Syntenic ho...    72   3e-12
AFR335C Chr6 complement(1046756..1049857) [3102 bp, 1033 aa] {ON...    72   3e-12
Ecym_2434 Chr2 complement(843308..846676) [3369 bp, 1122 aa] {ON...    72   3e-12
YNL298W Chr14 (68915..71443) [2529 bp, 842 aa] {ON}  CLA4Cdc42p-...    72   3e-12
YOL100W Chr15 (129237..132482) [3246 bp, 1081 aa] {ON}  PKH2Seri...    72   3e-12
TBLA0E02290 Chr5 complement(563483..567385) [3903 bp, 1300 aa] {...    72   3e-12
Ecym_6040 Chr6 complement(77854..80544) [2691 bp, 896 aa] {ON} s...    72   3e-12
Skud_4.97 Chr4 (168099..169670) [1572 bp, 523 aa] {ON} YDL159W (...    71   3e-12
KAFR0D03390 Chr4 (667896..670292) [2397 bp, 798 aa] {ON} Anc_2.4...    72   3e-12
CAGL0K02673g Chr11 complement(241338..244085) [2748 bp, 915 aa] ...    72   3e-12
Suva_8.47 Chr8 complement(91615..94557) [2943 bp, 980 aa] {ON} Y...    72   4e-12
ZYRO0F17402g Chr6 complement(1445685..1449254) [3570 bp, 1189 aa...    72   4e-12
Kpol_463.8 s463 complement(18696..23039) [4344 bp, 1447 aa] {ON}...    72   4e-12
Smik_10.147 Chr10 (239101..243537) [4437 bp, 1478 aa] {ON} YJL09...    72   4e-12
YHR102W Chr8 (316572..319814) [3243 bp, 1080 aa] {ON}  KIC1Prote...    72   4e-12
TBLA0E03360 Chr5 complement(838512..840476) [1965 bp, 654 aa] {O...    71   4e-12
ZYRO0D06776g Chr4 complement(583027..586641) [3615 bp, 1204 aa] ...    72   4e-12
AFL143C Chr6 complement(164241..165326) [1086 bp, 361 aa] {ON} S...    70   4e-12
CAGL0M10153g Chr13 complement(1010688..1013291) [2604 bp, 867 aa...    71   5e-12
NDAI0K02390 Chr11 (537260..539920) [2661 bp, 886 aa] {ON} Anc_6....    71   5e-12
Skud_15.54 Chr15 (88576..91824) [3249 bp, 1082 aa] {ON} YOL100W ...    71   5e-12
TBLA0H01660 Chr8 complement(377521..380511) [2991 bp, 996 aa] {O...    71   5e-12
NCAS0B05090 Chr2 (946126..949758) [3633 bp, 1210 aa] {ON}              71   5e-12
KLLA0C00979g Chr3 (73295..74746) [1452 bp, 483 aa] {ON} similar ...    70   5e-12
Kwal_56.22693 s56 complement(239982..242936) [2955 bp, 984 aa] {...    71   5e-12
TBLA0A02050 Chr1 (495735..497039) [1305 bp, 434 aa] {ON}               70   5e-12
KAFR0H02540 Chr8 complement(483399..485852) [2454 bp, 817 aa] {O...    71   5e-12
Kpol_1055.24 s1055 complement(57430..60243) [2814 bp, 937 aa] {O...    71   6e-12
YPR054W Chr16 (666280..667446) [1167 bp, 388 aa] {ON}  SMK1Middl...    70   6e-12
AEL284C Chr5 complement(106480..107919) [1440 bp, 479 aa] {ON} S...    70   6e-12
Suva_7.83 Chr7 complement(159329..161038) [1710 bp, 569 aa] {ON}...    70   6e-12
ZYRO0B06512g Chr2 complement(521075..524410) [3336 bp, 1111 aa] ...    71   6e-12
TPHA0G01710 Chr7 complement(350452..352869) [2418 bp, 805 aa] {O...    70   6e-12
Skud_16.340 Chr16 (631100..632266) [1167 bp, 388 aa] {ON} YPR054...    70   6e-12
Suva_15.65 Chr15 (102271..105513) [3243 bp, 1080 aa] {ON} YOL100...    71   7e-12
KNAG0K00680 Chr11 (120919..124206) [3288 bp, 1095 aa] {ON} Anc_3...    71   7e-12
TDEL0E02180 Chr5 complement(408232..411195) [2964 bp, 987 aa] {O...    71   7e-12
Skud_3.165 Chr3 (258916..261066) [2151 bp, 716 aa] {ON} YCR091W ...    70   7e-12
TPHA0P01270 Chr16 complement(254480..257137) [2658 bp, 885 aa] {...    70   7e-12
KAFR0A01760 Chr1 complement(363462..366119) [2658 bp, 885 aa] {O...    70   8e-12
Ecym_3525 Chr3 (993328..995784) [2457 bp, 818 aa] {ON} similar t...    70   8e-12
Ecym_4291 Chr4 complement(620549..623986) [3438 bp, 1145 aa] {ON...    70   8e-12
KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8....    70   9e-12
Suva_7.82 Chr7 (156049..158751) [2703 bp, 900 aa] {ON} YGL180W (...    70   9e-12
CAGL0I03498g Chr9 (297344..298699) [1356 bp, 451 aa] {ON} simila...    69   9e-12
Ecym_8337 Chr8 (679844..681460) [1617 bp, 538 aa] {ON} similar t...    70   9e-12
Skud_16.70 Chr16 complement(129918..131021) [1104 bp, 367 aa] {O...    69   9e-12
Suva_15.411 Chr15 (716095..718542) [2448 bp, 815 aa] {ON} YHR205...    70   9e-12
NCAS0A09470 Chr1 complement(1883183..1887730) [4548 bp, 1515 aa]...    70   9e-12
Smik_7.92 Chr7 (155049..157742) [2694 bp, 897 aa] {ON} YGL180W (...    70   1e-11
TDEL0A07560 Chr1 complement(1316498..1321225) [4728 bp, 1575 aa]...    70   1e-11
Smik_15.57 Chr15 (92331..95576) [3246 bp, 1081 aa] {ON} YOL100W ...    70   1e-11
Smik_14.377 Chr14 (666338..669025) [2688 bp, 895 aa] {ON} YNR047...    70   1e-11
SAKL0F11110g Chr6 (868447..869832) [1386 bp, 461 aa] {ON} simila...    69   1e-11
KNAG0M00190 Chr13 complement(25224..27602) [2379 bp, 792 aa] {ON...    70   1e-11
NCAS0C01590 Chr3 (293327..295921) [2595 bp, 864 aa] {ON} Anc_8.654     70   1e-11
TPHA0D01140 Chr4 (238656..240524) [1869 bp, 622 aa] {ON} Anc_8.6...    70   1e-11
Kwal_26.7355 s26 (326867..331207) [4341 bp, 1446 aa] {ON} YJL095...    70   1e-11
Kpol_1072.31 s1072 complement(67104..68684) [1581 bp, 526 aa] {O...    69   1e-11
Kpol_1054.2 s1054 complement(4365..7655) [3291 bp, 1096 aa] {ON}...    70   1e-11
Smik_14.34 Chr14 (53272..55788) [2517 bp, 838 aa] {ON} YNL298W (...    70   1e-11
YGL180W Chr7 (160065..162758) [2694 bp, 897 aa] {ON}  ATG1Protei...    70   1e-11
Kwal_56.23717 s56 complement(674222..676798) [2577 bp, 858 aa] {...    70   1e-11
TBLA0A02240 Chr1 (539297..540538) [1242 bp, 413 aa] {ON} Anc_6.2...    69   1e-11
NCAS0H01940 Chr8 (374913..377960) [3048 bp, 1015 aa] {ON} Anc_5....    70   1e-11
Smik_4.532 Chr4 complement(956572..961554) [4983 bp, 1660 aa] {O...    70   1e-11
NCAS0A05370 Chr1 complement(1061671..1066197) [4527 bp, 1508 aa]...    70   1e-11
Ecym_2405 Chr2 (788655..791222) [2568 bp, 855 aa] {ON} similar t...    69   2e-11
SAKL0A01254g Chr1 (119884..124560) [4677 bp, 1558 aa] {ON} simil...    70   2e-11
Smik_4.79 Chr4 (149246..150796) [1551 bp, 516 aa] {ON} YDL159W (...    69   2e-11
Skud_14.379 Chr14 (677081..679774) [2694 bp, 897 aa] {ON} YNR047...    69   2e-11
TPHA0P01050 Chr16 complement(212259..215624) [3366 bp, 1121 aa] ...    69   2e-11
YDR283C Chr4 complement(1025070..1030049) [4980 bp, 1659 aa] {ON...    70   2e-11
Skud_15.399 Chr15 (714789..717212) [2424 bp, 807 aa] {ON} YOR233...    69   2e-11
NCAS0A05050 Chr1 complement(1002107..1004788) [2682 bp, 893 aa] ...    69   2e-11
TBLA0C04600 Chr3 (1112043..1115990) [3948 bp, 1315 aa] {ON} Anc_...    69   2e-11
KNAG0B01780 Chr2 (326438..331180) [4743 bp, 1580 aa] {ON} Anc_1....    69   2e-11
Kpol_1066.45 s1066 complement(76786..79428) [2643 bp, 880 aa] {O...    69   2e-11
Kpol_1066.46 s1066 (82874..86551) [3678 bp, 1225 aa] {ON} (82874...    69   2e-11
NDAI0I00250 Chr9 (42174..44867) [2694 bp, 897 aa] {ON} Anc_3.177...    69   2e-11
Skud_14.40 Chr14 (62496..65006) [2511 bp, 836 aa] {ON} YNL298W (...    69   2e-11
KNAG0D00390 Chr4 (53459..58429) [4971 bp, 1656 aa] {ON} Anc_6.34...    69   2e-11
YHR205W Chr8 (509363..511837) [2475 bp, 824 aa] {ON}  SCH9AGC fa...    69   2e-11
TPHA0J00820 Chr10 (193408..197064) [3657 bp, 1218 aa] {ON} Anc_8...    69   2e-11
AEL205W Chr5 (246871..249252) [2382 bp, 793 aa] {ON} Syntenic ho...    69   2e-11
KLLA0F19536g Chr6 (1808263..1811577) [3315 bp, 1104 aa] {ON} sim...    69   2e-11
Skud_16.140 Chr16 complement(255090..257687) [2598 bp, 865 aa] {...    69   2e-11
Smik_8.295 Chr8 (484074..486548) [2475 bp, 824 aa] {ON} YHR205W ...    69   2e-11
YNR047W Chr14 (708523..711204) [2682 bp, 893 aa] {ON}  FPK1Ser/T...    69   2e-11
KLTH0G13288g Chr7 complement(1139058..1142486) [3429 bp, 1142 aa...    69   2e-11
ZYRO0C02288g Chr3 complement(181604..184327) [2724 bp, 907 aa] {...    69   3e-11
ZYRO0C06776g Chr3 complement(508813..511485) [2673 bp, 890 aa] {...    69   3e-11
YCR091W Chr3 (274404..276566) [2163 bp, 720 aa] {ON}  KIN82Putat...    69   3e-11
Suva_14.42 Chr14 (65645..68239) [2595 bp, 864 aa] {ON} YNL298W (...    69   3e-11
ZYRO0F06842g Chr6 (561269..563800) [2532 bp, 843 aa] {ON} simila...    69   3e-11
Suva_16.169 Chr16 complement(292738..295314) [2577 bp, 858 aa] {...    69   3e-11
Suva_4.87 Chr4 (160236..161810) [1575 bp, 524 aa] {ON} YDL159W (...    68   3e-11
KLLA0E03587g Chr5 complement(323764..325707) [1944 bp, 647 aa] {...    68   3e-11
YPL141C Chr16 complement(283464..286061) [2598 bp, 865 aa] {ON} ...    69   3e-11
KLTH0D03454g Chr4 (327039..331340) [4302 bp, 1433 aa] {ON} simil...    69   3e-11
Ecym_5251 Chr5 (522785..525466) [2682 bp, 893 aa] {ON} similar t...    69   3e-11
KAFR0B06980 Chr2 (1452754..1455081) [2328 bp, 775 aa] {ON} Anc_4...    69   3e-11
NDAI0B02070 Chr2 (514024..517800) [3777 bp, 1258 aa] {ON}              69   3e-11
NCAS0A08080 Chr1 complement(1594221..1596092) [1872 bp, 623 aa] ...    68   3e-11
Smik_6.338 Chr6 (535192..536727) [1536 bp, 511 aa] {ON} YPL140C ...    68   3e-11
KNAG0G02110 Chr7 (477260..480838) [3579 bp, 1192 aa] {ON} Anc_8....    69   3e-11
Skud_8.272 Chr8 (478199..480706) [2508 bp, 835 aa] {ON} YHR205W ...    68   4e-11
KLTH0F03916g Chr6 complement(348177..350282) [2106 bp, 701 aa] {...    68   4e-11
TDEL0D01400 Chr4 (269367..273656) [4290 bp, 1429 aa] {ON} Anc_1....    69   4e-11
TBLA0D02230 Chr4 (557816..561280) [3465 bp, 1154 aa] {ON} Anc_8....    69   4e-11
TBLA0B03990 Chr2 complement(910314..912455) [2142 bp, 713 aa] {O...    68   4e-11
NDAI0A06130 Chr1 complement(1391744..1394203) [2460 bp, 819 aa] ...    68   4e-11
TDEL0A07860 Chr1 (1365985..1368498) [2514 bp, 837 aa] {ON} Anc_6...    68   4e-11
NDAI0G05470 Chr7 (1340175..1344842) [4668 bp, 1555 aa] {ON} Anc_...    68   4e-11
NDAI0H00940 Chr8 complement(209645..211702) [2058 bp, 685 aa] {O...    68   4e-11
SAKL0H16632g Chr8 complement(1461613..1464801) [3189 bp, 1062 aa...    68   4e-11
KAFR0A01420 Chr1 (276454..280650) [4197 bp, 1398 aa] {ON} Anc_1....    68   4e-11
Suva_2.651 Chr2 (1164264..1166165) [1902 bp, 633 aa] {ON} YDR477...    68   4e-11
KLLA0E17073g Chr5 complement(1515721..1518279) [2559 bp, 852 aa]...    68   4e-11
KLTH0E06754g Chr5 (619163..621784) [2622 bp, 873 aa] {ON} simila...    68   5e-11
NDAI0A01970 Chr1 (440268..442184) [1917 bp, 638 aa] {ON} Anc_7.335     68   5e-11
KAFR0E01490 Chr5 (298209..303167) [4959 bp, 1652 aa] {ON} Anc_5....    68   5e-11
KLLA0C10802g Chr3 complement(926916..931934) [5019 bp, 1672 aa] ...    68   5e-11
SAKL0D12628g Chr4 (1048973..1051429) [2457 bp, 818 aa] {ON} weak...    68   5e-11
KNAG0J01590 Chr10 (292565..294982) [2418 bp, 805 aa] {ON} Anc_8....    68   5e-11
Suva_2.283 Chr2 (489490..492759) [3270 bp, 1089 aa] {ON} YDR122W...    68   5e-11
TBLA0C02940 Chr3 complement(706091..711022) [4932 bp, 1643 aa] {...    68   5e-11
TPHA0H00420 Chr8 complement(82575..85691) [3117 bp, 1038 aa] {ON...    68   5e-11
TBLA0A10690 Chr1 (2642723..2645632) [2910 bp, 969 aa] {ON} Anc_4...    68   5e-11
YDR122W Chr4 (694700..697894) [3195 bp, 1064 aa] {ON}  KIN1Serin...    68   5e-11
KNAG0B05350 Chr2 complement(1034166..1036676) [2511 bp, 836 aa] ...    68   5e-11
Kpol_265.1 s265 (4826..7099) [2274 bp, 757 aa] {ON} (4826..7099)...    68   5e-11
Skud_4.383 Chr4 (666354..669551) [3198 bp, 1065 aa] {ON} YDR122W...    68   5e-11
SAKL0C04576g Chr3 complement(444365..446611) [2247 bp, 748 aa] {...    67   6e-11
Smik_6.414 Chr6 (666806..667909) [1104 bp, 367 aa] {ON} YPL209C ...    67   6e-11
SAKL0D05522g Chr4 (437018..441442) [4425 bp, 1474 aa] {ON} simil...    68   6e-11
YOR233W Chr15 (775846..778248) [2403 bp, 800 aa] {ON}  KIN4Serin...    67   6e-11
CAGL0D01694g Chr4 complement(176981..178279) [1299 bp, 432 aa] {...    67   6e-11
NDAI0I00340 Chr9 (65047..70557) [5511 bp, 1836 aa] {ON} Anc_6.341      68   6e-11
NCAS0B03740 Chr2 complement(668231..671380) [3150 bp, 1049 aa] {...    68   6e-11
Skud_7.91 Chr7 (165681..168374) [2694 bp, 897 aa] {ON} YGL180W (...    67   6e-11
AER264C Chr5 complement(1120017..1124468) [4452 bp, 1483 aa] {ON...    68   6e-11
ZYRO0G15290g Chr7 complement(1237119..1241582) [4464 bp, 1487 aa...    68   6e-11
Kwal_23.5290 s23 complement(1095011..1097470) [2460 bp, 819 aa] ...    67   7e-11
Suva_8.284 Chr8 (514891..517317) [2427 bp, 808 aa] {ON} YOR233W ...    67   7e-11
NDAI0J01250 Chr10 complement(291314..294844) [3531 bp, 1176 aa] ...    68   7e-11
Suva_14.385 Chr14 complement(661987..666732) [4746 bp, 1581 aa] ...    68   7e-11
Smik_3.189 Chr3 (273885..276044) [2160 bp, 719 aa] {ON} YCR091W ...    67   7e-11
Smik_15.417 Chr15 (725513..727933) [2421 bp, 806 aa] {ON} YOR233...    67   7e-11
Skud_14.362 Chr14 complement(648801..653540) [4740 bp, 1579 aa] ...    68   7e-11
Smik_4.754 Chr4 (1333667..1335565) [1899 bp, 632 aa] {ON} YDR477...    67   7e-11
KNAG0D04040 Chr4 (730581..731897) [1317 bp, 438 aa] {ON} Anc_4.1...    66   8e-11
ZYRO0D08184g Chr4 (706856..711601) [4746 bp, 1581 aa] {ON} simil...    67   8e-11
Kpol_495.14 s495 (33810..35684) [1875 bp, 624 aa] {ON} (33810..3...    67   8e-11
TDEL0E00690 Chr5 (144269..146770) [2502 bp, 833 aa] {ON} Anc_3.6...    67   8e-11
YLR096W Chr12 (332590..336033) [3444 bp, 1147 aa] {ON}  KIN2Seri...    67   8e-11
Kpol_1018.65 s1018 (189779..191584) [1806 bp, 601 aa] {ON} (1897...    67   9e-11
ZYRO0A05544g Chr1 (450809..452704) [1896 bp, 631 aa] {ON} highly...    67   9e-11
Skud_4.546 Chr4 complement(967636..972618) [4983 bp, 1660 aa] {O...    67   9e-11
ADR313W Chr4 (1255930..1257666) [1737 bp, 578 aa] {ON} Syntenic ...    67   9e-11
NCAS0A09960 Chr1 complement(1993554..1995926) [2373 bp, 790 aa] ...    67   9e-11
YGL179C Chr7 complement(163409..165091) [1683 bp, 560 aa] {ON}  ...    67   1e-10
NCAS0D04600 Chr4 (875553..880604) [5052 bp, 1683 aa] {ON} Anc_6....    67   1e-10
YNR031C Chr14 complement(680694..685433) [4740 bp, 1579 aa] {ON}...    67   1e-10
KAFR0F04340 Chr6 (848844..853628) [4785 bp, 1594 aa] {ON} Anc_6....    67   1e-10
ZYRO0G19052g Chr7 (1576638..1580033) [3396 bp, 1131 aa] {ON} sim...    67   1e-10
NCAS0D04710 Chr4 complement(901442..903856) [2415 bp, 804 aa] {O...    67   1e-10
NCAS0C03690 Chr3 (741930..744881) [2952 bp, 983 aa] {ON}               67   1e-10
NCAS0A02180 Chr1 (410419..411489) [1071 bp, 356 aa] {ON} Anc_4.192     65   1e-10
CAGL0M08910g Chr13 complement(887703..889541) [1839 bp, 612 aa] ...    66   1e-10
Skud_16.141 Chr16 complement(259166..260707) [1542 bp, 513 aa] {...    66   1e-10
Skud_7.350 Chr7 (580913..582022) [1110 bp, 369 aa] {ON} YGR052W ...    65   1e-10
TDEL0D00330 Chr4 complement(55638..57872) [2235 bp, 744 aa] {ON}...    67   1e-10
KAFR0F03970 Chr6 (777047..778201) [1155 bp, 384 aa] {ON} Anc_4.1...    65   1e-10
KLTH0D10670g Chr4 (877472..878806) [1335 bp, 444 aa] {ON} some s...    66   1e-10
YDR477W Chr4 (1412373..1414274) [1902 bp, 633 aa] {ON}  SNF1AMP-...    66   1e-10
SAKL0C12386g Chr3 complement(1108341..1110923) [2583 bp, 860 aa]...    67   1e-10
Suva_16.170 Chr16 complement(296877..298406) [1530 bp, 509 aa] {...    66   1e-10
CAGL0B01925g Chr2 (176316..179150) [2835 bp, 944 aa] {ON} simila...    67   1e-10
TPHA0C00470 Chr3 (81482..83377) [1896 bp, 631 aa] {ON} Anc_5.611...    66   1e-10
Kwal_26.8703 s26 (905007..906341) [1335 bp, 444 aa] {ON} YOR231W...    66   1e-10
Kwal_47.16761 s47 (100315..102549) [2235 bp, 744 aa] {ON} YHR205...    66   1e-10
Suva_14.402 Chr14 (690198..692915) [2718 bp, 905 aa] {ON} YNR047...    66   1e-10
ZYRO0G00506g Chr7 complement(38488..40854) [2367 bp, 788 aa] {ON...    66   1e-10
SAKL0C09174g Chr3 complement(833618..836833) [3216 bp, 1071 aa] ...    66   1e-10
SAKL0B12364g Chr2 (1060853..1063021) [2169 bp, 722 aa] {ON} high...    66   2e-10
TPHA0H00750 Chr8 complement(150811..152043) [1233 bp, 410 aa] {O...    65   2e-10
AFR092W Chr6 (595092..599363) [4272 bp, 1423 aa] {ON} Syntenic h...    67   2e-10
KLTH0A01320g Chr1 (118671..121115) [2445 bp, 814 aa] {ON} simila...    66   2e-10
Smik_15.39 Chr15 (72332..74314) [1983 bp, 660 aa] {ON} YOL113W (...    66   2e-10
CAGL0F09075g Chr6 (894761..897001) [2241 bp, 746 aa] {ON} simila...    66   2e-10
SAKL0C07722g Chr3 (717419..720157) [2739 bp, 912 aa] {ON} simila...    66   2e-10
ACR117W Chr3 (557738..559312) [1575 bp, 524 aa] {ON} Syntenic ho...    65   2e-10
NCAS0I03020 Chr9 (555481..557853) [2373 bp, 790 aa] {ON} Anc_1.149     66   2e-10
Skud_4.751 Chr4 (1332135..1334039) [1905 bp, 634 aa] {ON} YDR477...    66   2e-10
KLTH0D17204g Chr4 complement(1426818..1429085) [2268 bp, 755 aa]...    66   2e-10
KNAG0B03230 Chr2 complement(625072..626997) [1926 bp, 641 aa] {O...    65   2e-10
YPL140C Chr16 complement(287514..289034) [1521 bp, 506 aa] {ON} ...    65   2e-10
YOL113W Chr15 (104326..106293) [1968 bp, 655 aa] {ON}  SKM1Membe...    65   2e-10
ADR167W Chr4 (994581..997202) [2622 bp, 873 aa] {ON} Syntenic ho...    66   2e-10
TBLA0B01630 Chr2 (360963..364850) [3888 bp, 1295 aa] {ON} Anc_3....    66   2e-10
Smik_7.93 Chr7 complement(158441..160132) [1692 bp, 563 aa] {ON}...    65   2e-10
KAFR0C05860 Chr3 (1160586..1162520) [1935 bp, 644 aa] {ON} Anc_5...    65   2e-10
TBLA0C01750 Chr3 (412762..415707) [2946 bp, 981 aa] {ON} Anc_8.6...    66   2e-10
Ecym_1275 Chr1 complement(560481..561836) [1356 bp, 451 aa] {ON}...    65   2e-10
NCAS0F02520 Chr6 (495799..500631) [4833 bp, 1610 aa] {ON} Anc_5....    66   2e-10
Skud_15.39 Chr15 (69445..71412) [1968 bp, 655 aa] {ON} YOL113W (...    65   2e-10
Kwal_27.10004 s27 complement(156153..158360) [2208 bp, 735 aa] {...    65   2e-10
Skud_12.164 Chr12 (315700..319182) [3483 bp, 1160 aa] {ON} YLR09...    66   2e-10
TPHA0C00160 Chr3 complement(17339..19603) [2265 bp, 754 aa] {ON}...    65   2e-10
AEL230W Chr5 (198401..200227) [1827 bp, 608 aa] {ON} Syntenic ho...    65   2e-10
KAFR0C04590 Chr3 complement(917915..922321) [4407 bp, 1468 aa] {...    66   2e-10
KAFR0F01150 Chr6 complement(218711..219811) [1101 bp, 366 aa] {O...    64   3e-10
KAFR0A03710 Chr1 (758918..760399) [1482 bp, 493 aa] {ON} Anc_8.6...    65   3e-10
NDAI0D03420 Chr4 (806856..809261) [2406 bp, 801 aa] {ON} Anc_4.384     65   3e-10
CAGL0L03520g Chr12 complement(403100..407443) [4344 bp, 1447 aa]...    65   3e-10
TDEL0B06320 Chr2 (1118534..1119868) [1335 bp, 444 aa] {ON} Anc_1...    65   3e-10
KLTH0A06776g Chr1 complement(562932..567503) [4572 bp, 1523 aa] ...    65   3e-10
Skud_3.146 Chr3 complement(227229..231233) [4005 bp, 1334 aa] {O...    65   3e-10
AER223C Chr5 complement(1044971..1047679) [2709 bp, 902 aa] {ON}...    65   4e-10
NCAS0A14050 Chr1 complement(2763082..2764551) [1470 bp, 489 aa] ...    64   4e-10
KNAG0A03060 Chr1 complement(375640..377142) [1503 bp, 500 aa] {O...    64   4e-10
Smik_12.155 Chr12 (312480..315968) [3489 bp, 1162 aa] {ON} YLR09...    65   4e-10
TBLA0B03860 Chr2 (887855..890821) [2967 bp, 988 aa] {ON} Anc_8.6...    65   4e-10
Kwal_23.6325 s23 complement(1533223..1537851) [4629 bp, 1542 aa]...    65   4e-10
Smik_3.173 Chr3 complement(242285..246307) [4023 bp, 1340 aa] {O...    65   4e-10
AGR058W Chr7 (823626..826841) [3216 bp, 1071 aa] {ON} Syntenic h...    65   4e-10
KNAG0I02670 Chr9 complement(524008..526734) [2727 bp, 908 aa] {O...    65   4e-10
Skud_5.249 Chr5 complement(400867..404310) [3444 bp, 1147 aa] {O...    65   4e-10
CAGL0M03729g Chr13 complement(420316..422901) [2586 bp, 861 aa] ...    65   4e-10
NCAS0A06440 Chr1 (1270771..1273020) [2250 bp, 749 aa] {ON} Anc_4...    65   4e-10
Suva_10.180 Chr10 (337364..340843) [3480 bp, 1159 aa] {ON} YLR09...    65   4e-10
Suva_5.250 Chr5 (392904..396323) [3420 bp, 1139 aa] {ON} YER129W...    65   4e-10
KAFR0C04780 Chr3 (948771..951131) [2361 bp, 786 aa] {ON} Anc_6.3...    65   5e-10
KLLA0C03828g Chr3 (349187..351568) [2382 bp, 793 aa] {ON} simila...    65   5e-10
KLLA0B07579g Chr2 (659591..661759) [2169 bp, 722 aa] {ON} simila...    65   5e-10
Kwal_47.17252 s47 (318148..320766) [2619 bp, 872 aa] {ON} YGL180...    65   5e-10
ZYRO0D17468g Chr4 (1439376..1441958) [2583 bp, 860 aa] {ON} weak...    65   5e-10
KLLA0C04213g Chr3 (386815..387999) [1185 bp, 394 aa] {ON} simila...    64   5e-10
NDAI0A08560 Chr1 complement(1969778..1973731) [3954 bp, 1317 aa]...    65   5e-10
TDEL0A04780 Chr1 (842715..844580) [1866 bp, 621 aa] {ON} Anc_5.6...    64   5e-10
TDEL0D04450 Chr4 complement(811665..812924) [1260 bp, 419 aa] {O...    64   5e-10
Suva_16.97 Chr16 complement(165977..167083) [1107 bp, 368 aa] {O...    64   5e-10
TBLA0C03180 Chr3 complement(770462..775468) [5007 bp, 1668 aa] {...    65   6e-10
TPHA0G01730 Chr7 complement(355001..356779) [1779 bp, 592 aa] {O...    64   6e-10
ZYRO0F06798g Chr6 (558198..559676) [1479 bp, 492 aa] {ON} simila...    64   6e-10
KLLA0C18568g Chr3 (1639958..1642282) [2325 bp, 774 aa] {ON} simi...    64   6e-10
KLLA0D07348g Chr4 (626999..629728) [2730 bp, 909 aa] {ON} simila...    64   6e-10
KLLA0B03586g Chr2 complement(326871..329075) [2205 bp, 734 aa] {...    64   6e-10
KLLA0A03806g Chr1 complement(338807..340615) [1809 bp, 602 aa] {...    64   6e-10
Smik_14.360 Chr14 complement(638655..643406) [4752 bp, 1583 aa] ...    64   6e-10
SAKL0E03344g Chr5 (272024..273754) [1731 bp, 576 aa] {ON} simila...    64   7e-10
Ecym_7473 Chr7 (963826..966045) [2220 bp, 739 aa] {ON} similar t...    64   7e-10
TPHA0I00920 Chr9 (204753..209057) [4305 bp, 1434 aa] {ON} Anc_1....    64   7e-10
TDEL0E03300 Chr5 complement(621448..626409) [4962 bp, 1653 aa] {...    64   7e-10
NCAS0G01210 Chr7 complement(215860..216963) [1104 bp, 367 aa] {O...    63   7e-10
ADR300C Chr4 complement(1222344..1225016) [2673 bp, 890 aa] {ON}...    64   8e-10
KNAG0D02140 Chr4 complement(362745..365357) [2613 bp, 870 aa] {O...    64   8e-10
Suva_2.449 Chr2 complement(789612..794603) [4992 bp, 1663 aa] {O...    64   8e-10
KAFR0C00930 Chr3 complement(186877..189687) [2811 bp, 936 aa] {O...    64   8e-10
KNAG0K01240 Chr11 (243154..246096) [2943 bp, 980 aa] {ON} Anc_3....    64   9e-10
CAGL0H00979g Chr8 complement(94328..95527) [1200 bp, 399 aa] {ON...    63   9e-10
CAGL0C05005g Chr3 complement(467626..470856) [3231 bp, 1076 aa] ...    64   1e-09
ZYRO0G16632g Chr7 (1360854..1365827) [4974 bp, 1657 aa] {ON} hig...    64   1e-09
TPHA0M01840 Chr13 complement(380953..385818) [4866 bp, 1621 aa] ...    64   1e-09
Ecym_8004 Chr8 complement(5273..7957) [2685 bp, 894 aa] {ON} sim...    64   1e-09
Kpol_1000.14 s1000 complement(36018..38015) [1998 bp, 665 aa] {O...    63   1e-09
Ecym_6344 Chr6 complement(664647..668840) [4194 bp, 1397 aa] {ON...    64   1e-09
YOL016C Chr15 complement(294777..296120) [1344 bp, 447 aa] {ON} ...    63   1e-09
KLTH0A07458g Chr1 (620459..623080) [2622 bp, 873 aa] {ON} simila...    64   1e-09
TPHA0H00760 Chr8 complement(152442..155384) [2943 bp, 980 aa] {O...    64   1e-09
Ecym_3488 Chr3 complement(915087..916400) [1314 bp, 437 aa] {ON}...    63   1e-09
CAGL0K02167g Chr11 complement(192297..195785) [3489 bp, 1162 aa]...    64   1e-09
ADL389W Chr4 (27641..29776) [2136 bp, 711 aa] {ON} Syntenic homo...    63   1e-09
AFL090W Chr6 (274336..275376) [1041 bp, 346 aa] {ON} Syntenic ho...    62   1e-09
Kwal_23.6458 s23 (1592349..1594955) [2607 bp, 868 aa] {ON} YNR04...    63   1e-09
KNAG0H03140 Chr8 complement(589553..592363) [2811 bp, 936 aa] {O...    63   1e-09
TDEL0D02650 Chr4 complement(505536..506636) [1101 bp, 366 aa] {O...    62   1e-09
TPHA0L00500 Chr12 (83710..86589) [2880 bp, 959 aa] {ON} Anc_7.86...    63   1e-09
KNAG0G01240 Chr7 (277868..280597) [2730 bp, 909 aa] {ON} Anc_8.1...    63   1e-09
Ecym_5588 Chr5 complement(1205102..1206943) [1842 bp, 613 aa] {O...    63   1e-09
Kpol_1004.19 s1004 (36090..36101,36217..37689) [1485 bp, 494 aa]...    63   1e-09
ADL315C Chr4 complement(146096..147400) [1305 bp, 434 aa] {ON} S...    62   2e-09
ACR119W Chr3 (560761..563556) [2796 bp, 931 aa] {ON} Syntenic ho...    63   2e-09
NDAI0C04000 Chr3 (907842..912812) [4971 bp, 1656 aa] {ON} Anc_5....    63   2e-09
Suva_15.155 Chr15 complement(267680..269038) [1359 bp, 452 aa] {...    62   2e-09
Smik_6.136 Chr6 (219577..220686) [1110 bp, 369 aa] {ON} YGR052W ...    62   2e-09
TBLA0I02400 Chr9 complement(548975..554167) [5193 bp, 1730 aa] {...    63   2e-09
TPHA0J00630 Chr10 (139476..140600) [1125 bp, 374 aa] {ON} Anc_4....    62   2e-09
AEL115C Chr5 complement(405062..406222) [1161 bp, 386 aa] {ON} S...    62   2e-09
Ecym_2499 Chr2 complement(976395..981020) [4626 bp, 1541 aa] {ON...    63   2e-09
CAGL0F03311g Chr6 complement(327599..330736) [3138 bp, 1045 aa] ...    63   2e-09
Kpol_1069.13 s1069 complement(27223..28506) [1284 bp, 427 aa] {O...    62   2e-09
TDEL0F00930 Chr6 complement(160181..163573) [3393 bp, 1130 aa] {...    63   2e-09
Kpol_541.48 s541 (152877..153692,153695..156046) [3168 bp, 1055 ...    63   2e-09
CAGL0F04741g Chr6 (478256..479584) [1329 bp, 442 aa] {ON} simila...    62   2e-09
TDEL0A05980 Chr1 (1049221..1050771) [1551 bp, 516 aa] {ON} Anc_8...    62   2e-09
KAFR0B05410 Chr2 complement(1111152..1112771) [1620 bp, 539 aa] ...    62   2e-09
Kpol_183.1 s183 (158..2257) [2100 bp, 699 aa] {ON} (158..2257) [...    62   2e-09
TDEL0A04580 Chr1 (816247..818331) [2085 bp, 694 aa] {ON} Anc_5.5...    62   2e-09
YGR052W Chr7 (593596..594705) [1110 bp, 369 aa] {ON}  FMP48Putat...    61   2e-09
SAKL0G06952g Chr7 (570584..572383) [1800 bp, 599 aa] {ON} simila...    62   3e-09
Suva_15.46 Chr15 (81948..83909) [1962 bp, 653 aa] {ON} YOL113W (...    62   3e-09
TDEL0E01820 Chr5 complement(348423..349403) [981 bp, 326 aa] {ON...    61   3e-09
SAKL0G06402g Chr7 (535632..537986) [2355 bp, 784 aa] {ON} simila...    62   3e-09
TPHA0B01150 Chr2 complement(259998..262070) [2073 bp, 690 aa] {O...    62   3e-09
Smik_8.160 Chr8 complement(245207..248323) [3117 bp, 1038 aa] {O...    62   3e-09
TBLA0H01820 Chr8 (429920..433417) [3498 bp, 1165 aa] {ON} Anc_5....    62   3e-09
NDAI0E01310 Chr5 complement(260484..262094) [1611 bp, 536 aa] {O...    62   3e-09
YER129W Chr5 (417281..420709) [3429 bp, 1142 aa] {ON}  SAK1Upstr...    62   3e-09
KLLA0D07304g Chr4 (623352..624749) [1398 bp, 465 aa] {ON} some s...    61   3e-09
KNAG0A06750 Chr1 (1053919..1056294) [2376 bp, 791 aa] {ON} Anc_2...    62   3e-09
KNAG0C04310 Chr3 complement(842994..846503) [3510 bp, 1169 aa] {...    62   3e-09
AAR009W Chr1 (358947..360308) [1362 bp, 453 aa] {ON} Syntenic ho...    61   4e-09
Kwal_23.3590 s23 complement(353755..355254) [1500 bp, 499 aa] {O...    61   4e-09
TBLA0F00240 Chr6 complement(45510..49256) [3747 bp, 1248 aa] {ON...    62   4e-09
Kwal_27.12559 s27 (1273349..1274593) [1245 bp, 414 aa] {ON} YPR0...    61   4e-09
Smik_15.153 Chr15 complement(261920..263248) [1329 bp, 442 aa] {...    61   4e-09
AAL083W Chr1 (196774..201870) [5097 bp, 1698 aa] {ON} Syntenic h...    62   4e-09
SAKL0C05368g Chr3 complement(510576..511832) [1257 bp, 418 aa] {...    61   4e-09
Kpol_1028.40 s1028 (95617..100392) [4776 bp, 1591 aa] {ON} (9561...    62   4e-09
KAFR0J02620 Chr10 complement(502187..504265) [2079 bp, 692 aa] {...    62   4e-09
Smik_5.275 Chr5 (426176..429601) [3426 bp, 1141 aa] {ON} YER129W...    62   4e-09
NCAS0C01580 Chr3 (291554..292873) [1320 bp, 439 aa] {ON} Anc_8.652     61   4e-09
Kwal_33.13681 s33 complement(350547..352694) [2148 bp, 715 aa] {...    62   4e-09
TBLA0A02030 Chr1 complement(491365..492576) [1212 bp, 403 aa] {O...    61   4e-09
Kpol_1037.6 s1037 (12601..15534) [2934 bp, 977 aa] {ON} (12601.....    62   4e-09
Suva_15.275 Chr15 complement(470782..473862) [3081 bp, 1026 aa] ...    62   5e-09
KNAG0H00560 Chr8 (89502..91268) [1767 bp, 588 aa] {ON} Anc_2.597...    61   5e-09
Kpol_1028.16 s1028 complement(45186..47825) [2640 bp, 879 aa] {O...    62   5e-09
KLTH0G06468g Chr7 complement(513119..518251) [5133 bp, 1710 aa] ...    62   5e-09
KLTH0G05698g Chr7 (453530..455323) [1794 bp, 597 aa] {ON} simila...    61   5e-09
TDEL0E02510 Chr5 (486415..489156) [2742 bp, 913 aa] {ON} Anc_5.3...    61   5e-09
Smik_11.62 Chr11 complement(120153..121346) [1194 bp, 397 aa] {O...    60   5e-09
Ecym_4647 Chr4 (1261859..1263511) [1653 bp, 550 aa] {ON} similar...    61   5e-09
Skud_11.58 Chr11 complement(120855..122042) [1188 bp, 395 aa] {O...    60   5e-09
TPHA0M02080 Chr13 (426966..429635) [2670 bp, 889 aa] {ON} Anc_6....    61   5e-09
YJL164C Chr10 complement(109966..111159) [1194 bp, 397 aa] {ON} ...    60   6e-09
NDAI0B00210 Chr2 (27983..29185) [1203 bp, 400 aa] {ON} Anc_1.182       60   6e-09
Ecym_7414 Chr7 (848665..850440) [1776 bp, 591 aa] {ON} similar t...    61   6e-09
Skud_15.432 Chr15 complement(761490..763601) [2112 bp, 703 aa] {...    61   6e-09
Smik_7.319 Chr7 complement(534132..535472) [1341 bp, 446 aa] {ON...    60   6e-09
Kwal_0.96 s0 complement(46082..47365) [1284 bp, 427 aa] {ON} YOL...    60   6e-09
NCAS0I02840 Chr9 (528136..529344) [1209 bp, 402 aa] {ON} Anc_1.2...    60   6e-09
NCAS0B01450 Chr2 (237824..239341) [1518 bp, 505 aa] {ON} Anc_8.652     60   6e-09
Kpol_1033.63 s1033 complement(158652..160205) [1554 bp, 517 aa] ...    60   6e-09
KLLA0E01585g Chr5 (149305..149370,149488..150960) [1539 bp, 512 ...    60   6e-09
Ecym_8095 Chr8 (205952..207106) [1155 bp, 384 aa] {ON} similar t...    60   7e-09
ZYRO0A05214g Chr1 complement(418443..421268) [2826 bp, 941 aa] {...    61   7e-09
NCAS0A12350 Chr1 complement(2446237..2447236,2447319..2448559) [...    61   7e-09
TPHA0D01770 Chr4 (365255..370279) [5025 bp, 1674 aa] {ON} Anc_5....    61   7e-09
Skud_10.50 Chr10 complement(84697..85890) [1194 bp, 397 aa] {ON}...    60   7e-09
SAKL0A00484g Chr1 complement(57938..60544) [2607 bp, 868 aa] {ON...    61   7e-09
TPHA0B03130 Chr2 complement(719624..721372) [1749 bp, 582 aa] {O...    60   7e-09
Kwal_26.7682 s26 complement(470565..472121) [1557 bp, 518 aa] {O...    60   7e-09
Kwal_47.18233 s47 complement(743846..745642) [1797 bp, 598 aa] {...    60   7e-09
KLTH0E03652g Chr5 (330227..332671) [2445 bp, 814 aa] {ON} simila...    61   8e-09
SAKL0C07744g Chr3 (720519..721799) [1281 bp, 426 aa] {ON} simila...    60   8e-09
NDAI0A05280 Chr1 complement(1191032..1192342) [1311 bp, 436 aa] ...    60   8e-09
Kwal_56.24584 s56 complement(1063271..1064578) [1308 bp, 435 aa]...    60   9e-09
SAKL0H07128g Chr8 complement(623681..625141) [1461 bp, 486 aa] {...    60   9e-09
CAGL0M08404g Chr13 complement(836791..838179) [1389 bp, 462 aa] ...    60   1e-08
Suva_11.56 Chr11 complement(119479..120675) [1197 bp, 398 aa] {O...    60   1e-08
KAFR0F03900 Chr6 (763094..764203) [1110 bp, 369 aa] {ON} Anc_4.1...    60   1e-08
Skud_16.76 Chr16 (139571..140719) [1149 bp, 382 aa] {ON} YPL203W...    60   1e-08
TBLA0D05010 Chr4 complement(1234934..1236238) [1305 bp, 434 aa] ...    60   1e-08
KLTH0H01584g Chr8 (143065..144453) [1389 bp, 462 aa] {ON} simila...    60   1e-08
TBLA0F02350 Chr6 complement(578797..580467) [1671 bp, 556 aa] {O...    60   1e-08
Kpol_1032.10 s1032 (24479..26854) [2376 bp, 791 aa] {ON} (24479....    60   1e-08
TDEL0C03710 Chr3 (653934..655169) [1236 bp, 411 aa] {ON} Anc_1.1...    60   1e-08
Suva_4.535 Chr4 (921278..922861) [1584 bp, 527 aa] {ON} YBR274W ...    60   1e-08
CAGL0L06006g Chr12 complement(672704..675532) [2829 bp, 942 aa] ...    60   1e-08
KNAG0C03830 Chr3 (751393..752877) [1485 bp, 494 aa] {ON} Anc_7.3...    60   1e-08
Smik_10.66 Chr10 complement(108043..109236) [1194 bp, 397 aa] {O...    59   1e-08
KLLA0C17160g Chr3 (1498959..1501454) [2496 bp, 831 aa] {ON} simi...    60   1e-08
KAFR0G00480 Chr7 complement(131066..132268) [1203 bp, 400 aa] {O...    59   1e-08
KAFR0B02140 Chr2 (417972..420662) [2691 bp, 896 aa] {ON} Anc_8.1...    60   1e-08
YKL166C Chr11 complement(134509..135705) [1197 bp, 398 aa] {ON} ...    59   1e-08
KLLA0C03938g Chr3 complement(358851..360632) [1782 bp, 593 aa] {...    60   1e-08
AFR150C Chr6 complement(707303..708352) [1050 bp, 349 aa] {ON} S...    59   1e-08
YOR267C Chr15 complement(822588..824867) [2280 bp, 759 aa] {ON} ...    60   1e-08
YOR231W Chr15 (772601..774127) [1527 bp, 508 aa] {ON}  MKK1Mitog...    60   1e-08
TPHA0H01500 Chr8 complement(336652..339639) [2988 bp, 995 aa] {O...    60   1e-08
Kpol_530.41 s530 (94710..96326) [1617 bp, 538 aa] {ON} (94710..9...    60   1e-08
Ecym_6136 Chr6 complement(248721..250187) [1467 bp, 488 aa] {ON}...    60   1e-08
Smik_6.408 Chr6 complement(657018..658163) [1146 bp, 381 aa] {ON...    59   1e-08
KAFR0I02010 Chr9 complement(411589..412887) [1299 bp, 432 aa] {O...    59   1e-08
ZYRO0A05192g Chr1 complement(416951..418198) [1248 bp, 415 aa] {...    59   1e-08
Suva_8.316 Chr8 complement(561812..563914) [2103 bp, 700 aa] {ON...    60   1e-08
KLTH0E16126g Chr5 complement(1427208..1429814) [2607 bp, 868 aa]...    60   2e-08
SAKL0G10384g Chr7 complement(883824..888848) [5025 bp, 1674 aa] ...    60   2e-08
ZYRO0C12078g Chr3 (946320..948647) [2328 bp, 775 aa] {ON} simila...    60   2e-08
Suva_6.78 Chr6 (135988..137325) [1338 bp, 445 aa] {ON} YFR014C (...    59   2e-08
Smik_15.449 Chr15 complement(772245..774437) [2193 bp, 730 aa] {...    60   2e-08
YHR082C Chr8 complement(268459..271548) [3090 bp, 1029 aa] {ON} ...    60   2e-08
KLTH0E15004g Chr5 (1328930..1330165) [1236 bp, 411 aa] {ON} simi...    59   2e-08
NCAS0D00630 Chr4 complement(107310..108593) [1284 bp, 427 aa] {O...    59   2e-08
KLTH0F04840g Chr6 complement(427194..428339) [1146 bp, 381 aa] {...    59   2e-08
Kpol_1037.7 s1037 (15938..17182) [1245 bp, 414 aa] {ON} (15938.....    59   2e-08
SAKL0D07656g Chr4 complement(627469..628767) [1299 bp, 432 aa] {...    59   2e-08
TDEL0A06610 Chr1 complement(1151052..1152824) [1773 bp, 590 aa] ...    59   2e-08
Skud_2.4 Chr2 complement(4805..8260) [3456 bp, 1151 aa] {ON} YBL...    60   2e-08
SAKL0G08250g Chr7 (703212..705707) [2496 bp, 831 aa] {ON} simila...    59   2e-08
CAGL0J03828g Chr10 (365325..366728) [1404 bp, 467 aa] {ON} simil...    59   2e-08
NDAI0A00960 Chr1 complement(197205..198431) [1227 bp, 408 aa] {O...    59   2e-08
ACR196C Chr3 complement(692321..693913) [1593 bp, 530 aa] {ON} S...    59   2e-08
YPL203W Chr16 (166256..167398) [1143 bp, 380 aa] {ON}  TPK2cAMP-...    59   2e-08
YJL187C Chr10 complement(76803..79262) [2460 bp, 819 aa] {ON}  S...    59   2e-08
AFR377C Chr6 complement(1116589..1118769) [2181 bp, 726 aa] {ON}...    59   2e-08
TPHA0M01500 Chr13 (317999..319291) [1293 bp, 430 aa] {ON} Anc_3....    59   2e-08
Kwal_55.20189 s55 (288918..291356) [2439 bp, 812 aa] {ON} YHR082...    59   2e-08
YKL116C Chr11 complement(221344..222900) [1557 bp, 518 aa] {ON} ...    59   2e-08
NDAI0G03030 Chr7 (704910..708269) [3360 bp, 1119 aa] {ON}              59   2e-08
ZYRO0G02816g Chr7 complement(213421..214980) [1560 bp, 519 aa] {...    59   2e-08
NDAI0D04050 Chr4 (952438..953538) [1101 bp, 366 aa] {ON} Anc_4.184     58   2e-08
Kwal_23.5668 s23 (1263868..1268937) [5070 bp, 1689 aa] {ON} YDR2...    59   2e-08
KNAG0G01250 Chr7 complement(280791..283364) [2574 bp, 857 aa] {O...    59   3e-08
Kwal_27.9763 s27 (54483..57089) [2607 bp, 868 aa] {ON} YAR019C (...    59   3e-08
TPHA0G01450 Chr7 (297855..299861) [2007 bp, 668 aa] {ON}               59   3e-08
CAGL0M10829g Chr13 complement(1076233..1081236) [5004 bp, 1667 a...    59   3e-08
NDAI0G03470 Chr7 complement(829975..832455) [2481 bp, 826 aa] {O...    59   3e-08
TDEL0D04460 Chr4 complement(813075..815816) [2742 bp, 913 aa] {O...    59   3e-08
KLTH0D05082g Chr4 complement(457124..458680) [1557 bp, 518 aa] {...    59   3e-08
NDAI0F01650 Chr6 (403635..404738) [1104 bp, 367 aa] {ON} Anc_6.214     58   3e-08
Ecym_5252 Chr5 (525687..526976) [1290 bp, 429 aa] {ON} similar t...    58   3e-08
NCAS0B08280 Chr2 (1579804..1581033) [1230 bp, 409 aa] {ON} Anc_1...    58   3e-08
Skud_6.89 Chr6 (166257..167594) [1338 bp, 446 aa] {ON} YFR014C (...    58   3e-08
KLTH0H04180g Chr8 (381111..382172) [1062 bp, 353 aa] {ON} highly...    58   3e-08
Suva_6.268 Chr6 (470348..472519) [2172 bp, 723 aa] {ON} YJL187C ...    59   3e-08
Suva_4.221 Chr4 complement(391492..393789) [2298 bp, 765 aa] {ON...    59   3e-08
ZYRO0F11418g Chr6 complement(936573..938117) [1545 bp, 514 aa] {...    59   3e-08
KLLA0A02497g Chr1 (218592..219680) [1089 bp, 362 aa] {ON} highly...    58   3e-08
TBLA0A08430 Chr1 complement(2075682..2076773) [1092 bp, 363 aa] ...    58   3e-08
KAFR0K02450 Chr11 (504087..504131,504190..505680) [1536 bp, 511 ...    58   3e-08
CAGL0H01199g Chr8 (110610..115556) [4947 bp, 1648 aa] {ON} highl...    59   3e-08
KAFR0B00920 Chr2 (170792..172300) [1509 bp, 502 aa] {ON} Anc_7.3...    58   4e-08
TBLA0D02730 Chr4 complement(674994..676427) [1434 bp, 477 aa] {O...    58   4e-08
CAGL0K10604g Chr11 complement(1030055..1031395) [1341 bp, 446 aa...    58   4e-08
SAKL0B01210g Chr2 complement(109892..114658) [4767 bp, 1588 aa] ...    59   4e-08
TBLA0C05830 Chr3 complement(1408930..1410210) [1281 bp, 426 aa] ...    58   4e-08
Skud_4.223 Chr4 complement(395836..398145) [2310 bp, 769 aa] {ON...    59   4e-08
KLTH0F06578g Chr6 complement(568519..570309) [1791 bp, 596 aa] {...    58   4e-08
Suva_6.245 Chr6 (438131..439315) [1185 bp, 394 aa] {ON} YJL164C ...    58   4e-08
SAKL0B04488g Chr2 (395136..396242) [1107 bp, 368 aa] {ON} highly...    57   4e-08
SAKL0H05588g Chr8 (502752..504602) [1851 bp, 616 aa] {ON} simila...    58   4e-08
SAKL0H24750g Chr8 complement(2152673..2155420) [2748 bp, 915 aa]...    59   4e-08
KLLA0B11946g Chr2 complement(1048033..1049352) [1320 bp, 439 aa]...    58   4e-08
Suva_8.282 Chr8 (511665..513185) [1521 bp, 506 aa] {ON} YOR231W ...    58   4e-08
TPHA0O01400 Chr15 complement(277678..279258) [1581 bp, 526 aa] {...    58   4e-08
SAKL0B07304g Chr2 (625541..627007) [1467 bp, 488 aa] {ON} simila...    58   4e-08
SAKL0D06534g Chr4 complement(538606..540091,540155..540237) [156...    58   4e-08
Ecym_6145 Chr6 complement(266766..267863) [1098 bp, 365 aa] {ON}...    57   4e-08
Kwal_33.13846 s33 complement(419630..420757) [1128 bp, 375 aa] {...    57   4e-08
SAKL0C07458g Chr3 complement(687452..689395) [1944 bp, 647 aa] {...    58   4e-08
Smik_4.207 Chr4 complement(381159..383456) [2298 bp, 765 aa] {ON...    58   5e-08
Skud_8.143 Chr8 complement(242422..245535) [3114 bp, 1037 aa] {O...    58   5e-08
KLTH0D12166g Chr4 complement(987310..989061) [1752 bp, 583 aa] {...    58   5e-08
KLTH0F09988g Chr6 complement(868693..869931) [1239 bp, 412 aa] {...    57   5e-08
CAGL0C02893g Chr3 complement(286017..287966) [1950 bp, 649 aa] {...    58   5e-08
SAKL0C07348g Chr3 (677348..679933) [2586 bp, 861 aa] {ON} some s...    58   5e-08
KLTH0C02662g Chr3 complement(240347..242674) [2328 bp, 775 aa] {...    58   5e-08
TBLA0G01910 Chr7 complement(500551..502596) [2046 bp, 681 aa] {O...    58   5e-08
NDAI0D04110 Chr4 (966439..967560) [1122 bp, 373 aa] {ON} Anc_4.192     57   5e-08
TBLA0I00910 Chr9 complement(170526..173945) [3420 bp, 1139 aa] {...    58   5e-08
ZYRO0G19074g Chr7 complement(1580648..1583413) [2766 bp, 921 aa]...    58   5e-08
ZYRO0F13310g Chr6 (1092612..1096322) [3711 bp, 1236 aa] {ON} som...    58   5e-08
Kpol_1033.50 s1033 complement(126043..127197) [1155 bp, 384 aa] ...    57   5e-08
Ecym_2203 Chr2 (401590..402648) [1059 bp, 352 aa] {ON} similar t...    57   6e-08
Ecym_6307 Chr6 (578677..580227) [1551 bp, 516 aa] {ON} similar t...    58   6e-08
TBLA0E02790 Chr5 complement(693136..695562) [2427 bp, 808 aa] {O...    58   6e-08
ABL055C Chr2 complement(295495..297105) [1611 bp, 536 aa] {ON} S...    57   6e-08
TDEL0G02820 Chr7 complement(543911..545377,545450..545476) [1494...    57   6e-08
AFL188C Chr6 complement(88793..90211) [1419 bp, 472 aa] {ON} Syn...    57   6e-08
KNAG0K01250 Chr11 (246241..247467) [1227 bp, 408 aa] {ON} Anc_3....    57   6e-08
TBLA0B03590 Chr2 (834488..837022) [2535 bp, 844 aa] {ON} Anc_8.7...    58   6e-08
Skud_15.397 Chr15 (711559..713082) [1524 bp, 507 aa] {ON} YOR231...    57   6e-08
NCAS0H01780 Chr8 complement(341549..344773) [3225 bp, 1074 aa] {...    58   6e-08
TBLA0D02240 Chr4 complement(561856..566547) [4692 bp, 1563 aa] {...    58   6e-08
KNAG0H00790 Chr8 complement(124926..126131) [1206 bp, 401 aa] {O...    57   6e-08
TDEL0F02980 Chr6 (539327..541549) [2223 bp, 740 aa] {ON} Anc_1.1...    58   7e-08
Smik_2.13 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...    58   7e-08
Smik_2.14 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...    58   7e-08
CAGL0F03245g Chr6 complement(316924..320034) [3111 bp, 1036 aa] ...    58   7e-08
NDAI0C01850 Chr3 (407978..411712) [3735 bp, 1244 aa] {ON}              58   7e-08
Smik_15.415 Chr15 (722292..723815) [1524 bp, 507 aa] {ON} YOR231...    57   7e-08
TPHA0E02840 Chr5 (594381..595589) [1209 bp, 402 aa] {ON} Anc_6.2...    57   7e-08
KAFR0F01800 Chr6 complement(350480..351754) [1275 bp, 424 aa] {O...    57   7e-08
Kpol_1018.54 s1018 (163688..166192) [2505 bp, 834 aa] {ON} (1636...    58   7e-08
Suva_16.104 Chr16 (176201..177352) [1152 bp, 383 aa] {ON} YPL203...    57   7e-08
ACR191C Chr3 complement(680398..683847) [3450 bp, 1149 aa] {ON} ...    58   7e-08
TPHA0H02390 Chr8 (561244..563436) [2193 bp, 730 aa] {ON} Anc_6.3...    57   8e-08
YDL214C Chr4 complement(74446..76545) [2100 bp, 699 aa] {ON}  PR...    57   8e-08
NCAS0C01110 Chr3 (207664..209664) [2001 bp, 666 aa] {ON} Anc_8.716     57   8e-08
YFR014C Chr6 complement(172537..173877) [1341 bp, 446 aa] {ON}  ...    57   8e-08
TBLA0J01200 Chr10 (271800..275420) [3621 bp, 1206 aa] {ON} Anc_1...    58   8e-08
YBL105C Chr2 complement(14241..17696) [3456 bp, 1151 aa] {ON}  P...    58   8e-08
ZYRO0G18502g Chr7 (1528075..1529265) [1191 bp, 396 aa] {ON} simi...    57   8e-08
NDAI0H03520 Chr8 (860096..861472) [1377 bp, 458 aa] {ON}               57   8e-08
TPHA0C04570 Chr3 (985491..987071) [1581 bp, 526 aa] {ON} Anc_2.3...    57   9e-08
SAKL0A04466g Chr1 (413816..414937) [1122 bp, 373 aa] {ON} highly...    57   9e-08
KNAG0A05670 Chr1 complement(847460..849016) [1557 bp, 518 aa] {O...    57   9e-08
KLTH0E06776g Chr5 complement(622147..625575) [3429 bp, 1142 aa] ...    57   1e-07
Kwal_33.14192 s33 complement(563582..565315) [1734 bp, 577 aa] {...    57   1e-07
Smik_13.507 Chr13 (835298..837058) [1761 bp, 586 aa] {ON} YMR291...    57   1e-07
Skud_15.144 Chr15 complement(254620..255969) [1350 bp, 449 aa] {...    57   1e-07
Smik_2.417 Chr2 (735214..736797) [1584 bp, 527 aa] {ON} YBR274W ...    57   1e-07
Kwal_33.14081 s33 complement(519343..521085) [1743 bp, 580 aa] {...    57   1e-07
KLLA0D03190g Chr4 (267933..269051) [1119 bp, 372 aa] {ON} highly...    56   1e-07
Suva_2.11 Chr2 complement(17473..18858) [1386 bp, 461 aa] {ON} Y...    57   1e-07
KAFR0D03100 Chr4 complement(610106..611635) [1530 bp, 509 aa] {O...    57   1e-07
NCAS0A01100 Chr1 (218400..219464) [1065 bp, 354 aa] {ON}               56   1e-07
NCAS0B04580 Chr2 (831695..835255) [3561 bp, 1186 aa] {ON} Anc_8....    57   1e-07
TPHA0B03850 Chr2 (909219..910841) [1623 bp, 540 aa] {ON} Anc_1.4...    57   1e-07
Ecym_8129 Chr8 (269437..271626) [2190 bp, 729 aa] {ON} similar t...    57   1e-07
SAKL0E05984g Chr5 complement(485895..487391,487462..487482) [151...    57   1e-07
KAFR0C00920 Chr3 complement(185475..186674) [1200 bp, 399 aa] {O...    56   1e-07
CAGL0K01661g Chr11 complement(147781..149229) [1449 bp, 482 aa] ...    57   1e-07
AEL149C Chr5 complement(348350..350533) [2184 bp, 727 aa] {ON} S...    57   1e-07
NCAS0A11020 Chr1 (2193556..2194869) [1314 bp, 437 aa] {ON} Anc_3...    56   1e-07
SAKL0F13618g Chr6 (1085967..1089494) [3528 bp, 1175 aa] {ON} sim...    57   1e-07
KNAG0K01740 Chr11 (364195..366492) [2298 bp, 765 aa] {ON} Anc_3....    57   1e-07
KLLA0F23155g Chr6 (2157146..2158429) [1284 bp, 427 aa] {ON} simi...    56   1e-07
TBLA0C05800 Chr3 complement(1402262..1405207) [2946 bp, 981 aa] ...    57   1e-07
CAGL0K04301g Chr11 (405248..406315) [1068 bp, 355 aa] {ON} simil...    56   1e-07
NCAS0B08300 Chr2 (1582859..1584796) [1938 bp, 645 aa] {ON} Anc_1...    57   1e-07
ZYRO0C15862g Chr3 (1239992..1241305) [1314 bp, 437 aa] {ON} simi...    56   1e-07
Kpol_2002.75 s2002 complement(168123..169394) [1272 bp, 423 aa] ...    56   1e-07
Skud_10.30 Chr10 complement(51698..54124) [2427 bp, 808 aa] {ON}...    57   1e-07
NCAS0E01560 Chr5 (294095..295345) [1251 bp, 416 aa] {ON}               56   1e-07
KLLA0C14278g Chr3 (1240990..1242615) [1626 bp, 541 aa] {ON} simi...    57   1e-07
ZYRO0A07546g Chr1 complement(619278..620747,620833..620847) [148...    56   1e-07
Kwal_27.10581 s27 complement(403249..406713) [3465 bp, 1154 aa] ...    57   1e-07
Suva_10.464 Chr10 (809505..811721) [2217 bp, 738 aa] {ON} YLR362...    57   1e-07
TDEL0C03050 Chr3 (545862..549299) [3438 bp, 1145 aa] {ON} Anc_7....    57   1e-07
Kwal_56.24059 s56 complement(829673..830734) [1062 bp, 353 aa] {...    55   2e-07
Smik_10.45 Chr10 complement(74813..77278) [2466 bp, 821 aa] {ON}...    56   2e-07
Skud_11.113 Chr11 complement(207796..209355) [1560 bp, 519 aa] {...    56   2e-07
KAFR0C03020 Chr3 complement(601565..603121) [1557 bp, 518 aa] {O...    56   2e-07
TPHA0D03940 Chr4 (825250..826989) [1740 bp, 579 aa] {ON} Anc_3.4...    56   2e-07
Kwal_14.1416 s14 (315842..316939) [1098 bp, 365 aa] {ON} YGR040W...    55   2e-07
Kwal_26.8941 s26 complement(1014543..1016528) [1986 bp, 661 aa] ...    56   2e-07
CAGL0I04422g Chr9 (394159..395427) [1269 bp, 422 aa] {ON} some s...    56   2e-07
KAFR0G01080 Chr7 complement(243965..247417) [3453 bp, 1150 aa] {...    56   2e-07
TPHA0B00240 Chr2 complement(44468..46525) [2058 bp, 685 aa] {ON}...    56   2e-07
Kpol_541.49 s541 complement(156530..159514) [2985 bp, 994 aa] {O...    56   2e-07
NDAI0E04610 Chr5 (1042690..1046154) [3465 bp, 1154 aa] {ON} Anc_...    56   2e-07
NCAS0E03010 Chr5 (599358..602810) [3453 bp, 1150 aa] {ON} Anc_7....    56   2e-07
CAGL0F03707g Chr6 complement(359839..361665) [1827 bp, 608 aa] {...    56   2e-07
Kpol_1018.137 s1018 complement(366178..367914) [1737 bp, 578 aa]...    56   2e-07
KNAG0D01140 Chr4 (192308..193495) [1188 bp, 395 aa] {ON}               55   2e-07
CAGL0G09020g Chr7 (860266..861351) [1086 bp, 361 aa] {ON} highly...    55   2e-07
TPHA0M00300 Chr13 (59377..61701) [2325 bp, 774 aa] {ON} Anc_3.16...    56   2e-07
KLLA0B07205g Chr2 complement(624606..625973) [1368 bp, 455 aa] {...    55   2e-07
ZYRO0F03014g Chr6 complement(255189..260003) [4815 bp, 1604 aa] ...    56   2e-07
NCAS0D00710 Chr4 (122875..124737) [1863 bp, 620 aa] {ON}               56   2e-07
Smik_11.125 Chr11 complement(208208..209764) [1557 bp, 518 aa] {...    55   2e-07
Ecym_5241 Chr5 complement(495748..497586) [1839 bp, 612 aa] {ON}...    56   2e-07
Kpol_1002.111 s1002 (277615..278664) [1050 bp, 349 aa] {ON} (277...    55   3e-07
KNAG0C02440 Chr3 complement(475652..476857) [1206 bp, 401 aa] {O...    55   3e-07
KNAG0C01060 Chr3 complement(205965..207374) [1410 bp, 469 aa] {O...    55   3e-07
NDAI0A06630 Chr1 complement(1514165..1515943) [1779 bp, 592 aa] ...    55   3e-07
Skud_11.181 Chr11 complement(326935..328845) [1911 bp, 636 aa] {...    55   3e-07
KLLA0F01276g Chr6 complement(120001..121560) [1560 bp, 519 aa] {...    55   3e-07
Kpol_499.3 s499 complement(6075..7199) [1125 bp, 374 aa] {ON} co...    55   3e-07
TBLA0A06670 Chr1 complement(1630701..1632023) [1323 bp, 440 aa] ...    55   3e-07
ACL054W Chr3 (269703..272621) [2919 bp, 972 aa] {ON} Syntenic ho...    55   3e-07
ADR058C Chr4 complement(810939..811826) [888 bp, 295 aa] {ON} Sy...    54   3e-07
Suva_7.334 Chr7 (568847..569956) [1110 bp, 369 aa] {ON} YGR052W ...    55   3e-07
ZYRO0C13156g Chr3 complement(1041022..1042068) [1047 bp, 348 aa]...    55   3e-07
YBR274W Chr2 (749594..751177) [1584 bp, 527 aa] {ON}  CHK1Serine...    55   3e-07
Suva_11.108 Chr11 complement(207520..209070) [1551 bp, 516 aa] {...    55   3e-07
TBLA0C00720 Chr3 (149299..151149) [1851 bp, 616 aa] {ON} Anc_1.4...    55   3e-07
TPHA0E03300 Chr5 (703575..704912) [1338 bp, 445 aa] {ON} Anc_1.1...    55   3e-07
KLTH0C05478g Chr3 complement(471760..475254) [3495 bp, 1164 aa] ...    55   4e-07
TDEL0E05220 Chr5 complement(957515..958597) [1083 bp, 360 aa] {O...    55   4e-07
NDAI0B02900 Chr2 complement(737651..738709) [1059 bp, 352 aa] {O...    55   4e-07
TPHA0O01120 Chr15 complement(217462..218751) [1290 bp, 429 aa] {...    55   4e-07
CAGL0K00693g Chr11 complement(75466..78096) [2631 bp, 876 aa] {O...    55   4e-07
ZYRO0G08844g Chr7 complement(711678..712766) [1089 bp, 362 aa] {...    54   4e-07
KNAG0F03410 Chr6 (640115..645094) [4980 bp, 1659 aa] {ON}              55   4e-07
Smik_3.94 Chr3 (128344..130155) [1812 bp, 603 aa] {ON} YCR008W (...    55   4e-07
Suva_4.33 Chr4 complement(63334..65427) [2094 bp, 697 aa] {ON} Y...    55   4e-07
YLR362W Chr12 (849866..852019) [2154 bp, 717 aa] {ON}  STE11Sign...    55   4e-07
TDEL0D04600 Chr4 (843530..845917) [2388 bp, 795 aa] {ON} Anc_3.1...    55   4e-07
SAKL0B05082g Chr2 (436707..438896) [2190 bp, 729 aa] {ON} simila...    55   4e-07
CAGL0M09361g Chr13 complement(928484..931918) [3435 bp, 1144 aa]...    55   4e-07
Ecym_8399 Chr8 (821221..824766) [3546 bp, 1181 aa] {ON} similar ...    55   4e-07
TPHA0B01520 Chr2 complement(336164..339616) [3453 bp, 1150 aa] {...    55   4e-07
KNAG0G02780 Chr7 complement(615058..617202) [2145 bp, 714 aa] {O...    55   5e-07
SAKL0H24706g Chr8 (2145552..2149100) [3549 bp, 1182 aa] {ON} sim...    55   5e-07
Ecym_8400 Chr8 complement(825315..828515) [3201 bp, 1066 aa] {ON...    55   5e-07
TDEL0A02330 Chr1 complement(420205..421662) [1458 bp, 485 aa] {O...    55   5e-07
Kpol_376.5 s376 (6334..7767) [1434 bp, 477 aa] {ON} (6334..7767)...    55   5e-07
KNAG0D03980 Chr4 (721049..722170) [1122 bp, 373 aa] {ON} Anc_4.1...    54   5e-07
Skud_2.406 Chr2 (718522..720105) [1584 bp, 527 aa] {ON} YBR274W ...    55   5e-07
KNAG0B05880 Chr2 (1155395..1157695) [2301 bp, 766 aa] {ON} Anc_4...    55   5e-07
Suva_7.325 Chr7 (550760..551866) [1107 bp, 368 aa] {ON} YGR040W ...    54   5e-07
NDAI0E00960 Chr5 (195116..197251) [2136 bp, 711 aa] {ON} Anc_8.716     55   5e-07
TBLA0F00820 Chr6 (209607..211844) [2238 bp, 745 aa] {ON} Anc_3.1...    55   5e-07
TBLA0G03450 Chr7 (913497..919415) [5919 bp, 1972 aa] {ON} Anc_8....    55   5e-07
Ecym_4523 Chr4 (1039929..1042070) [2142 bp, 713 aa] {ON} similar...    55   5e-07
Smik_12.450 Chr12 (788896..791106) [2211 bp, 736 aa] {ON} YLR362...    55   6e-07
Kpol_1055.25 s1055 complement(62930..67933) [5004 bp, 1667 aa] {...    55   6e-07
TBLA0C01320 Chr3 complement(289223..290626) [1404 bp, 467 aa] {O...    54   6e-07
KNAG0B04460 Chr2 (856495..859461) [2967 bp, 988 aa] {ON} Anc_5.3...    55   6e-07
Kpol_365.3 s365 complement(2204..4177,4180..4206,4209..4874) [26...    55   6e-07
KLLA0D08415g Chr4 (714473..716797) [2325 bp, 774 aa] {ON} simila...    55   6e-07
Kpol_520.17 s520 complement(37953..41447) [3495 bp, 1164 aa] {ON...    55   6e-07
KNAG0E03200 Chr5 complement(641437..646020) [4584 bp, 1527 aa] {...    55   6e-07
KLLA0C16577g Chr3 complement(1451181..1452695) [1515 bp, 504 aa]...    54   6e-07
NDAI0G05300 Chr7 (1289208..1290521) [1314 bp, 437 aa] {ON} Anc_1...    54   7e-07
KLLA0E15313g Chr5 (1362851..1365025) [2175 bp, 724 aa] {ON} simi...    54   7e-07
TDEL0B04700 Chr2 (834336..836996) [2661 bp, 886 aa] {ON} Anc_8.1...    54   7e-07
KAFR0D04800 Chr4 complement(942369..944690) [2322 bp, 773 aa] {O...    54   7e-07
YDL028C Chr4 complement(400997..403291) [2295 bp, 764 aa] {ON}  ...    54   7e-07
Kwal_55.20326 s55 complement(351010..353262) [2253 bp, 750 aa] {...    54   7e-07
NDAI0B02500 Chr2 (625206..629036) [3831 bp, 1276 aa] {ON} Anc_8....    55   7e-07
CAGL0B02739g Chr2 complement(262590..264620) [2031 bp, 676 aa] {...    54   7e-07
NCAS0A11530 Chr1 (2281835..2283223) [1389 bp, 462 aa] {ON} Anc_3...    54   7e-07
YMR104C Chr13 complement(473420..475453) [2034 bp, 677 aa] {ON} ...    54   7e-07
Suva_11.99 Chr11 (192143..194197) [2055 bp, 684 aa] {ON} YMR104C...    54   7e-07
KAFR0K00330 Chr11 (74162..75283) [1122 bp, 373 aa] {ON} Anc_6.21...    54   8e-07
ABL028W Chr2 (345953..348121) [2169 bp, 722 aa] {ON} Syntenic ho...    54   8e-07
TBLA0G00820 Chr7 complement(191559..192833) [1275 bp, 424 aa] {O...    54   8e-07
YJL128C Chr10 complement(178097..180103) [2007 bp, 668 aa] {ON} ...    54   8e-07
TPHA0D00360 Chr4 complement(55596..60206) [4611 bp, 1536 aa] {ON...    54   8e-07
CAGL0K11550g Chr11 (1118971..1120587) [1617 bp, 538 aa] {ON} sim...    54   9e-07
NDAI0J01990 Chr10 (491491..493758) [2268 bp, 755 aa] {ON} Anc_4....    54   9e-07
ZYRO0F01034g Chr6 (80328..82826) [2499 bp, 832 aa] {ON} similar ...    54   9e-07
Kpol_1031.76 s1031 (193193..194923) [1731 bp, 576 aa] {ON} (1931...    54   9e-07
Ecym_5624 Chr5 (1256658..1258022) [1365 bp, 454 aa] {ON} similar...    54   9e-07
TPHA0L01470 Chr12 (303604..304497) [894 bp, 297 aa] {ON} Anc_8.5...    53   9e-07
YCR008W Chr3 (128470..130281) [1812 bp, 603 aa] {ON}  SAT4Ser/Th...    54   9e-07
Skud_3.73 Chr3 (110742..112556) [1815 bp, 604 aa] {ON} YCR008W (...    54   9e-07
KAFR0H01040 Chr8 complement(189604..190860) [1257 bp, 418 aa] {O...    54   9e-07
Smik_10.106 Chr10 complement(175752..177776) [2025 bp, 674 aa] {...    54   1e-06
Kpol_1072.1 s1072 (686..2683) [1998 bp, 665 aa] {ON} (686..2683)...    54   1e-06
KNAG0M01450 Chr13 (254622..256061) [1440 bp, 479 aa] {ON}              54   1e-06
TPHA0A02630 Chr1 complement(562516..565164) [2649 bp, 882 aa] {O...    54   1e-06
Suva_3.129 Chr3 (193311..194282) [972 bp, 323 aa] {ON} YCR091W (...    53   1e-06
ZYRO0D06182g Chr4 complement(529121..530416) [1296 bp, 431 aa] {...    54   1e-06
ACL191C Chr3 complement(26475..27572) [1098 bp, 365 aa] {ON} Syn...    53   1e-06
Kpol_448.13 s448 (25051..27063) [2013 bp, 670 aa] {ON} (25051..2...    54   1e-06
NCAS0E01150 Chr5 complement(217594..219315) [1722 bp, 573 aa] {O...    54   1e-06
TPHA0G00730 Chr7 (139442..141364) [1923 bp, 640 aa] {ON} Anc_8.7...    54   1e-06
NCAS0J00960 Chr10 (157010..159121) [2112 bp, 703 aa] {ON}              54   1e-06
KLLA0E06447g Chr5 complement(577669..581154) [3486 bp, 1161 aa] ...    54   1e-06
KLTH0H11396g Chr8 complement(973355..974668) [1314 bp, 437 aa] {...    54   1e-06
CAGL0J04290g Chr10 complement(403542..404615) [1074 bp, 357 aa] ...    53   1e-06
Smik_6.125 Chr6 (201071..202177) [1107 bp, 368 aa] {ON} YGR040W ...    53   1e-06
ZYRO0A12826g Chr1 (1014651..1015751) [1101 bp, 366 aa] {ON} high...    53   1e-06
Kpol_2001.30 s2001 (87817..90093) [2277 bp, 758 aa] {ON} (87817....    54   1e-06
TPHA0F02870 Chr6 complement(636574..638259) [1686 bp, 561 aa] {O...    54   1e-06
Suva_1.84 Chr1 complement(148430..149737) [1308 bp, 435 aa] {ON}...    53   1e-06
TBLA0B08650 Chr2 (2065061..2066308) [1248 bp, 415 aa] {ON} Anc_3...    53   1e-06
NCAS0C03380 Chr3 complement(664012..665310) [1299 bp, 432 aa] {O...    53   1e-06
NDAI0B04700 Chr2 complement(1164332..1165918) [1587 bp, 528 aa] ...    54   1e-06
KLTH0F04730g Chr6 complement(417013..419133) [2121 bp, 706 aa] {...    54   1e-06
TPHA0L01350 Chr12 (282034..283884) [1851 bp, 616 aa] {ON}              54   1e-06
KLTH0G18612g Chr7 (1604066..1608640) [4575 bp, 1524 aa] {ON} sim...    54   1e-06
KLLA0B11902g Chr2 (1041657..1043144) [1488 bp, 495 aa] {ON} unip...    53   1e-06
Smik_4.25 Chr4 complement(52454..54547) [2094 bp, 697 aa] {ON} Y...    54   1e-06
NCAS0I02080 Chr9 (390551..392875) [2325 bp, 774 aa] {ON} Anc_3.162     54   1e-06
Skud_13.262 Chr13 complement(448758..450791) [2034 bp, 677 aa] {...    54   1e-06
Suva_13.281 Chr13 complement(455094..457136) [2043 bp, 680 aa] {...    54   1e-06
CAGL0I05390g Chr9 complement(508677..510041) [1365 bp, 454 aa] {...    53   1e-06
YGR040W Chr7 (575398..576504) [1107 bp, 368 aa] {ON}  KSS1Mitoge...    53   1e-06
Ecym_1508 Chr1 (1045857..1050941) [5085 bp, 1694 aa] {ON} simila...    54   1e-06
TDEL0D02040 Chr4 (395555..397138) [1584 bp, 527 aa] {ON} Anc_1.3...    53   1e-06
KNAG0C02080 Chr3 complement(404332..405588) [1257 bp, 418 aa] {O...    53   1e-06
Ecym_2566 Chr2 (1105239..1106126) [888 bp, 295 aa] {ON} similar ...    52   1e-06
NDAI0G03110 Chr7 complement(725984..731107) [5124 bp, 1707 aa] {...    54   1e-06
Smik_13.290 Chr13 complement(457921..459951) [2031 bp, 676 aa] {...    53   1e-06
AFR076W Chr6 (564252..566714) [2463 bp, 820 aa] {ON} Syntenic ho...    54   1e-06
ZYRO0B04906g Chr2 (395546..398089) [2544 bp, 847 aa] {ON} simila...    53   2e-06
YPL031C Chr16 complement(492018..492918,493021..493037) [918 bp,...    52   2e-06
Skud_11.103 Chr11 (192587..194629) [2043 bp, 680 aa] {ON} YMR104...    53   2e-06
Kpol_1067.14 s1067 (29413..31050) [1638 bp, 545 aa] {ON} (29413....    53   2e-06
Smik_11.113 Chr11 (191688..193730) [2043 bp, 680 aa] {ON} YMR104...    53   2e-06
KAFR0C02840 Chr3 (559821..560873) [1053 bp, 350 aa] {ON} Anc_8.1...    52   2e-06
TDEL0C04800 Chr3 (866157..867467) [1311 bp, 436 aa] {ON} Anc_3.3...    53   2e-06
Ecym_4652 Chr4 (1272725..1276156) [3432 bp, 1143 aa] {ON} simila...    53   2e-06
NDAI0G02700 Chr7 complement(618268..619611) [1344 bp, 447 aa] {O...    53   2e-06
KLTH0G18194g Chr7 (1570885..1572132) [1248 bp, 415 aa] {ON} weak...    52   2e-06
KAFR0C04480 Chr3 (894906..896213) [1308 bp, 435 aa] {ON} Anc_1.3...    53   2e-06
CAGL0K12562g Chr11 (1235695..1240743) [5049 bp, 1682 aa] {ON} si...    53   2e-06
KAFR0F02220 Chr6 (432967..435210) [2244 bp, 747 aa] {ON} Anc_3.1...    53   2e-06
TDEL0E01710 Chr5 complement(330667..332706) [2040 bp, 679 aa] {O...    53   2e-06
TBLA0H01330 Chr8 complement(297718..299163) [1446 bp, 481 aa] {O...    53   2e-06
Suva_7.106 Chr7 (202969..204540) [1572 bp, 523 aa] {ON} YGL158W ...    53   2e-06
KAFR0F01630 Chr6 complement(323802..326057) [2256 bp, 751 aa] {O...    53   2e-06
TDEL0B01250 Chr2 complement(228145..229038) [894 bp, 297 aa] {ON...    52   2e-06
KLTH0F05918g Chr6 complement(525566..527254) [1689 bp, 562 aa] {...    53   2e-06
Skud_16.251 Chr16 complement(457106..458006,458108..458124) [918...    52   2e-06
ADR033W Chr4 (764716..766449) [1734 bp, 577 aa] {ON} Syntenic ho...    53   2e-06
YLR113W Chr12 (371620..372927) [1308 bp, 435 aa] {ON}  HOG1Mitog...    52   2e-06
Skud_4.225 Chr4 complement(400160..401992) [1833 bp, 610 aa] {ON...    53   2e-06
ZYRO0C09768g Chr3 (740592..742925) [2334 bp, 777 aa] {ON} simila...    53   2e-06
NCAS0B00420 Chr2 complement(54562..56718) [2157 bp, 718 aa] {ON}...    53   2e-06
Suva_10.202 Chr10 (380079..381386) [1308 bp, 435 aa] {ON} YLR113...    52   2e-06
NDAI0B03190 Chr2 complement(815759..817309) [1551 bp, 516 aa] {O...    52   2e-06
KNAG0G02300 Chr7 (528489..529748) [1260 bp, 419 aa] {ON} Anc_8.3...    52   2e-06
NCAS0B07380 Chr2 complement(1396315..1397898) [1584 bp, 527 aa] ...    52   2e-06
Skud_7.337 Chr7 (562750..563856) [1107 bp, 368 aa] {ON} YGR040W ...    52   2e-06
Ecym_4266 Chr4 complement(564935..566329) [1395 bp, 464 aa] {ON}...    52   2e-06
CAGL0G05720g Chr7 complement(547617..549833) [2217 bp, 738 aa] {...    53   2e-06
Skud_4.39 Chr4 complement(70857..72947) [2091 bp, 696 aa] {ON} Y...    53   2e-06
NCAS0A06680 Chr1 (1320265..1321704) [1440 bp, 479 aa] {ON} Anc_5...    52   2e-06
KLTH0G17512g Chr7 complement(1518329..1519426) [1098 bp, 365 aa]...    52   2e-06
KNAG0C06060 Chr3 (1183766..1186654) [2889 bp, 962 aa] {ON} Anc_5...    53   2e-06
NDAI0D01620 Chr4 (386654..388132) [1479 bp, 492 aa] {ON} Anc_5.274     52   2e-06
Smik_12.173 Chr12 (351727..353034) [1308 bp, 435 aa] {ON} YLR113...    52   2e-06
KNAG0C02430 Chr3 complement(472213..474804) [2592 bp, 863 aa] {O...    53   2e-06
Ecym_3160 Chr3 complement(304537..306957) [2421 bp, 806 aa] {ON}...    53   2e-06
NDAI0G05060 Chr7 complement(1227369..1229495) [2127 bp, 708 aa] ...    53   2e-06
Kpol_2001.46 s2001 (127016..129376) [2361 bp, 786 aa] {ON} (1270...    53   2e-06
Kwal_14.1159 s14 complement(219896..224461) [4566 bp, 1521 aa] {...    53   2e-06
TBLA0A10420 Chr1 (2562614..2564092) [1479 bp, 492 aa] {ON} Anc_5...    52   3e-06
TPHA0A01630 Chr1 complement(328040..329347) [1308 bp, 435 aa] {O...    52   3e-06
Smik_10.91 Chr10 complement(145745..148153) [2409 bp, 802 aa] {O...    53   3e-06
Skud_12.181 Chr12 (354407..355702) [1296 bp, 431 aa] {ON} YLR113...    52   3e-06
Kwal_47.17263 s47 complement(321115..324498) [3384 bp, 1127 aa] ...    53   3e-06
TDEL0B05820 Chr2 complement(1031136..1032863) [1728 bp, 575 aa] ...    52   3e-06
AER232C Chr5 complement(1066272..1067981) [1710 bp, 569 aa] {ON}...    52   3e-06
AGR048C Chr7 complement(807464..808825) [1362 bp, 453 aa] {ON} S...    52   3e-06
KLLA0B12716g Chr2 (1109939..1112089) [2151 bp, 716 aa] {ON} simi...    52   3e-06
ZYRO0E05588g Chr5 (430271..431686) [1416 bp, 471 aa] {ON} simila...    52   3e-06
Ecym_2397 Chr2 complement(771343..773961) [2619 bp, 872 aa] {ON}...    53   3e-06
Kpol_543.55 s543 (126256..127533) [1278 bp, 425 aa] {ON} (126256...    52   3e-06
KAFR0G00440 Chr7 (124896..127328) [2433 bp, 810 aa] {ON} Anc_1.1...    52   3e-06
KNAG0B01670 Chr2 (307587..309860) [2274 bp, 757 aa] {ON} Anc_1.2...    52   3e-06
Kwal_33.13831 s33 complement(413256..415358) [2103 bp, 700 aa] {...    52   3e-06
KLLA0B13112g Chr2 complement(1146006..1148198) [2193 bp, 730 aa]...    52   3e-06
YKL126W Chr11 (205707..207749) [2043 bp, 680 aa] {ON}  YPK1Serin...    52   3e-06
ZYRO0B09196g Chr2 complement(721019..722569) [1551 bp, 516 aa] {...    52   3e-06
Suva_3.33 Chr3 (42176..44020) [1845 bp, 614 aa] {ON} YCR008W (REAL)    52   3e-06
Skud_12.447 Chr12 (790003..792210) [2208 bp, 735 aa] {ON} YLR362...    52   3e-06
NCAS0A02120 Chr1 (401097..402230) [1134 bp, 377 aa] {ON} Anc_4.184     52   3e-06
TDEL0A06220 Chr1 (1088622..1091006) [2385 bp, 794 aa] {ON} Anc_8...    52   3e-06
Ecym_7361 Chr7 complement(753862..755313) [1452 bp, 483 aa] {ON}...    52   3e-06
Ecym_6359 Chr6 complement(699564..702176) [2613 bp, 870 aa] {ON}...    52   3e-06
YJL141C Chr10 complement(147967..150390) [2424 bp, 807 aa] {ON} ...    52   3e-06
NDAI0K01370 Chr11 (313672..315714) [2043 bp, 680 aa] {ON}              52   3e-06
TDEL0F04290 Chr6 (801456..802739) [1284 bp, 427 aa] {ON} Anc_8.3...    52   3e-06
Kwal_26.7635 s26 (451306..453381) [2076 bp, 691 aa] {ON} YKL126W...    52   3e-06
KLTH0D03080g Chr4 (295808..297730) [1923 bp, 640 aa] {ON} simila...    52   3e-06
TPHA0G02990 Chr7 complement(640488..642098) [1611 bp, 536 aa] {O...    52   3e-06
Ecym_2042 Chr2 complement(67312..68397) [1086 bp, 361 aa] {ON} s...    52   3e-06
NCAS0A10290 Chr1 complement(2051582..2053111) [1530 bp, 509 aa] ...    52   3e-06
Skud_10.87 Chr10 complement(153140..155164) [2025 bp, 674 aa] {O...    52   3e-06
ADR174C Chr4 complement(1008796..1010811) [2016 bp, 671 aa] {ON}...    52   3e-06
ZYRO0B04796g Chr2 (385611..387683) [2073 bp, 690 aa] {ON} simila...    52   4e-06
NDAI0H02340 Chr8 complement(568767..570887) [2121 bp, 706 aa] {O...    52   4e-06
KAFR0A06190 Chr1 complement(1251546..1253690) [2145 bp, 714 aa] ...    52   4e-06
KNAG0I01480 Chr9 (287733..289055) [1323 bp, 440 aa] {ON} Anc_1.3...    52   4e-06
KLTH0D04818g Chr4 (439491..441566) [2076 bp, 691 aa] {ON} simila...    52   4e-06
KAFR0K01540 Chr11 (320997..322706) [1710 bp, 569 aa] {ON} Anc_3....    52   4e-06
YDL025C Chr4 complement(405344..407206) [1863 bp, 620 aa] {ON}  ...    52   4e-06
KLLA0A02717g Chr1 (245082..246380) [1299 bp, 432 aa] {ON} weakly...    52   4e-06
Suva_2.642 Chr2 (1147428..1148865,1149541..1150805) [2703 bp, 90...    52   4e-06
Ecym_5236 Chr5 (486270..488864) [2595 bp, 864 aa] {ON} similar t...    52   4e-06
KLTH0E16104g Chr5 complement(1425822..1427042) [1221 bp, 406 aa]...    52   4e-06
ZYRO0F12122g Chr6 complement(984069..985910) [1842 bp, 613 aa] {...    52   4e-06
NCAS0H03070 Chr8 complement(590494..592440) [1947 bp, 648 aa] {O...    52   4e-06
TBLA0A08290 Chr1 complement(2039328..2041376) [2049 bp, 682 aa] ...    52   4e-06
Klac_YGOB_Anc_8.34 Chr6 (836287..839007,839010..841004) [4716 bp...    52   4e-06
NCAS0A08880 Chr1 (1756271..1757539) [1269 bp, 422 aa] {ON} Anc_1...    52   4e-06
TPHA0P00640 Chr16 (132185..133963) [1779 bp, 592 aa] {ON} Anc_3....    52   4e-06
NCAS0I02850 Chr9 (529637..532042) [2406 bp, 801 aa] {ON} Anc_1.180     52   4e-06
NCAS0B05910 Chr2 (1120092..1121645) [1554 bp, 517 aa] {ON} Anc_2...    52   4e-06
NCAS0I02060 Chr9 (386630..388573) [1944 bp, 647 aa] {ON} Anc_3.1...    52   4e-06
CAGL0M08360g Chr13 complement(833220..835520) [2301 bp, 766 aa] ...    52   4e-06
CAGL0L05632g Chr12 (612478..614511) [2034 bp, 677 aa] {ON} simil...    52   4e-06
NCAS0A04440 Chr1 complement(895181..896935) [1755 bp, 584 aa] {O...    52   4e-06
NCAS0B05560 Chr2 complement(1050313..1051371) [1059 bp, 352 aa] ...    51   5e-06
Kwal_14.1273 s14 complement(259953..261200) [1248 bp, 415 aa] {O...    51   5e-06
Skud_4.742 Chr4 (1315170..1317881) [2712 bp, 903 aa] {ON} YDR466...    52   5e-06
SAKL0D05104g Chr4 (402641..404692) [2052 bp, 683 aa] {ON} simila...    52   5e-06
Kpol_1035.40 s1035 (101912..102910,102960..102968,103011..106556...    52   5e-06
KNAG0A06290 Chr1 (958438..960516) [2079 bp, 692 aa] {ON} Anc_2.4...    52   5e-06
KLLA0D09328g Chr4 complement(788565..791705) [3141 bp, 1046 aa] ...    52   5e-06
TBLA0A01660 Chr1 complement(391368..392828) [1461 bp, 486 aa] {O...    51   5e-06
SAKL0G10978g Chr7 (929164..930729) [1566 bp, 521 aa] {ON} highly...    52   5e-06
ZYRO0B07854g Chr2 complement(613992..616007) [2016 bp, 671 aa] {...    52   5e-06
ABL011C Chr2 complement(378257..380362) [2106 bp, 701 aa] {ON} S...    52   5e-06
KNAG0C01020 Chr3 (200271..202595) [2325 bp, 774 aa] {ON} Anc_1.1...    52   5e-06
KLTH0E04334g Chr5 complement(391495..393723) [2229 bp, 742 aa] {...    52   5e-06
NCAS0C04540 Chr3 complement(929920..931056) [1137 bp, 378 aa] {O...    51   5e-06
KLTH0E11396g Chr5 (1018348..1020069) [1722 bp, 573 aa] {ON} simi...    52   5e-06
NDAI0A07190 Chr1 (1636773..1638380) [1608 bp, 535 aa] {ON} Anc_3...    51   5e-06
CAGL0M11748g Chr13 (1168856..1170199) [1344 bp, 447 aa] {ON} hig...    51   5e-06
KNAG0C01820 Chr3 (355604..357376) [1773 bp, 590 aa] {ON}               52   5e-06
KLTH0G12738g Chr7 complement(1085500..1086804) [1305 bp, 434 aa]...    51   5e-06
Kwal_27.11777 s27 (942591..943985) [1395 bp, 464 aa] {ON} YPL026...    51   5e-06
Kpol_1033.1 s1033 complement(1..828) [828 bp, 276 aa] {ON} compl...    50   5e-06
Smik_6.46 Chr6 complement(84451..89733) [5283 bp, 1760 aa] {ON} ...    52   5e-06
Kwal_55.22001 s55 (1069907..1070998) [1092 bp, 363 aa] {ON} YNL3...    51   6e-06
Kwal_27.9773 s27 (57252..58472) [1221 bp, 406 aa] {ON} YAR018C (...    51   6e-06
ZYRO0D10252g Chr4 (860458..863109) [2652 bp, 883 aa] {ON} simila...    52   6e-06
NDAI0H02930 Chr8 (715278..716846) [1569 bp, 522 aa] {ON} Anc_2.391     51   6e-06
KAFR0H01570 Chr8 complement(290698..291897) [1200 bp, 399 aa] {O...    51   6e-06
KLTH0F18942g Chr6 (1535941..1537032) [1092 bp, 363 aa] {ON} high...    51   6e-06
Kpol_2001.10 s2001 (30724..33018) [2295 bp, 764 aa] {ON} (30724....    52   6e-06
Kwal_17.2687 s17 complement(6084..7172) [1089 bp, 362 aa] {ON} Y...    51   6e-06
Suva_16.286 Chr16 complement(495354..496254,496351..496367) [918...    50   6e-06
TBLA0H03440 Chr8 (840759..841643) [885 bp, 294 aa] {ON} Anc_8.51...    50   6e-06
KLLA0F20053g Chr6 (1867209..1868543) [1335 bp, 444 aa] {ON} high...    51   6e-06
KNAG0I02830 Chr9 (549811..554358) [4548 bp, 1515 aa] {ON} Anc_1....    52   6e-06
SAKL0E03608g Chr5 complement(291806..294007) [2202 bp, 733 aa] {...    51   6e-06
YDR466W Chr4 (1395121..1397817) [2697 bp, 898 aa] {ON}  PKH3Prot...    52   6e-06
NDAI0C05340 Chr3 (1236394..1237296) [903 bp, 300 aa] {ON}              50   6e-06
Skud_6.38 Chr6 complement(72416..77692) [5277 bp, 1758 aa] {ON} ...    52   6e-06
YHR030C Chr8 complement(168890..170344) [1455 bp, 484 aa] {ON}  ...    51   6e-06
NDAI0K01480 Chr11 complement(337108..338706) [1599 bp, 532 aa] {...    51   6e-06
Smik_8.97 Chr8 complement(148421..149857) [1437 bp, 478 aa] {ON}...    51   6e-06
AFR372W Chr6 (1109169..1111493) [2325 bp, 774 aa] {ON} Syntenic ...    51   6e-06
Kwal_56.23841 s56 (732202..733500) [1299 bp, 432 aa] {ON} YLR113...    51   6e-06
AGL242C Chr7 complement(246896..247790,247838..247854) [912 bp, ...    50   6e-06
Kpol_513.7 s513 (14160..15050) [891 bp, 296 aa] {ON} (14160..150...    50   7e-06
TBLA0I01370 Chr9 complement(294202..296526) [2325 bp, 774 aa] {O...    51   7e-06
NDAI0B00220 Chr2 (29825..32470) [2646 bp, 881 aa] {ON} Anc_1.180       51   7e-06
SAKL0H16038g Chr8 complement(1401627..1402931) [1305 bp, 434 aa]...    51   7e-06
KAFR0E01580 Chr5 (318991..320280) [1290 bp, 429 aa] {ON} Anc_5.2...    51   7e-06
YFL033C Chr6 complement(69115..74427) [5313 bp, 1770 aa] {ON}  R...    51   7e-06
KAFR0C03520 Chr3 (715667..720019) [4353 bp, 1450 aa] {ON} Anc_8....    51   7e-06
SAKL0E12958g Chr5 (1066434..1068653) [2220 bp, 739 aa] {ON} simi...    51   7e-06
CAGL0J00539g Chr10 (47095..48561) [1467 bp, 488 aa] {ON} highly ...    51   7e-06
AEL118C Chr5 complement(399738..401789) [2052 bp, 683 aa] {ON} S...    51   7e-06
KNAG0G01430 Chr7 complement(322758..323822) [1065 bp, 354 aa] {O...    50   7e-06
TDEL0C03740 Chr3 (658468..660702) [2235 bp, 744 aa] {ON} Anc_1.1...    51   8e-06
YKL048C Chr11 complement(347214..349136) [1923 bp, 640 aa] {ON} ...    51   8e-06
KAFR0E01810 Chr5 complement(372094..373524) [1431 bp, 476 aa] {O...    51   8e-06
NDAI0G03920 Chr7 complement(934765..935889) [1125 bp, 374 aa] {O...    50   8e-06
KAFR0G00460 Chr7 complement(128077..130023) [1947 bp, 648 aa] {O...    51   8e-06
TPHA0O01620 Chr15 (321912..324359) [2448 bp, 815 aa] {ON} Anc_2....    51   8e-06
NDAI0A06620 Chr1 complement(1510218..1512461) [2244 bp, 747 aa] ...    51   8e-06
Kwal_0.307 s0 (145676..147145) [1470 bp, 490 aa] {OFF} YCR008W (...    50   8e-06
ZYRO0F08778g Chr6 (702733..703626) [894 bp, 297 aa] {ON} highly ...    50   8e-06
Kwal_YGOB_0.307 s0 (145676..147175) [1500 bp, 500 aa] {ON} ANNOT...    50   8e-06
Suva_4.223 Chr4 complement(395869..397719) [1851 bp, 616 aa] {ON...    51   8e-06
ZYRO0E04246g Chr5 complement(322215..324035) [1821 bp, 606 aa] {...    51   8e-06
TDEL0F03120 Chr6 (570471..572192) [1722 bp, 573 aa] {ON} Anc_3.4...    50   9e-06
Kpol_185.2 s185 complement(1614..3704) [2091 bp, 696 aa] {ON} co...    51   9e-06
KAFR0D03020 Chr4 (596365..598398) [2034 bp, 677 aa] {ON} Anc_2.4...    51   9e-06
ZYRO0A02772g Chr1 complement(223226..224473) [1248 bp, 415 aa] {...    50   9e-06
TBLA0B07330 Chr2 complement(1745229..1746821,1746990..1747013) [...    50   9e-06
Suva_6.221 Chr6 (399862..400920,400924..402096) [2232 bp, 743 aa...    51   9e-06
TDEL0E03520 Chr5 (657779..659251) [1473 bp, 490 aa] {ON} Anc_5.2...    50   9e-06
CAGL0L12474g Chr12 complement(1347340..1348248) [909 bp, 302 aa]...    50   9e-06
Suva_15.216 Chr15 complement(376197..377624) [1428 bp, 475 aa] {...    50   1e-05
YKL168C Chr11 complement(131288..133462) [2175 bp, 724 aa] {ON} ...    51   1e-05
Kpol_1031.67 s1031 (174170..175663) [1494 bp, 497 aa] {ON} (1741...    50   1e-05
Smik_4.209 Chr4 complement(385530..386995,387230..387623) [1860 ...    50   1e-05
TDEL0A02220 Chr1 (402496..404565) [2070 bp, 689 aa] {ON} Anc_2.4...    50   1e-05
Kpol_1041.9 s1041 (27806..29059) [1254 bp, 417 aa] {ON} (27806.....    50   1e-05
Skud_8.86 Chr8 complement(149508..150953) [1446 bp, 481 aa] {ON}...    50   1e-05
CAGL0K03399g Chr11 complement(311316..313427) [2112 bp, 703 aa] ...    50   1e-05
Smik_1.78 Chr1 complement(147996..149303) [1308 bp, 435 aa] {ON}...    50   1e-05
KLTH0F06468g Chr6 (559256..561769) [2514 bp, 837 aa] {ON} simila...    50   1e-05
YOR351C Chr15 complement(995018..996511) [1494 bp, 497 aa] {ON} ...    50   1e-05
TPHA0C01780 Chr3 complement(407048..407965) [918 bp, 305 aa] {ON...    50   1e-05
TPHA0H00410 Chr8 (79426..82197) [2772 bp, 923 aa] {ON} Anc_8.141...    50   1e-05
CAGL0K06479g Chr11 (637125..640100) [2976 bp, 991 aa] {ON} some ...    51   1e-05
TBLA0B03840 Chr2 complement(881914..884490) [2577 bp, 858 aa] {O...    50   1e-05
KLTH0G06974g Chr7 (556626..558125) [1500 bp, 499 aa] {ON} highly...    50   1e-05
Smik_15.535 Chr15 complement(940569..942050) [1482 bp, 493 aa] {...    50   1e-05
TBLA0J00990 Chr10 (224999..227335) [2337 bp, 778 aa] {ON} Anc_1....    50   1e-05
Kwal_27.11830 s27 (964584..966311) [1728 bp, 575 aa] {ON} YPL042...    50   1e-05
Kwal_23.5576 s23 complement(1223517..1225031) [1515 bp, 504 aa] ...    50   1e-05
Kpol_161.2 s161 complement(3125..4246) [1122 bp, 373 aa] {ON} co...    50   1e-05
NDAI0K01150 Chr11 complement(264377..266527) [2151 bp, 716 aa] {...    50   1e-05
Suva_14.158 Chr14 complement(289281..291650) [2370 bp, 789 aa] {...    50   1e-05
AER195C Chr5 complement(1005431..1006945) [1515 bp, 504 aa] {ON}...    50   1e-05
KNAG0B01130 Chr2 complement(208528..210279) [1752 bp, 583 aa] {O...    50   1e-05
Kwal_33.13222 s33 (127342..127788) [447 bp, 148 aa] {OFF} YDR507...    47   1e-05
KLLA0B09790g Chr2 complement(855327..856214) [888 bp, 295 aa] {O...    49   1e-05
TPHA0C02880 Chr3 (623723..624778) [1056 bp, 351 aa] {ON} Anc_8.1...    50   1e-05
KAFR0I02440 Chr9 complement(493668..495128) [1461 bp, 486 aa] {O...    50   1e-05
TBLA0I01310 Chr9 (279407..281245) [1839 bp, 612 aa] {ON} Anc_2.4...    50   1e-05
TBLA0D01200 Chr4 (303528..305198) [1671 bp, 556 aa] {ON} Anc_8.7...    50   1e-05
KLTH0H08316g Chr8 (730027..731094) [1068 bp, 355 aa] {ON} simila...    50   1e-05
KLLA0E07437g Chr5 complement(672690..673787) [1098 bp, 365 aa] {...    50   1e-05
CAGL0J11308g Chr10 (1099969..1102155) [2187 bp, 728 aa] {ON} sim...    50   1e-05
KAFR0C03010 Chr3 (598970..601342) [2373 bp, 790 aa] {ON} Anc_8.1...    50   1e-05
TPHA0O01030 Chr15 complement(191875..193890) [2016 bp, 671 aa] {...    50   1e-05
Suva_11.178 Chr11 complement(330253..332184) [1932 bp, 643 aa] {...    50   1e-05
YMR291W Chr13 (852630..854390) [1761 bp, 586 aa] {ON}  TDA1Prote...    50   1e-05
ZYRO0G16082g Chr7 complement(1320266..1321714) [1449 bp, 482 aa]...    50   1e-05
TDEL0H00890 Chr8 complement(146908..149088) [2181 bp, 726 aa] {O...    50   1e-05
KLTH0H10318g Chr8 complement(888661..890128,890228..890316) [155...    50   1e-05
TBLA0E04970 Chr5 (1272310..1273944) [1635 bp, 544 aa] {ON} Anc_4...    50   1e-05
TDEL0D04560 Chr4 (835822..837885) [2064 bp, 687 aa] {ON} Anc_3.1...    50   1e-05
CAGL0L07326g Chr12 (810529..812049) [1521 bp, 506 aa] {ON} simil...    50   1e-05
Skud_14.151 Chr14 complement(284115..286490) [2376 bp, 791 aa] {...    50   1e-05
Ecym_4448 Chr4 complement(917136..918872) [1737 bp, 578 aa] {ON}...    50   1e-05
NCAS0A04360 Chr1 (880768..882822) [2055 bp, 684 aa] {ON} Anc_2.446     50   2e-05
Suva_6.26 Chr6 complement(42811..48072) [5262 bp, 1753 aa] {ON} ...    50   2e-05
Kwal_YGOB_27.11919 s27 (1003201..1003830,1004866..1005135) [900 ...    49   2e-05
TDEL0C00590 Chr3 complement(94223..99031) [4809 bp, 1602 aa] {ON...    50   2e-05
TBLA0C03140 Chr3 (759258..760763) [1506 bp, 501 aa] {ON} Anc_5.2...    50   2e-05
ZYRO0G02530g Chr7 (194463..196577) [2115 bp, 704 aa] {ON} highly...    50   2e-05
KLTH0E11924g Chr5 (1059134..1060030) [897 bp, 298 aa] {ON} highl...    49   2e-05
TPHA0D02740 Chr4 (566279..568819) [2541 bp, 846 aa] {ON} Anc_5.5...    50   2e-05
Skud_11.56 Chr11 complement(117617..119776) [2160 bp, 719 aa] {O...    50   2e-05
SAKL0H11638g Chr8 complement(994049..994946,995016..995032) [915...    49   2e-05
KLTH0E11220g Chr5 (1005953..1005969,1006040..1006931) [909 bp, 3...    49   2e-05
TDEL0A01120 Chr1 complement(189217..191466) [2250 bp, 749 aa] {O...    50   2e-05
Ecym_5209 Chr5 complement(445530..448133) [2604 bp, 867 aa] {ON}...    50   2e-05
KAFR0B02980 Chr2 (623470..624804) [1335 bp, 444 aa] {ON} Anc_8.3...    49   2e-05
Suva_11.65 Chr11 complement(134606..136120) [1515 bp, 504 aa] {O...    50   2e-05
Kwal_26.7276 s26 (293129..295069) [1941 bp, 646 aa] {ON} YJL106W...    50   2e-05
SAKL0H10758g Chr8 complement(930403..931302) [900 bp, 299 aa] {O...    49   2e-05
ACL053C Chr3 complement(273163..276708) [3546 bp, 1181 aa] {ON} ...    50   2e-05
TDEL0H01070 Chr8 complement(192834..194624) [1791 bp, 596 aa] {O...    50   2e-05
KLLA0D11990g Chr4 complement(1022895..1023792,1023928..1023944) ...    49   2e-05
ZYRO0C12408g Chr3 (979857..981593) [1737 bp, 578 aa] {ON} highly...    50   2e-05
Kpol_1018.162 s1018 (414868..416904) [2037 bp, 678 aa] {ON} (414...    50   2e-05
NCAS0B02350 Chr2 complement(394128..395018) [891 bp, 296 aa] {ON...    49   2e-05
CAGL0K07458g Chr11 complement(737165..739279) [2115 bp, 704 aa] ...    50   2e-05
KLTH0B06424g Chr2 complement(518184..520328) [2145 bp, 714 aa] {...    50   2e-05
Ecym_2457 Chr2 (888054..890165) [2112 bp, 703 aa] {ON} similar t...    50   2e-05
Skud_10.73 Chr10 complement(123049..125436) [2388 bp, 795 aa] {O...    50   2e-05
KLTH0F05522g Chr6 complement(477035..478975) [1941 bp, 646 aa] {...    50   2e-05
Kwal_27.11919 s27 (1003201..1003827) [627 bp, 209 aa] {OFF} YBR1...    48   2e-05
NDAI0G01280 Chr7 complement(281834..283573) [1740 bp, 579 aa] {O...    50   2e-05
NCAS0A08610 Chr1 complement(1700839..1702704) [1866 bp, 621 aa] ...    50   2e-05
ACR218W Chr3 (731433..736142) [4710 bp, 1569 aa] {ON} Syntenic h...    50   2e-05
SAKL0H11748g Chr8 complement(1002207..1003541) [1335 bp, 444 aa]...    49   2e-05
Suva_6.222 Chr6 (400975..402096) [1122 bp, 373 aa] {ON} YJL141C ...    49   2e-05
Kwal_33.14554 s33 (717776..719920) [2145 bp, 714 aa] {ON} YNL161...    50   2e-05
TPHA0B02440 Chr2 (560189..561592) [1404 bp, 467 aa] {ON} Anc_5.2...    49   2e-05
Kwal_33.14167 s33 (554863..557379) [2517 bp, 838 aa] {ON} YDL028...    50   2e-05
Smik_14.147 Chr14 complement(272373..274742) [2370 bp, 789 aa] {...    50   2e-05
KLTH0D11242g Chr4 (918232..920619) [2388 bp, 795 aa] {ON} simila...    50   2e-05
ZYRO0G18546g Chr7 (1530693..1533050) [2358 bp, 785 aa] {ON} simi...    50   2e-05
SAKL0E04092g Chr5 complement(326532..327901,327970..327982) [138...    49   2e-05
Skud_2.90 Chr2 (176138..177199) [1062 bp, 353 aa] {ON} YBL016W (...    49   2e-05
Smik_11.200 Chr11 complement(333676..335592) [1917 bp, 638 aa] {...    49   2e-05
NDAI0B00400 Chr2 (74403..76643) [2241 bp, 746 aa] {ON} Anc_1.149       49   2e-05
KLTH0B07106g Chr2 (571005..573260) [2256 bp, 751 aa] {ON} simila...    49   2e-05
YNL183C Chr14 complement(293137..295509) [2373 bp, 790 aa] {ON} ...    49   2e-05
TBLA0A01580 Chr1 complement(367370..369976) [2607 bp, 868 aa] {O...    49   2e-05
TBLA0A08810 Chr1 (2161249..2162304) [1056 bp, 351 aa] {ON} Anc_8...    49   2e-05
KAFR0D02900 Chr4 (575853..577313) [1461 bp, 486 aa] {ON} Anc_7.5...    49   2e-05
CAGL0L07810g Chr12 complement(859653..861443) [1791 bp, 596 aa] ...    49   2e-05
YBL016W Chr2 (192451..193512) [1062 bp, 353 aa] {ON}  FUS3Mitoge...    49   2e-05
TPHA0P01380 Chr16 (278259..279380) [1122 bp, 373 aa] {ON} Anc_3....    49   3e-05
AFL217C Chr6 complement(30765..32840) [2076 bp, 691 aa] {ON} Syn...    49   3e-05
Kpol_1044.26 s1044 complement(60216..62666) [2451 bp, 816 aa] {O...    49   3e-05
KNAG0E01390 Chr5 (275055..276776) [1722 bp, 573 aa] {ON} Anc_1.4...    49   3e-05
Suva_2.105 Chr2 (186428..187489) [1062 bp, 353 aa] {ON} YBL016W ...    49   3e-05
YDL101C Chr4 complement(280307..281848) [1542 bp, 513 aa] {ON}  ...    49   3e-05
KNAG0A02310 Chr1 complement(216545..217453) [909 bp, 302 aa] {ON...    48   3e-05
TBLA0C02310 Chr3 complement(546887..548596) [1710 bp, 569 aa] {O...    49   3e-05
Kpol_1007.17 s1007 (32671..32687,32861..33767) [924 bp, 307 aa] ...    48   3e-05
AER222C Chr5 complement(1043479..1044750) [1272 bp, 423 aa] {ON}...    49   3e-05
KAFR0F01790 Chr6 complement(347491..349884) [2394 bp, 797 aa] {O...    49   3e-05
TBLA0D05770 Chr4 (1424960..1427671) [2712 bp, 903 aa] {ON} Anc_1...    49   3e-05
Ecym_6044 Chr6 complement(84500..85756) [1257 bp, 418 aa] {ON} s...    49   3e-05
KLLA0F11143g Chr6 complement(1026129..1028570) [2442 bp, 813 aa]...    49   3e-05
NCAS0F01460 Chr6 complement(290441..292465) [2025 bp, 674 aa] {O...    49   3e-05
TDEL0A00600 Chr1 complement(101753..102877) [1125 bp, 374 aa] {O...    49   3e-05
Suva_6.208 Chr6 (369853..371880) [2028 bp, 675 aa] {ON} YJL128C ...    49   3e-05
ABL143C Chr2 complement(128215..130392) [2178 bp, 725 aa] {ON} S...    49   3e-05
Skud_13.465 Chr13 (826172..827929) [1758 bp, 585 aa] {ON} YMR291...    49   3e-05
Smik_16.354 Chr16 (625456..627150) [1695 bp, 564 aa] {ON} YPR111...    49   3e-05
Kpol_1031.32 s1031 (76827..78821) [1995 bp, 664 aa] {ON} (76827....    49   3e-05
Ecym_1502 Chr1 (1030765..1031838) [1074 bp, 357 aa] {ON} similar...    49   3e-05
TPHA0G02910 Chr7 (624676..626727) [2052 bp, 683 aa] {ON} Anc_2.4...    49   3e-05
CAGL0E01683g Chr5 complement(166821..167948) [1128 bp, 375 aa] {...    49   3e-05
NCAS0F02190 Chr6 complement(435844..437706) [1863 bp, 620 aa] {O...    49   3e-05
CAGL0I05896g Chr9 (560169..562505) [2337 bp, 778 aa] {ON} some s...    49   3e-05
Skud_10.107 Chr10 (189314..191254) [1941 bp, 646 aa] {ON} YJL106...    49   3e-05
ADL168C Chr4 complement(398517..399605) [1089 bp, 362 aa] {ON} S...    48   3e-05
KAFR0E01040 Chr5 complement(214744..216252) [1509 bp, 502 aa] {O...    49   4e-05
Smik_2.101 Chr2 (186008..187069) [1062 bp, 353 aa] {ON} YBL016W ...    48   4e-05
KNAG0C01040 Chr3 complement(203429..204976) [1548 bp, 515 aa] {O...    49   4e-05
AFR019W Chr6 (471481..472560) [1080 bp, 359 aa] {ON} Syntenic ho...    48   4e-05
KLTH0H12650g Chr8 (1072961..1074592) [1632 bp, 543 aa] {ON} simi...    49   4e-05
Suva_6.182 Chr6 complement(328699..330642) [1944 bp, 647 aa] {ON...    49   4e-05
KAFR0A04070 Chr1 complement(817388..819325) [1938 bp, 645 aa] {O...    49   4e-05
TDEL0B04490 Chr2 (792559..793629) [1071 bp, 356 aa] {ON} Anc_8.1...    48   4e-05
TBLA0B09740 Chr2 (2312062..2314815) [2754 bp, 917 aa] {ON} Anc_2...    49   4e-05
Skud_1.73 Chr1 (144821..146128) [1308 bp, 435 aa] {ON} YAR018C (...    48   4e-05
YAR018C Chr1 complement(170396..171703) [1308 bp, 435 aa] {ON}  ...    48   4e-05
KNAG0A06390 Chr1 complement(974644..976254) [1611 bp, 536 aa] {O...    49   4e-05
KNAG0A06140 Chr1 (931737..933437) [1701 bp, 566 aa] {ON} Anc_2.4...    49   4e-05
KAFR0E03030 Chr5 (606567..607457) [891 bp, 296 aa] {ON} Anc_8.51...    48   4e-05
TBLA0D02070 Chr4 complement(522456..523958) [1503 bp, 500 aa] {O...    48   4e-05
Ecym_2531 Chr2 (1034031..1034047,1034135..1035023) [906 bp, 301 ...    48   4e-05
Suva_16.439 Chr16 (755102..756796) [1695 bp, 564 aa] {ON} YPR111...    49   4e-05
CAGL0I08349g Chr9 complement(813998..816001) [2004 bp, 667 aa] {...    49   5e-05
Kwal_33.14434 s33 complement(672031..674310) [2280 bp, 759 aa] {...    49   5e-05
Smik_4.745 Chr4 (1316457..1319201) [2745 bp, 914 aa] {ON} YDR466...    49   5e-05
ZYRO0C02772g Chr3 (216325..217464) [1140 bp, 379 aa] {ON} highly...    48   5e-05
ADR317C Chr4 complement(1263080..1265539) [2460 bp, 819 aa] {ON}...    49   5e-05
Kwal_33.13984 s33 complement(471429..473378) [1950 bp, 649 aa] {...    49   5e-05
TDEL0B01540 Chr2 complement(272561..273458,273562..273578) [915 ...    48   5e-05
SAKL0H19668g Chr8 (1736301..1737674) [1374 bp, 457 aa] {ON} high...    48   5e-05
YDR247W Chr4 (956013..957398) [1386 bp, 461 aa] {ON}  VHS1Cytopl...    48   5e-05
KNAG0J02660 Chr10 (495011..497425) [2415 bp, 804 aa] {ON} Anc_1....    49   5e-05
KNAG0J01700 Chr10 (309962..312424) [2463 bp, 820 aa] {ON}              49   5e-05
KNAG0A03900 Chr1 complement(520500..521390) [891 bp, 296 aa] {ON...    47   5e-05
YPR161C Chr16 complement(864449..866422) [1974 bp, 657 aa] {ON} ...    48   5e-05
CAGL0H07535g Chr8 (736241..737137) [897 bp, 298 aa] {ON} highly ...    47   5e-05
TPHA0A04170 Chr1 (937692..939233) [1542 bp, 513 aa] {ON} Anc_3.2...    48   5e-05
KAFR0H01530 Chr8 complement(283589..284509) [921 bp, 306 aa] {ON...    47   5e-05
SAKL0C12870g Chr3 (1145051..1146142) [1092 bp, 363 aa] {ON} high...    48   5e-05
YPL026C Chr16 complement(500675..502183) [1509 bp, 502 aa] {ON} ...    48   6e-05
TBLA0C06820 Chr3 (1645811..1647508) [1698 bp, 565 aa] {ON} Anc_5...    48   6e-05
NDAI0G05370 Chr7 (1313015..1315555) [2541 bp, 846 aa] {ON} Anc_1...    48   6e-05
SAKL0C06666g Chr3 complement(628448..630367) [1920 bp, 639 aa] {...    48   6e-05
CAGL0L12650g Chr12 (1360085..1361788) [1704 bp, 567 aa] {ON} sim...    48   6e-05
ZYRO0A08448g Chr1 complement(677122..678225) [1104 bp, 367 aa] {...    47   6e-05
Kpol_1041.29 s1041 (73725..74876) [1152 bp, 383 aa] {ON} (73725....    48   6e-05
KAFR0C01720 Chr3 (351078..352208) [1131 bp, 376 aa] {ON} Anc_3.4...    47   6e-05
Suva_11.54 Chr11 complement(116221..118401) [2181 bp, 726 aa] {O...    48   6e-05
KNAG0A02350 Chr1 complement(223757..225022) [1266 bp, 421 aa] {O...    48   6e-05
SAKL0D09240g Chr4 (764130..765761) [1632 bp, 543 aa] {ON} some s...    48   7e-05
TPHA0D00430 Chr4 complement(73651..74730) [1080 bp, 359 aa] {ON}...    47   7e-05
KNAG0A02220 Chr1 complement(198240..199979) [1740 bp, 579 aa] {O...    48   7e-05
ZYRO0G17094g Chr7 complement(1404552..1406804) [2253 bp, 750 aa]...    48   7e-05
CAGL0G03047g Chr7 (282299..283918) [1620 bp, 539 aa] {ON} highly...    48   7e-05
SAKL0H11352g Chr8 complement(975064..976857) [1794 bp, 597 aa] {...    48   7e-05
NDAI0F03390 Chr6 (816047..818380) [2334 bp, 777 aa] {ON}               48   7e-05
TPHA0I00820 Chr9 (177222..179651) [2430 bp, 809 aa] {ON} Anc_1.2...    48   7e-05
Kpol_1050.13 s1050 (34788..36578) [1791 bp, 596 aa] {ON} (34788....    48   7e-05
AEL185C Chr5 complement(291129..292676) [1548 bp, 515 aa] {ON} S...    48   7e-05
Skud_16.398 Chr16 (712145..713827) [1683 bp, 560 aa] {ON} YPR111...    48   7e-05
NCAS0A09570 Chr1 complement(1907017..1909200) [2184 bp, 727 aa] ...    48   8e-05
YJL106W Chr10 (221390..223327) [1938 bp, 645 aa] {ON}  IME2Serin...    48   8e-05
KAFR0E02850 Chr5 (575512..576786) [1275 bp, 424 aa] {ON} Anc_8.4...    47   8e-05
Suva_7.375 Chr7 (643870..645591) [1722 bp, 573 aa] {ON} YGR092W ...    48   8e-05
NCAS0I02680 Chr9 (498371..500752) [2382 bp, 793 aa] {ON}               48   8e-05
NCAS0G01820 Chr7 complement(323288..325690) [2403 bp, 800 aa] {O...    48   8e-05
KAFR0C04280 Chr3 (848308..849912) [1605 bp, 534 aa] {ON} Anc_1.3...    47   8e-05
YNL307C Chr14 complement(56446..57573) [1128 bp, 375 aa] {ON}  M...    47   8e-05
Smik_4.135 Chr4 complement(256861..258402) [1542 bp, 513 aa] {ON...    47   9e-05
ZYRO0D03344g Chr4 complement(278347..280326) [1980 bp, 659 aa] {...    47   9e-05
Smik_10.132 Chr10 (212933..214873) [1941 bp, 646 aa] {ON} YJL106...    47   9e-05
ADR379C Chr4 complement(1386598..1388076) [1479 bp, 492 aa] {ON}...    47   9e-05
TDEL0D03950 Chr4 (720229..721710) [1482 bp, 493 aa] {ON} Anc_3.2...    47   9e-05
Smik_14.24 Chr14 complement(40883..42010) [1128 bp, 375 aa] {ON}...    47   9e-05
KLLA0A06820g Chr1 complement(615686..618004) [2319 bp, 772 aa] {...    47   9e-05
Skud_14.32 Chr14 complement(49930..51057) [1128 bp, 375 aa] {ON}...    47   9e-05
NDAI0A04760 Chr1 complement(1088637..1090103) [1467 bp, 488 aa] ...    47   9e-05
KNAG0F03730 Chr6 complement(697517..699586) [2070 bp, 689 aa] {O...    47   1e-04
Ecym_6425 Chr6 (825834..828095) [2262 bp, 753 aa] {ON} similar t...    47   1e-04
KNAG0J01950 Chr10 complement(352815..354317) [1503 bp, 500 aa] {...    47   1e-04
TPHA0G02800 Chr7 (597211..598722) [1512 bp, 503 aa] {ON} Anc_2.4...    47   1e-04
NCAS0C03770 Chr3 complement(761101..765897) [4797 bp, 1598 aa] {...    47   1e-04
ZYRO0F07370g Chr6 (595931..598219) [2289 bp, 762 aa] {ON} simila...    47   1e-04
Kpol_513.17 s513 (49097..50824) [1728 bp, 575 aa] {ON} (49097..5...    47   1e-04
Suva_14.32 Chr14 complement(52757..53884) [1128 bp, 375 aa] {ON}...    47   1e-04
AGL249C Chr7 complement(234347..236092) [1746 bp, 581 aa] {ON} S...    47   1e-04
SAKL0F06094g Chr6 (457709..459442) [1734 bp, 577 aa] {ON} unipro...    47   1e-04
KNAG0C02250 Chr3 complement(444156..446639) [2484 bp, 827 aa] {O...    47   1e-04
Kpol_1064.31 s1064 complement(52651..54350) [1700 bp, 566.666666...    47   1e-04
TBLA0D05640 Chr4 (1380616..1383066) [2451 bp, 816 aa] {ON} Anc_1...    47   1e-04
Kpol_YGOB_1064.31 s1064 complement(52620..54350) [1731 bp, 577 a...    47   1e-04
Ecym_2540 Chr2 (1048071..1049792) [1722 bp, 573 aa] {ON} similar...    47   1e-04
CAGL0B04147g Chr2 (402798..404498) [1701 bp, 566 aa] {ON} highly...    47   1e-04
Ecym_2357 Chr2 (700079..701914) [1836 bp, 611 aa] {ON} similar t...    47   1e-04
TBLA0B00770 Chr2 complement(168444..170519) [2076 bp, 691 aa] {O...    47   1e-04
SAKL0C06248g Chr3 complement(577990..580185) [2196 bp, 731 aa] {...    47   1e-04
TBLA0B06510 Chr2 (1536156..1538489) [2334 bp, 777 aa] {ON} Anc_1...    47   1e-04
NDAI0G06150 Chr7 (1519393..1521780) [2388 bp, 795 aa] {ON} Anc_1...    47   1e-04
Smik_16.420 Chr16 complement(725685..727658) [1974 bp, 657 aa] {...    47   1e-04
NCAS0C03560 Chr3 complement(710551..712476) [1926 bp, 641 aa] {O...    47   1e-04
NCAS0C02470 Chr3 complement(460460..461378,461483..461499) [936 ...    46   1e-04
KLLA0F17006g Chr6 complement(1561859..1563106) [1248 bp, 415 aa]...    47   1e-04
YGR092W Chr7 (668189..669907) [1719 bp, 572 aa] {ON}  DBF2Ser/Th...    47   1e-04
NDAI0C03900 Chr3 complement(883841..885310) [1470 bp, 489 aa] {O...    47   2e-04
SAKL0E04950g Chr5 (401903..402994) [1092 bp, 363 aa] {ON} highly...    46   2e-04
TPHA0G02480 Chr7 (509815..511860) [2046 bp, 681 aa] {ON} Anc_2.4...    47   2e-04
ZYRO0D02970g Chr4 complement(231363..233669) [2307 bp, 768 aa] {...    47   2e-04
Ecym_6400 Chr6 complement(779716..781983) [2268 bp, 755 aa] {ON}...    47   2e-04
Kpol_1035.17 s1035 complement(39908..41503) [1596 bp, 531 aa] {O...    47   2e-04
KAFR0A07560 Chr1 (1525225..1527504) [2280 bp, 759 aa] {ON} Anc_2...    47   2e-04
KAFR0H01460 Chr8 complement(269957..271705) [1749 bp, 582 aa] {O...    47   2e-04
Ecym_6092 Chr6 (178965..180299) [1335 bp, 444 aa] {ON} similar t...    46   2e-04
TDEL0G03220 Chr7 complement(600259..601350) [1092 bp, 363 aa] {O...    46   2e-04
KLLA0D11814g Chr4 complement(1007240..1009021) [1782 bp, 593 aa]...    47   2e-04
Ecym_3547 Chr3 complement(1034494..1036107) [1614 bp, 537 aa] {O...    47   2e-04
ZYRO0G20306g Chr7 complement(1675578..1677227) [1650 bp, 549 aa]...    47   2e-04
CAGL0K01617g Chr11 complement(143308..145632) [2325 bp, 774 aa] ...    47   2e-04
NDAI0E03170 Chr5 complement(677441..678392,678524..678543) [972 ...    46   2e-04
KNAG0F01240 Chr6 complement(223003..225591) [2589 bp, 862 aa] {O...    47   2e-04
KNAG0B04500 Chr2 (865766..869089) [3324 bp, 1107 aa] {ON} Anc_5....    47   2e-04
TPHA0I03100 Chr9 complement(681645..683666) [2022 bp, 673 aa] {O...    47   2e-04
KLLA0F02838g Chr6 (264329..266596) [2268 bp, 755 aa] {ON} simila...    47   2e-04
NDAI0E03080 Chr5 complement(653882..655798) [1917 bp, 638 aa] {O...    47   2e-04
AEL173W Chr5 (313261..314856) [1596 bp, 531 aa] {ON} Syntenic ho...    46   2e-04
KLLA0F08877g Chr6 (825217..826182) [966 bp, 321 aa] {ON} uniprot...    46   2e-04
KLTH0F18458g Chr6 complement(1491777..1493663) [1887 bp, 628 aa]...    46   2e-04
Ecym_6196 Chr6 (364576..365652) [1077 bp, 358 aa] {ON} similar t...    46   2e-04
ZYRO0F08272g Chr6 (668685..670508) [1824 bp, 607 aa] {ON} simila...    46   2e-04
SAKL0D06666g Chr4 (551260..552522) [1263 bp, 420 aa] {ON} some s...    46   2e-04
TPHA0G02090 Chr7 complement(429178..430527) [1350 bp, 449 aa] {O...    46   2e-04
KNAG0A01330 Chr1 complement(34784..35977) [1194 bp, 397 aa] {ON}...    46   2e-04
ZYRO0G05214g Chr7 (420482..422980) [2499 bp, 832 aa] {ON} some s...    47   2e-04
ZYRO0D07502g Chr4 complement(652782..654320) [1539 bp, 512 aa] {...    46   2e-04
Smik_14.167 Chr14 (311655..312284,312591..314228) [2268 bp, 755 ...    47   2e-04
CAGL0K04169g Chr11 (384567..385763) [1197 bp, 398 aa] {ON} simil...    46   2e-04
KAFR0B03170 Chr2 complement(656163..658025) [1863 bp, 620 aa] {O...    46   2e-04
TPHA0F02150 Chr6 complement(475516..477768) [2253 bp, 750 aa] {O...    46   2e-04
Kpol_463.19 s463 complement(53246..55561) [2316 bp, 771 aa] {ON}...    46   2e-04
KLTH0E11110g Chr5 (997486..998847) [1362 bp, 453 aa] {ON} simila...    46   2e-04
Smik_16.204 Chr16 complement(369272..370021) [750 bp, 249 aa] {O...    45   2e-04
YPR111W Chr16 (747306..749000) [1695 bp, 564 aa] {ON}  DBF20Ser/...    46   2e-04
YNL161W Chr14 (332597..334867) [2271 bp, 756 aa] {ON}  CBK1Serin...    46   2e-04
TBLA0B01990 Chr2 complement(458264..461623) [3360 bp, 1119 aa] {...    47   2e-04
KLLA0F23507g Chr6 complement(2198603..2200066) [1464 bp, 487 aa]...    46   2e-04
NCAS0A15040 Chr1 complement(2962030..2964036) [2007 bp, 668 aa] ...    46   2e-04
KLLA0B06501g Chr2 complement(576636..579089) [2454 bp, 817 aa] {...    46   2e-04
Skud_2.287 Chr2 (527443..528339) [897 bp, 298 aa] {ON} YBR160W (...    45   2e-04
KLLA0E10539g Chr5 (929989..931104) [1116 bp, 371 aa] {ON} highly...    46   2e-04
TDEL0B01470 Chr2 complement(257397..259169) [1773 bp, 590 aa] {O...    46   2e-04
SAKL0F15510g Chr6 complement(1251475..1253373) [1899 bp, 632 aa]...    46   2e-04
SAKL0E12342g Chr5 complement(1021369..1023795) [2427 bp, 808 aa]...    46   2e-04
KNAG0C02600 Chr3 complement(504486..507134) [2649 bp, 882 aa] {O...    46   2e-04
CAGL0G04455g Chr7 (426386..428641) [2256 bp, 751 aa] {ON} simila...    46   2e-04
ACR249C Chr3 complement(797020..798951) [1932 bp, 643 aa] {ON} S...    46   2e-04
Skud_15.519 Chr15 complement(932720..934216) [1497 bp, 498 aa] {...    46   2e-04
NDAI0A00940 Chr1 complement(193710..195800) [2091 bp, 696 aa] {O...    46   3e-04
NCAS0A04010 Chr1 complement(809163..810299) [1137 bp, 378 aa] {O...    45   3e-04
Kpol_1033.55 s1033 (138831..140555,140557..140895) [2064 bp, 687...    46   3e-04
Kpol_1056.20 s1056 complement(44529..46724) [2196 bp, 731 aa] {O...    46   3e-04
Suva_15.271 Chr15 complement(460466..463813) [3348 bp, 1115 aa] ...    46   3e-04
YBR160W Chr2 (560078..560974) [897 bp, 298 aa] {ON}  CDC28Cataly...    45   3e-04
Smik_6.178 Chr6 (291601..293322) [1722 bp, 573 aa] {ON} YGR092W ...    46   3e-04
NDAI0E01690 Chr5 (335849..337051) [1203 bp, 400 aa] {ON} Anc_2.391     45   3e-04
Smik_2.300 Chr2 (546211..547107) [897 bp, 298 aa] {ON} YBR160W (...    45   3e-04
TDEL0B01590 Chr2 complement(280143..281573) [1431 bp, 476 aa] {O...    46   3e-04
Skud_16.460 Chr16 complement(807116..809077) [1962 bp, 653 aa] {...    46   3e-04
ZYRO0F08074g Chr6 (654009..654025,654107..655004) [915 bp, 304 a...    45   3e-04
NCAS0A07990 Chr1 complement(1578473..1581346) [2874 bp, 957 aa] ...    46   3e-04
NCAS0G03420 Chr7 (628644..630668) [2025 bp, 674 aa] {ON} Anc_1.507     46   3e-04
KAFR0B00520 Chr2 (105553..107502) [1950 bp, 649 aa] {ON} Anc_4.1...    46   3e-04
Smik_7.115 Chr7 (201140..202663) [1524 bp, 507 aa] {ON} YGL158W ...    46   3e-04
Skud_14.172 Chr14 (323327..325564) [2238 bp, 745 aa] {ON} YNL161...    46   3e-04
AFR035W Chr6 (498529..500688) [2160 bp, 719 aa] {ON} Syntenic ho...    46   3e-04
Smik_11.97 Chr11 (168854..170491) [1638 bp, 545 aa] {ON} YKL139W...    46   3e-04
KLLA0C07535g Chr3 (658746..660620) [1875 bp, 624 aa] {ON} some s...    46   3e-04
Suva_16.491 Chr16 complement(848824..850794) [1971 bp, 656 aa] {...    46   3e-04
KLLA0A05819g Chr1 (541545..543659) [2115 bp, 704 aa] {ON} simila...    46   3e-04
TBLA0D00220 Chr4 (52218..54500) [2283 bp, 760 aa] {ON} Anc_2.96 ...    46   3e-04
Smik_4.157 Chr4 complement(289446..290605,290830..291250) [1581 ...    45   3e-04
YDL079C Chr4 complement(312951..314044,314337..314748) [1506 bp,...    45   3e-04
Ecym_2744 Chr2 complement(1442759..1444465) [1707 bp, 568 aa] {O...    45   3e-04
CAGL0L06820g Chr12 (769035..770135) [1101 bp, 366 aa] {ON} highl...    45   3e-04
Suva_4.145 Chr4 complement(268826..270370) [1545 bp, 514 aa] {ON...    45   4e-04
Skud_4.154 Chr4 complement(275783..277324) [1542 bp, 513 aa] {ON...    45   4e-04
YKL161C Chr11 complement(149386..150687) [1302 bp, 433 aa] {ON} ...    45   4e-04
NDAI0G01760 Chr7 (384420..385700) [1281 bp, 426 aa] {ON}               45   4e-04
KAFR0F01940 Chr6 complement(379908..382283) [2376 bp, 791 aa] {O...    45   4e-04
ZYRO0G20570g Chr7 (1695518..1697305) [1788 bp, 595 aa] {ON} simi...    45   4e-04
Smik_16.209 Chr16 complement(377965..379425) [1461 bp, 486 aa] {...    45   4e-04
CAGL0I06248g Chr9 (600351..602792) [2442 bp, 813 aa] {ON} simila...    45   4e-04
TDEL0F00840 Chr6 (144884..146875) [1992 bp, 663 aa] {ON} Anc_2.9...    45   4e-04
Skud_16.256 Chr16 complement(465728..467362) [1635 bp, 544 aa] {...    45   4e-04
Suva_16.291 Chr16 complement(504006..505433) [1428 bp, 475 aa] {...    45   4e-04
KLTH0D01386g Chr4 (129448..130053,130132..130974) [1449 bp, 482 ...    45   4e-04
SAKL0H06534g Chr8 complement(575439..577853) [2415 bp, 804 aa] {...    45   4e-04
TBLA0F01550 Chr6 complement(385184..386716) [1533 bp, 510 aa] {O...    45   4e-04
Suva_8.405 Chr8 complement(730738..732348) [1611 bp, 536 aa] {ON...    45   4e-04
KLLA0F01507g Chr6 (144356..145774) [1419 bp, 472 aa] {ON} some s...    45   4e-04
KNAG0F01440 Chr6 (261403..263685) [2283 bp, 760 aa] {ON}               45   5e-04
Suva_4.411 Chr4 (729465..730361) [897 bp, 298 aa] {ON} YBR160W (...    45   5e-04
Ecym_6056 Chr6 complement(107449..108888) [1440 bp, 479 aa] {ON}...    45   5e-04
NCAS0D00400 Chr4 complement(61545..63716) [2172 bp, 723 aa] {ON}...    45   5e-04
Smik_4.494 Chr4 (900954..902321) [1368 bp, 455 aa] {ON} YDR247W ...    45   5e-04
TDEL0A02010 Chr1 (365325..366782) [1458 bp, 485 aa] {ON} Anc_2.4...    45   5e-04
Kwal_26.8347 s26 complement(748254..750032) [1779 bp, 592 aa] {O...    45   5e-04
TBLA0B09590 Chr2 (2272405..2273328) [924 bp, 307 aa] {ON} Anc_2....    44   5e-04
KNAG0J01290 Chr10 complement(230493..232019) [1527 bp, 508 aa] {...    45   5e-04
Kpol_1042.20 s1042 (45090..47261) [2172 bp, 723 aa] {ON} (45090....    45   5e-04
CAGL0D02002g Chr4 (207419..209080) [1662 bp, 553 aa] {ON} simila...    45   6e-04
KLLA0D14905g Chr4 (1256065..1257768) [1704 bp, 567 aa] {ON} simi...    45   6e-04
Ecym_7206 Chr7 complement(423402..425576) [2175 bp, 724 aa] {ON}...    45   6e-04
TPHA0F03520 Chr6 (755480..757756) [2277 bp, 758 aa] {ON} Anc_1.5...    45   6e-04
KAFR0H02430 Chr8 complement(464446..466800) [2355 bp, 784 aa] {O...    45   6e-04
TPHA0A04570 Chr1 (1038551..1040674) [2124 bp, 707 aa] {ON} Anc_1...    45   6e-04
SAKL0C05280g Chr3 complement(502205..504490) [2286 bp, 761 aa] {...    45   6e-04
TPHA0A03700 Chr1 complement(808996..813273) [4278 bp, 1425 aa] {...    45   6e-04
YGL158W Chr7 (207033..208571) [1539 bp, 512 aa] {ON}  RCK1Protei...    45   6e-04
Skud_4.176 Chr4 complement(308461..309594) [1134 bp, 377 aa] {ON...    44   6e-04
KLLA0D07810g Chr4 complement(669095..671251) [2157 bp, 718 aa] {...    45   6e-04
TBLA0A01630 Chr1 complement(385348..386386,386496..386512) [1056...    44   7e-04
ABR177C Chr2 complement(735829..738090) [2262 bp, 753 aa] {ON} S...    45   7e-04
KLLA0E11947g Chr5 complement(1060048..1061892) [1845 bp, 614 aa]...    45   7e-04
NCAS0C01370 Chr3 complement(250693..253092) [2400 bp, 799 aa] {O...    45   7e-04
TBLA0H02950 Chr8 complement(721123..723906) [2784 bp, 927 aa] {O...    45   7e-04
Suva_2.157 Chr2 complement(275484..277064) [1581 bp, 526 aa] {ON...    45   7e-04
Kpol_1060.53 s1060 complement(126120..128330) [2211 bp, 736 aa] ...    45   7e-04
ADR253W Chr4 (1141941..1143083) [1143 bp, 380 aa] {ON} Syntenic ...    44   7e-04
NDAI0G06240 Chr7 (1546580..1549282) [2703 bp, 900 aa] {ON} Anc_1...    45   8e-04
Skud_2.141 Chr2 complement(264097..265677) [1581 bp, 526 aa] {ON...    44   8e-04
KLTH0E09658g Chr5 (869857..870957) [1101 bp, 366 aa] {ON} highly...    44   8e-04
Kwal_26.8796 s26 (946406..948796) [2391 bp, 796 aa] {ON} YPL153C...    45   8e-04
TPHA0A02770 Chr1 complement(597703..600129) [2427 bp, 808 aa] {O...    45   8e-04
TBLA0A07770 Chr1 complement(1916632..1917939) [1308 bp, 435 aa] ...    44   8e-04
KLLA0B11924g Chr2 complement(1043344..1047582) [4239 bp, 1412 aa...    45   9e-04
Kpol_1014.8 s1014 (13007..14368) [1362 bp, 453 aa] {ON} (13007.....    44   9e-04
ACR142W Chr3 (597519..600032) [2514 bp, 837 aa] {ON} Syntenic ho...    44   9e-04
KLTH0F12012g Chr6 complement(1013169..1014881) [1713 bp, 570 aa]...    44   9e-04
KAFR0K02490 Chr11 (515669..518356) [2688 bp, 895 aa] {ON} Anc_5....    44   9e-04
KAFR0A07370 Chr1 complement(1487868..1490012) [2145 bp, 714 aa] ...    44   0.001
Smik_8.156 Chr8 complement(234928..238269) [3342 bp, 1113 aa] {O...    44   0.001
Suva_14.178 Chr14 (328862..331195) [2334 bp, 777 aa] {ON} YNL161...    44   0.001
TDEL0E02600 Chr5 (501545..504934) [3390 bp, 1129 aa] {ON} Anc_5....    44   0.001
TDEL0D01220 Chr4 complement(228529..230451) [1923 bp, 640 aa] {O...    44   0.001
NDAI0E03760 Chr5 (817014..818765) [1752 bp, 583 aa] {ON} Anc_7.41      44   0.001
Suva_16.157 Chr16 complement(270891..273389) [2499 bp, 832 aa] {...    44   0.001
CAGL0J06072g Chr10 complement(574501..576822) [2322 bp, 773 aa] ...    44   0.001
YBR028C Chr2 complement(294425..296002) [1578 bp, 525 aa] {ON}  ...    44   0.001
Kwal_23.3992 s23 complement(515493..517208) [1716 bp, 571 aa] {O...    44   0.001
TPHA0B01010 Chr2 complement(229538..231634) [2097 bp, 698 aa] {O...    44   0.001
KAFR0D04500 Chr4 (887515..889989) [2475 bp, 824 aa] {ON} Anc_1.5...    44   0.001
Smik_11.60 Chr11 complement(116793..118970) [2178 bp, 725 aa] {O...    44   0.001
KLLA0D12100g Chr4 complement(1031728..1033161) [1434 bp, 477 aa]...    44   0.001
CAGL0H09152g Chr8 complement(895722..898055) [2334 bp, 777 aa] {...    44   0.001
KLLA0F24618g Chr6 complement(2288943..2290613) [1671 bp, 556 aa]...    44   0.001
Ecym_8098 Chr8 (210698..212857) [2160 bp, 719 aa] {ON} similar t...    44   0.001
NDAI0B04530 Chr2 complement(1128472..1130094) [1623 bp, 540 aa] ...    44   0.001
Kpol_529.18 s529 (52782..55118) [2337 bp, 778 aa] {ON} (52782..5...    44   0.001
TPHA0N01450 Chr14 complement(318088..320340) [2253 bp, 750 aa] {...    44   0.001
NDAI0H03460 Chr8 complement(836849..838726) [1878 bp, 625 aa] {O...    44   0.001
KLLA0F01408g Chr6 (135424..136302) [879 bp, 292 aa] {ON} conserv...    43   0.001
KAFR0F02710 Chr6 (528336..529493) [1158 bp, 385 aa] {ON} Anc_2.3...    43   0.001
KLLA0D10527g Chr4 (892955..894892) [1938 bp, 645 aa] {ON} simila...    44   0.001
AFR205C Chr6 complement(805580..806953) [1374 bp, 457 aa] {ON} S...    44   0.001
TBLA0B08810 Chr2 (2094401..2095375) [975 bp, 324 aa] {ON} Anc_2....    43   0.001
KAFR0A01340 Chr1 (259300..261171) [1872 bp, 623 aa] {ON} Anc_1.2...    44   0.002
SAKL0B04752g Chr2 (416940..418259) [1320 bp, 439 aa] {ON} weakly...    43   0.002
Smik_6.350 Chr6 (559997..562465) [2469 bp, 822 aa] {ON} YPL153C ...    44   0.002
NCAS0E02230 Chr5 (429499..430176,430250..431104) [1533 bp, 510 a...    44   0.002
KNAG0J02520 Chr10 (472464..476795) [4332 bp, 1443 aa] {ON} Anc_3...    44   0.002
Smik_2.146 Chr2 complement(275270..276850) [1581 bp, 526 aa] {ON...    44   0.002
Kpol_1037.52 s1037 complement(128841..130379) [1539 bp, 512 aa] ...    44   0.002
CAGL0B04301g Chr2 (420544..422172) [1629 bp, 542 aa] {ON} simila...    44   0.002
Skud_7.114 Chr7 (211645..213153) [1509 bp, 502 aa] {ON} YGL158W ...    43   0.002
Suva_16.274 Chr16 complement(476249..477916) [1668 bp, 555 aa] {...    44   0.002
Kwal_14.1249 s14 (252877..253911) [1035 bp, 344 aa] {ON} YFL029C...    43   0.002
Kpol_1072.16 s1072 complement(37585..39972) [2388 bp, 795 aa] {O...    44   0.002
KAFR0F00380 Chr6 complement(91358..92800) [1443 bp, 480 aa] {ON}...    43   0.002
NDAI0F03200 Chr6 complement(770618..772924) [2307 bp, 768 aa] {O...    44   0.002
TDEL0H00560 Chr8 (94614..96500) [1887 bp, 628 aa] {ON} Anc_7.515...    44   0.002
Skud_4.509 Chr4 (910551..911945) [1395 bp, 464 aa] {ON} YDR247W ...    43   0.002
Kwal_33.13225 s33 (127676..130570) [2895 bp, 964 aa] {ON} YFR016...    44   0.002
AEL083W Chr5 (470964..472574) [1611 bp, 536 aa] {ON} Syntenic ho...    43   0.002
TPHA0E02270 Chr5 (471696..472916) [1221 bp, 406 aa] {ON} Anc_5.2...    43   0.002
Ecym_6301 Chr6 complement(566248..567324) [1077 bp, 358 aa] {ON}...    43   0.002
Skud_16.239 Chr16 complement(438063..439727) [1665 bp, 554 aa] {...    43   0.002
YPL042C Chr16 complement(473040..474707) [1668 bp, 555 aa] {ON} ...    43   0.002
TPHA0O01080 Chr15 complement(205407..207653) [2247 bp, 748 aa] {...    43   0.002
Kwal_55.21900 s55 complement(1027253..1029130) [1878 bp, 625 aa]...    43   0.002
NDAI0C03610 Chr3 (829317..831476) [2160 bp, 719 aa] {ON} Anc_5.38      43   0.002
KLLA0F26983g Chr6 (2489326..2490729) [1404 bp, 467 aa] {ON} some...    43   0.002
Kwal_27.11803 s27 (952938..953678) [741 bp, 246 aa] {ON} YPL031C...    42   0.002
Skud_8.139 Chr8 complement(232178..235534) [3357 bp, 1118 aa] {O...    44   0.002
Kpol_1002.21 s1002 complement(62702..63895) [1194 bp, 397 aa] {O...    43   0.002
AFR040W Chr6 (505602..507245) [1644 bp, 547 aa] {ON} Syntenic ho...    43   0.002
NCAS0D01230 Chr4 complement(225213..226661) [1449 bp, 482 aa] {O...    43   0.002
Kpol_1045.46 s1045 complement(106567..108372) [1806 bp, 601 aa] ...    43   0.002
NCAS0C02390 Chr3 complement(446642..448468) [1827 bp, 608 aa] {O...    43   0.002
NDAI0C05160 Chr3 (1199533..1201026) [1494 bp, 497 aa] {ON} Anc_8...    43   0.002
KAFR0F02190 Chr6 (428623..430095) [1473 bp, 490 aa] {ON} Anc_3.1...    43   0.002
Skud_7.391 Chr7 (652479..654200) [1722 bp, 573 aa] {ON} YGR092W ...    43   0.002
TDEL0F00530 Chr6 complement(88187..90517) [2331 bp, 776 aa] {ON}...    43   0.002
NDAI0F03150 Chr6 complement(757283..758923) [1641 bp, 546 aa] {O...    43   0.002
Kpol_209.1 s209 (1823..5734) [3912 bp, 1303 aa] {ON} (1823..5734...    43   0.002
KLLA0E14785g Chr5 complement(1323743..1324675) [933 bp, 310 aa] ...    42   0.002
Suva_13.481 Chr13 (834531..836279) [1749 bp, 582 aa] {ON} YMR291...    43   0.002
NCAS0G02070 Chr7 (372747..374960) [2214 bp, 737 aa] {ON} Anc_2.96      43   0.002
Kwal_14.2497 s14 complement(784224..785480) [1257 bp, 418 aa] {O...    42   0.003
Suva_13.319 Chr13 (525309..526421) [1113 bp, 370 aa] {ON} YMR139...    42   0.003
Suva_11.86 Chr11 (169096..170685) [1590 bp, 529 aa] {ON} YKL139W...    43   0.003
CAGL0H10318g Chr8 complement(1006299..1007222) [924 bp, 307 aa] ...    42   0.003
KLLA0E12145g Chr5 (1080245..1081612) [1368 bp, 455 aa] {ON} simi...    43   0.003
Smik_16.193 Chr16 complement(350311..351978) [1668 bp, 555 aa] {...    43   0.003
KAFR0I01570 Chr9 (330982..332574) [1593 bp, 530 aa] {ON} Anc_2.5...    43   0.003
KAFR0G01670 Chr7 (363200..367459) [4260 bp, 1419 aa] {ON} Anc_3....    43   0.003
YKL139W Chr11 (182958..184544) [1587 bp, 528 aa] {ON}  CTK1Catal...    43   0.003
TPHA0H01880 Chr8 (441140..442402) [1263 bp, 420 aa] {ON} Anc_6.2...    42   0.003
YBR097W Chr2 (436951..441315) [4365 bp, 1454 aa] {ON}  VPS15Myri...    43   0.003
SAKL0G08448g Chr7 (718250..721717) [3468 bp, 1155 aa] {ON} simil...    43   0.003
TPHA0L01240 Chr12 (263357..264814) [1458 bp, 485 aa] {ON} Anc_8....    42   0.003
Smik_13.338 Chr13 (528578..529690) [1113 bp, 370 aa] {ON} YMR139...    42   0.003
KAFR0A06790 Chr1 complement(1371892..1372806) [915 bp, 304 aa] {...    42   0.003
NDAI0C00570 Chr3 (108274..110547) [2274 bp, 757 aa] {ON}               43   0.003
TBLA0F00860 Chr6 (219628..222570) [2943 bp, 980 aa] {ON} Anc_3.1...    43   0.003
NDAI0H01020 Chr8 complement(225366..228566) [3201 bp, 1066 aa] {...    43   0.003
TBLA0I01800 Chr9 complement(401728..403617) [1890 bp, 629 aa] {O...    42   0.003
NDAI0A07790 Chr1 (1790683..1795206) [4524 bp, 1507 aa] {ON} Anc_...    43   0.003
YMR139W Chr13 (546125..547237) [1113 bp, 370 aa] {ON}  RIM11Prot...    42   0.004
YHR079C Chr8 complement(258244..261591) [3348 bp, 1115 aa] {ON} ...    42   0.004
Kwal_YGOB_23.3471 s23 (305207..305234,305298..306196) [927 bp, 3...    42   0.004
Suva_11.52 Chr11 (112355..115156) [2802 bp, 933 aa] {ON} YKL171W...    42   0.004
NCAS0H01740 Chr8 complement(331436..335284) [3849 bp, 1282 aa] {...    42   0.004
NCAS0A04220 Chr1 (855791..857353) [1563 bp, 520 aa] {ON} Anc_2.425     42   0.004
Kwal_23.3471 s23 (305414..306196) [783 bp, 260 aa] {OFF} YDL108W...    41   0.004
KAFR0C05130 Chr3 (1018035..1019402) [1368 bp, 455 aa] {ON} Anc_7...    42   0.004
Suva_10.345 Chr10 (601536..603365) [1830 bp, 609 aa] {ON} YLR248...    42   0.004
Kwal_55.20221 s55 (304482..308006) [3525 bp, 1174 aa] {ON} YHR07...    42   0.004
NCAS0B07200 Chr2 complement(1363351..1364940) [1590 bp, 529 aa] ...    42   0.004
YPL153C Chr16 complement(261727..264192) [2466 bp, 821 aa] {ON} ...    42   0.004
Smik_14.174 Chr14 complement(323054..324709) [1656 bp, 551 aa] {...    42   0.004
CAGL0G06138g Chr7 complement(585585..587204) [1620 bp, 539 aa] {...    42   0.004
TPHA0H01470 Chr8 complement(329451..333578) [4128 bp, 1375 aa] {...    42   0.004
NCAS0G02120 Chr7 (381894..383465) [1572 bp, 523 aa] {ON} Anc_2.105     42   0.004
Kpol_1018.148 s1018 (393064..394413) [1350 bp, 449 aa] {ON} (393...    42   0.005
Ecym_6294 Chr6 complement(551351..552982) [1632 bp, 543 aa] {ON}...    42   0.005
Smik_10.349 Chr10 (534756..537209) [2454 bp, 817 aa] {ON} YJR059...    42   0.005
SAKL0C08844g Chr3 (811712..813307) [1596 bp, 531 aa] {ON} simila...    42   0.005
KLTH0F09504g Chr6 (824743..824770,824831..825729) [927 bp, 308 a...    41   0.005
KAFR0A00840 Chr1 complement(151896..152894) [999 bp, 332 aa] {ON...    41   0.005
Kwal_56.22788 s56 complement(281404..282951) [1548 bp, 515 aa] {...    42   0.005
Kpol_1027.20 s1027 complement(43412..44974) [1563 bp, 520 aa] {O...    42   0.005
Suva_4.344 Chr4 (606007..610371) [4365 bp, 1454 aa] {ON} YBR097W...    42   0.006
Kwal_47.17868 s47 (587449..588546) [1098 bp, 365 aa] {ON} YMR139...    41   0.006
KLTH0E03828g Chr5 (345775..349131) [3357 bp, 1118 aa] {ON} simil...    42   0.006
Kpol_534.14 s534 (34465..34591,34724..35616) [1020 bp, 339 aa] {...    41   0.006
CAGL0J04972g Chr10 (475587..476606) [1020 bp, 339 aa] {ON} some ...    41   0.006
KNAG0A05920 Chr1 complement(883522..884742) [1221 bp, 406 aa] {O...    41   0.006
Skud_11.88 Chr11 (169115..170659) [1545 bp, 514 aa] {ON} YKL139W...    42   0.006
Skud_13.300 Chr13 (519521..520633) [1113 bp, 370 aa] {ON} YMR139...    41   0.006
KLTH0D04356g Chr4 (405904..405987,406076..407401) [1410 bp, 469 ...    41   0.006
KLTH0C08932g Chr3 (749308..750867) [1560 bp, 519 aa] {ON} simila...    42   0.006
AEL179W Chr5 (302948..303817) [870 bp, 289 aa] {ON} NOHBY510; No...    41   0.006
Suva_16.433 Chr16 (747883..749205) [1323 bp, 440 aa] {ON} YPR106...    41   0.007
Smik_4.128 Chr4 (244339..244354,244439..245331) [909 bp, 302 aa]...    41   0.007
CAGL0F00649g Chr6 (71961..73505) [1545 bp, 514 aa] {ON} similar ...    41   0.007
Suva_15.332 Chr15 complement(575263..575547,575959..576084,57614...    41   0.007
YJR059W Chr10 (545787..548243) [2457 bp, 818 aa] {ON}  PTK2Putat...    42   0.007
Ecym_3371 Chr3 (706573..706597,706675..707570) [921 bp, 306 aa] ...    41   0.007
Suva_4.168 Chr4 complement(302527..303654) [1128 bp, 375 aa] {ON...    41   0.007
Kwal_26.7552 s26 (416444..417829) [1386 bp, 461 aa] {ON} YKL139W...    41   0.007
Suva_11.24 Chr11 complement(52742..52930,52961..54523) [1752 bp,...    41   0.007
NDAI0B03310 Chr2 complement(844616..845557) [942 bp, 313 aa] {ON...    41   0.007
TPHA0G01600 Chr7 complement(329313..331850) [2538 bp, 845 aa] {O...    41   0.008
NDAI0J00420 Chr10 (73312..75606) [2295 bp, 764 aa] {ON} Anc_7.515      41   0.008
NDAI0E01960 Chr5 (397897..399717) [1821 bp, 606 aa] {ON} Anc_2.425     41   0.008
SAKL0E12100g Chr5 complement(1004036..1005622) [1587 bp, 528 aa]...    41   0.008
Kpol_2001.31 s2001 complement(90402..93110) [2709 bp, 902 aa] {O...    41   0.008
ZYRO0G05412g Chr7 (435657..437408) [1752 bp, 583 aa] {ON} simila...    41   0.008
TPHA0I01240 Chr9 (283537..285210) [1674 bp, 557 aa] {ON} Anc_2.1...    41   0.008
SAKL0B11044g Chr2 complement(962142..962940,963019..963086,96315...    41   0.008
CAGL0M13541g Chr13 (1333846..1335714) [1869 bp, 622 aa] {ON} sim...    41   0.008
TBLA0J00250 Chr10 (42058..44457) [2400 bp, 799 aa] {ON} Anc_7.51...    41   0.008
Suva_14.185 Chr14 complement(340104..341789) [1686 bp, 561 aa] {...    41   0.009
SAKL0D08294g Chr4 (692455..693966) [1512 bp, 503 aa] {ON} some s...    41   0.009
KAFR0E00330 Chr5 complement(74619..76574) [1956 bp, 651 aa] {ON}...    41   0.009
TBLA0D02510 Chr4 complement(626101..627234) [1134 bp, 377 aa] {O...    41   0.009
YNL154C Chr14 complement(343636..345276) [1641 bp, 546 aa] {ON} ...    41   0.009
Skud_14.179 Chr14 complement(334239..335924) [1686 bp, 561 aa] {...    41   0.009
Skud_16.129 Chr16 complement(233341..235824) [2484 bp, 827 aa] {...    41   0.010
SAKL0B11308g Chr2 complement(984543..986369) [1827 bp, 608 aa] {...    41   0.010
KNAG0I00590 Chr9 (100275..102068) [1794 bp, 597 aa] {ON}               41   0.010
TPHA0C04650 Chr3 complement(1006190..1007119) [930 bp, 309 aa] {...    40   0.010
KLLA0D11044g Chr4 complement(942458..944068) [1611 bp, 536 aa] {...    41   0.010
Suva_6.246 Chr6 (439815..442373) [2559 bp, 852 aa] {ON} YJL165C ...    41   0.010
CAGL0I09504g Chr9 (909589..911175) [1587 bp, 528 aa] {ON} simila...    41   0.010
ADR163W Chr4 (989728..991008) [1281 bp, 426 aa] {ON} Syntenic ho...    40   0.010
Suva_4.138 Chr4 (256421..257197) [777 bp, 258 aa] {ON} YDL108W (...    40   0.011
Skud_4.146 Chr4 (263181..263196,263281..264173) [909 bp, 302 aa]...    40   0.011
KNAG0I03000 Chr9 (596789..598840) [2052 bp, 683 aa] {ON} Anc_4.4...    41   0.011
TBLA0D00250 Chr4 (61918..63618) [1701 bp, 566 aa] {ON} Anc_2.105...    41   0.011
Skud_8.196 Chr8 complement(346056..346463,346494..347684) [1599 ...    40   0.011
CAGL0J05940g Chr10 (562687..564147) [1461 bp, 486 aa] {ON} simil...    40   0.012
TBLA0B09215 Chr2 complement(2180179..2181375) [1197 bp, 398 aa] ...    40   0.012
NDAI0C01890 Chr3 (419452..423777) [4326 bp, 1441 aa] {ON} Anc_5....    41   0.012
Suva_2.413 Chr2 (735541..736923) [1383 bp, 460 aa] {ON} YDR247W ...    40   0.012
Smik_8.216 Chr8 complement(349478..351145) [1668 bp, 555 aa] {ON...    40   0.013
YHR135C Chr8 complement(372694..374310) [1617 bp, 538 aa] {ON}  ...    40   0.013
NDAI0E02110 Chr5 complement(430989..433700) [2712 bp, 903 aa] {O...    40   0.013
NDAI0A04040 Chr1 complement(907696..910041) [2346 bp, 781 aa] {O...    40   0.014
KLLA0D13266g Chr4 complement(1137750..1141208) [3459 bp, 1152 aa...    40   0.015
AGR334W Chr7 (1355098..1356693) [1596 bp, 531 aa] {ON} Syntenic ...    40   0.015
YDL108W Chr4 (267698..267725,267807..268699) [921 bp, 306 aa] {O...    40   0.015
NCAS0A12200 Chr1 (2417539..2419782) [2244 bp, 747 aa] {ON} Anc_1...    40   0.016
ZYRO0D01584g Chr4 (124739..126688) [1950 bp, 649 aa] {ON} some s...    40   0.016
KAFR0A07320 Chr1 complement(1478564..1480033) [1470 bp, 489 aa] ...    40   0.016
CAGL0M02233g Chr13 complement(267332..269635) [2304 bp, 767 aa] ...    40   0.017
KLTH0B06204g Chr2 complement(502282..503778) [1497 bp, 498 aa] {...    40   0.019
CAGL0M13167g Chr13 complement(1293074..1294906) [1833 bp, 610 aa...    40   0.020
NDAI0D01450 Chr4 (339780..341948) [2169 bp, 722 aa] {ON} Anc_1.507     40   0.020
TPHA0A02760 Chr1 (594482..597502) [3021 bp, 1006 aa] {ON} Anc_1....    40   0.021
KNAG0D02790 Chr4 (507235..508848) [1614 bp, 537 aa] {ON} Anc_5.3...    40   0.022
CAGL0H01837g Chr8 complement(176352..178736) [2385 bp, 794 aa] {...    40   0.022
NCAS0I01210 Chr9 complement(218242..222582) [4341 bp, 1446 aa] {...    40   0.025
TDEL0B06900 Chr2 complement(1220590..1222257) [1668 bp, 555 aa] ...    40   0.025
AEL120W Chr5 (396394..398715) [2322 bp, 773 aa] {ON} Syntenic ho...    40   0.026
ZYRO0G04488g Chr7 complement(360635..362545) [1911 bp, 636 aa] {...    40   0.026
CAGL0M08316g Chr13 (829069..831963) [2895 bp, 964 aa] {ON} weakl...    40   0.026
Kwal_33.14596 s33 (735962..737464) [1503 bp, 500 aa] {ON} YNL154...    39   0.026
Skud_10.283 Chr10 (503324..505765) [2442 bp, 813 aa] {ON} YJR059...    40   0.026
TBLA0A03220 Chr1 complement(765108..768590) [3483 bp, 1160 aa] {...    40   0.026
TDEL0F00910 Chr6 (157379..159070) [1692 bp, 563 aa] {ON} Anc_2.1...    39   0.027
NDAI0H03740 Chr8 (912611..915373) [2763 bp, 920 aa] {ON} Anc_2.71      40   0.027
TBLA0D03740 Chr4 complement(926538..929057) [2520 bp, 839 aa] {O...    40   0.027
Suva_12.148 Chr12 (223571..225982) [2412 bp, 804 aa] {ON} YJR059...    40   0.028
Skud_10.49 Chr10 complement(81651..84206) [2556 bp, 851 aa] {ON}...    40   0.029
KAFR0D04760 Chr4 complement(932849..936205) [3357 bp, 1118 aa] {...    40   0.029
KLTH0H11858g Chr8 (1013677..1015374) [1698 bp, 565 aa] {ON} some...    39   0.030
Skud_16.391 Chr16 (704392..705723) [1332 bp, 443 aa] {ON} YPR106...    39   0.030
Ecym_8100 Chr8 complement(214001..216547) [2547 bp, 848 aa] {ON}...    39   0.031
Suva_6.29 Chr6 complement(51588..52691) [1104 bp, 367 aa] {ON} Y...    39   0.032
ZYRO0C15884g Chr3 (1241605..1245873) [4269 bp, 1422 aa] {ON} sim...    39   0.033
Smik_10.65 Chr10 complement(104987..107545) [2559 bp, 852 aa] {O...    39   0.035
SAKL0B01474g Chr2 complement(145734..146777) [1044 bp, 347 aa] {...    39   0.036
NCAS0B02530 Chr2 complement(422882..424207) [1326 bp, 441 aa] {O...    39   0.038
YJL165C Chr10 complement(106894..109461) [2568 bp, 855 aa] {ON} ...    39   0.038
YLL019C Chr12 complement(105686..107899) [2214 bp, 737 aa] {ON} ...    39   0.038
Smik_2.239 Chr2 (421843..426207) [4365 bp, 1454 aa] {ON} YBR097W...    39   0.039
YKL171W Chr11 (127475..130261) [2787 bp, 928 aa] {ON}  NNK1Prote...    39   0.039
ZYRO0A07062g Chr1 (576600..576615,576675..577561) [903 bp, 300 a...    39   0.040
SAKL0E06534g Chr5 complement(533369..534267,534334..534358) [924...    39   0.040
KNAG0B00260 Chr2 complement(36240..38477) [2238 bp, 745 aa] {ON}...    39   0.040
CAGL0B03509g Chr2 complement(349638..351431) [1794 bp, 597 aa] {...    39   0.040
KAFR0B01510 Chr2 complement(284425..286092) [1668 bp, 555 aa] {O...    39   0.040
ADL283W Chr4 (205173..205197,205250..206145) [921 bp, 306 aa] {O...    38   0.044
KNAG0E00360 Chr5 (54187..55563) [1377 bp, 458 aa] {ON}                 39   0.046
KLTH0D08712g Chr4 complement(728072..729886) [1815 bp, 604 aa] {...    39   0.047
ABR088C Chr2 complement(546325..547920) [1596 bp, 531 aa] {ON} S...    39   0.047
TDEL0C00660 Chr3 complement(107849..108952) [1104 bp, 367 aa] {O...    39   0.048
KLTH0F04686g Chr6 (413669..416209) [2541 bp, 846 aa] {ON} weakly...    39   0.048
KAFR0C03480 Chr3 (708186..709277) [1092 bp, 363 aa] {ON} Anc_8.4...    38   0.050
NCAS0C01030 Chr3 (192001..194043) [2043 bp, 680 aa] {ON} Anc_8.732     39   0.051
Ecym_4773 Chr4 complement(1504949..1506541) [1593 bp, 530 aa] {O...    39   0.052
CAGL0D02244g Chr4 complement(229504..230967) [1464 bp, 487 aa] {...    39   0.052
Smik_9.156 Chr9 complement(261998..263116) [1119 bp, 372 aa] {ON...    38   0.054
SAKL0C05236g Chr3 (498347..501385) [3039 bp, 1012 aa] {ON} simil...    39   0.054
KAFR0F00520 Chr6 (111106..112659) [1554 bp, 517 aa] {ON} Anc_2.1...    39   0.054
Skud_9.134 Chr9 complement(256610..257728) [1119 bp, 372 aa] {ON...    38   0.056
YFL029C Chr6 complement(78055..79161) [1107 bp, 368 aa] {ON}  CA...    38   0.056
Suva_9.165 Chr9 complement(276469..277587) [1119 bp, 372 aa] {ON...    38   0.058
Skud_12.48 Chr12 complement(97218..99422) [2205 bp, 734 aa] {ON}...    39   0.062
ZYRO0D10472g Chr4 (876899..880357) [3459 bp, 1152 aa] {ON} simil...    39   0.062
TPHA0C01810 Chr3 complement(413495..414790) [1296 bp, 431 aa] {O...    38   0.063
NCAS0B06000 Chr2 complement(1134919..1135808,1135909..1135957) [...    38   0.065
Kwal_33.13825 s33 (409772..412477) [2706 bp, 901 aa] {ON} YKL171...    38   0.070
KNAG0G00280 Chr7 complement(43196..45262) [2067 bp, 688 aa] {ON}...    38   0.071
KNAG0F01490 Chr6 (270931..272604) [1674 bp, 557 aa] {ON} Anc_2.1...    38   0.077
TBLA0J01000 Chr10 complement(227869..231072) [3204 bp, 1067 aa] ...    38   0.081
TPHA0A05460 Chr1 (1233608..1235170) [1563 bp, 520 aa] {ON} Anc_5...    38   0.084
YIL035C Chr9 complement(287790..288908) [1119 bp, 372 aa] {ON}  ...    38   0.084
KNAG0A05580 Chr1 (830643..831560) [918 bp, 305 aa] {ON} Anc_2.33...    37   0.085
Kpol_1013.52 s1013 (123332..125881) [2550 bp, 849 aa] {ON} (1233...    38   0.088
ZYRO0G08316g Chr7 (677123..679465) [2343 bp, 780 aa] {ON} simila...    38   0.092
KNAG0H03710 Chr8 complement(687550..689184) [1635 bp, 544 aa] {O...    38   0.093
TDEL0G02620 Chr7 (501589..501613,501677..502566) [915 bp, 304 aa...    37   0.093
TPHA0J02290 Chr10 (508389..510779) [2391 bp, 796 aa] {ON} Anc_6....    38   0.097
YKL198C Chr11 complement(68232..70220) [1989 bp, 662 aa] {ON}  P...    38   0.097
Skud_11.20 Chr11 complement(51603..53558) [1956 bp, 651 aa] {ON}...    38   0.097
Skud_2.225 Chr2 (405095..409459) [4365 bp, 1454 aa] {ON} YBR097W...    38   0.099
Skud_12.329 Chr12 (580813..582645) [1833 bp, 610 aa] {ON} YLR248...    38   0.10 
KNAG0K01710 Chr11 (360438..361931) [1494 bp, 497 aa] {ON} Anc_3....    37   0.10 
TBLA0C06190 Chr3 complement(1501660..1503108) [1449 bp, 482 aa] ...    37   0.10 
TBLA0D05210 Chr4 (1279846..1282323) [2478 bp, 825 aa] {ON} Anc_1...    38   0.11 
KLTH0D12518g Chr4 complement(1023214..1024992) [1779 bp, 592 aa]...    37   0.11 
KNAG0H02860 Chr8 (531728..532843) [1116 bp, 371 aa] {ON}               37   0.12 
KNAG0A04080 Chr1 complement(551409..552635) [1227 bp, 408 aa] {O...    37   0.12 
ZYRO0A03894g Chr1 (307915..309273) [1359 bp, 452 aa] {ON} simila...    37   0.12 
KLTH0G18282g Chr7 complement(1576512..1577558) [1047 bp, 348 aa]...    37   0.13 
NDAI0G03150 Chr7 complement(741321..742463) [1143 bp, 380 aa] {O...    37   0.13 
TBLA0A06660 Chr1 complement(1626147..1630400) [4254 bp, 1417 aa]...    37   0.14 
YJL057C Chr10 complement(328118..330121) [2004 bp, 667 aa] {ON} ...    37   0.15 
NCAS0G00490 Chr7 complement(83953..84996) [1044 bp, 347 aa] {ON}...    37   0.15 
CAGL0K11275g Chr11 (1094626..1096203) [1578 bp, 525 aa] {ON} sim...    37   0.16 
Smik_11.24 Chr11 complement(52600..54522) [1923 bp, 640 aa] {ON}...    37   0.16 
ZYRO0G18590g Chr7 complement(1533974..1536202) [2229 bp, 742 aa]...    37   0.16 
Skud_11.67 Chr11 complement(135815..137341) [1527 bp, 508 aa] {O...    37   0.16 
CAGL0H08437g Chr8 complement(825191..829423) [4233 bp, 1410 aa] ...    37   0.17 
Smik_11.58 Chr11 (112932..115715) [2784 bp, 927 aa] {ON} YKL171W...    37   0.17 
SAKL0B07326g Chr2 (627224..631477) [4254 bp, 1417 aa] {ON} simil...    37   0.18 
Ecym_3487 Chr3 complement(910575..914810) [4236 bp, 1411 aa] {ON...    37   0.19 
Kpol_1065.6 s1065 (12266..12916,12918..13280,13332..13340,13394....    37   0.22 
ZYRO0D04752g Chr4 complement(397364..398215,398290..398907) [147...    37   0.22 
KLTH0H10582g Chr8 (914695..916440) [1746 bp, 581 aa] {ON} weakly...    37   0.23 
AAL029W Chr1 (289989..291593) [1605 bp, 534 aa] {ON} Syntenic ho...    36   0.23 
SAKL0H01364g Chr8 complement(143450..145141) [1692 bp, 563 aa] {...    37   0.23 
YPR106W Chr16 (740061..741392) [1332 bp, 443 aa] {ON}  ISR1Predi...    36   0.26 
Smik_12.44 Chr12 complement(92046..94262) [2217 bp, 738 aa] {ON}...    36   0.27 
KLLA0A09713g Chr1 (851952..853625) [1674 bp, 557 aa] {ON} simila...    36   0.27 
Ecym_8380 Chr8 (772519..774573) [2055 bp, 684 aa] {ON} similar t...    36   0.28 
Smik_12.321 Chr12 (579087..580919) [1833 bp, 610 aa] {ON} YLR248...    36   0.29 
Kwal_23.4276 s23 complement(648061..649626) [1566 bp, 521 aa] {O...    36   0.31 
KAFR0K01310 Chr11 (270172..271191) [1020 bp, 339 aa] {ON} Anc_5....    36   0.32 
Kpol_1066.19 s1066 (31013..32806) [1794 bp, 597 aa] {OFF} (31013...    36   0.32 
Kpol_YGOB_1066.19 s1066 (30983..32806) [1824 bp, 607 aa] {ON} AN...    36   0.32 
NCAS0A13320 Chr1 (2622149..2623258) [1110 bp, 369 aa] {ON}             35   0.41 
NCAS0C02510 Chr3 complement(468113..469390) [1278 bp, 425 aa] {O...    35   0.42 
Kwal_27.12562 s27 (1274883..1279139) [4257 bp, 1418 aa] {ON} YBR...    36   0.44 
Skud_10.153 Chr10 (288733..290742) [2010 bp, 669 aa] {ON} YJL057...    35   0.44 
TDEL0G00630 Chr7 complement(128151..129764) [1614 bp, 537 aa] {O...    35   0.45 
Skud_6.41 Chr6 complement(81310..82416) [1107 bp, 368 aa] {ON} Y...    35   0.45 
TDEL0C04810 Chr3 (867670..871932) [4263 bp, 1420 aa] {ON} Anc_3....    36   0.47 
TPHA0N00370 Chr14 (68298..69650) [1353 bp, 450 aa] {ON} Anc_7.41...    35   0.48 
CAGL0G01716g Chr7 complement(155248..156390) [1143 bp, 380 aa] {...    35   0.50 
Suva_10.55 Chr10 complement(110943..113177) [2235 bp, 744 aa] {O...    35   0.52 
Kwal_14.2554 s14 (811455..813233) [1779 bp, 592 aa] {ON} YJL057C...    35   0.52 
TBLA0F01730 Chr6 complement(431961..433004) [1044 bp, 347 aa] {O...    35   0.58 
ZYRO0D16170g Chr4 (1348849..1349982) [1134 bp, 377 aa] {ON} high...    35   0.59 
NCAS0C03810 Chr3 complement(772530..773660) [1131 bp, 376 aa] {O...    35   0.60 
NDAI0A02720 Chr1 complement(612346..613455) [1110 bp, 369 aa] {O...    35   0.62 
NCAS0A06000 Chr1 (1184842..1187133) [2292 bp, 763 aa] {ON} Anc_4...    35   0.62 
TBLA0B05130 Chr2 complement(1207884..1210484) [2601 bp, 866 aa] ...    35   0.63 
Suva_5.243 Chr5 (380441..382012) [1572 bp, 523 aa] {ON} YER123W ...    35   0.63 
NDAI0H00610 Chr8 complement(141913..143022) [1110 bp, 369 aa] {O...    35   0.64 
TDEL0C03760 Chr3 complement(661391..663895) [2505 bp, 834 aa] {O...    35   0.67 
KLLA0E04247g Chr5 (382874..383995) [1122 bp, 373 aa] {ON} simila...    35   0.69 
ADL102C Chr4 complement(503667..504785) [1119 bp, 372 aa] {ON} S...    35   0.74 
Skud_11.54 Chr11 (113775..116570) [2796 bp, 931 aa] {ON} YKL171W...    35   0.76 
Ecym_4364 Chr4 (772870..773997) [1128 bp, 375 aa] {ON} similar t...    35   0.79 
KLTH0B09042g Chr2 (736520..738112) [1593 bp, 530 aa] {ON} simila...    35   0.80 
CAGL0I05192g Chr9 complement(493635..494756) [1122 bp, 373 aa] {...    34   0.92 
CAGL0K12496g Chr11 (1219220..1220302) [1083 bp, 360 aa] {ON} sim...    34   0.98 
KAFR0B02070 Chr2 (408079..409539) [1461 bp, 486 aa] {ON} Anc_8.1...    34   0.99 
Smik_6.49 Chr6 complement(93305..94408) [1104 bp, 367 aa] {ON} Y...    34   1.0  
TBLA0A02040 Chr1 complement(493305..495056) [1752 bp, 583 aa] {O...    34   1.0  
Kpol_1065.32 s1065 complement(65735..70255) [4521 bp, 1506 aa] {...    34   1.1  
Skud_15.228 Chr15 (403382..404401) [1020 bp, 339 aa] {ON} YOR061...    34   1.2  
Kpol_1063.4 s1063 complement(10790..11932) [1143 bp, 380 aa] {ON...    34   1.2  
Smik_10.183 Chr10 complement(319743..321746) [2004 bp, 667 aa] {...    34   1.2  
NDAI0D02970 Chr4 (701299..704058) [2760 bp, 919 aa] {ON} Anc_4.4...    34   1.3  
TPHA0I02660 Chr9 (582108..584219) [2112 bp, 703 aa] {ON} Anc_1.3...    34   1.3  
KLTH0A03542g Chr1 (306667..307803) [1137 bp, 378 aa] {ON} highly...    34   1.4  
Ecym_8164 Chr8 (342672..346076) [3405 bp, 1134 aa] {ON} similar ...    34   1.4  
Ecym_2618 Chr2 (1196140..1197453) [1314 bp, 437 aa] {ON} similar...    34   1.4  
SAKL0D06820g Chr4 (566145..567938) [1794 bp, 597 aa] {ON} simila...    34   1.5  
TPHA0B02780 Chr2 complement(633307..634449) [1143 bp, 380 aa] {O...    33   1.7  
TDEL0G01540 Chr7 complement(303940..306300) [2361 bp, 786 aa] {O...    34   1.7  
KAFR0A02560 Chr1 complement(532248..533351) [1104 bp, 367 aa] {O...    33   1.7  
NCAS0B08320 Chr2 complement(1585766..1588471) [2706 bp, 901 aa] ...    34   1.7  
TPHA0L02180 Chr12 (453556..455538) [1983 bp, 660 aa] {ON} Anc_5....    33   1.9  
KNAG0E03260 Chr5 complement(654134..655246) [1113 bp, 370 aa] {O...    33   2.1  
NCAS0F02410 Chr6 complement(476683..478071) [1389 bp, 462 aa] {O...    33   2.4  
Ecym_4056 Chr4 complement(119406..120428) [1023 bp, 340 aa] {ON}...    33   2.4  
Ecym_1313 Chr1 complement(633556..634455) [900 bp, 299 aa] {ON} ...    33   2.5  
ADR204W Chr4 (1062593..1063612) [1020 bp, 339 aa] {ON} Syntenic ...    33   2.9  
KLLA0F16467g Chr6 (1519800..1520822) [1023 bp, 340 aa] {ON} high...    33   3.0  
Kpol_1035.34 s1035 (79914..80978) [1065 bp, 354 aa] {ON} (79914....    32   3.2  
Smik_15.241 Chr15 (407598..408617) [1020 bp, 339 aa] {ON} YOR061...    32   3.3  
TPHA0J01160 Chr10 (268613..269905) [1293 bp, 430 aa] {ON} Anc_3....    33   3.3  
Suva_8.111 Chr8 (204414..205433) [1020 bp, 339 aa] {ON} YOR061W ...    32   3.3  
SAKL0G00990g Chr7 complement(89700..90824) [1125 bp, 374 aa] {ON...    32   3.4  
YOR061W Chr15 (441534..442553) [1020 bp, 339 aa] {ON}  CKA2Alpha...    32   3.7  
ADR293C Chr4 complement(1207021..1210425) [3405 bp, 1134 aa] {ON...    33   3.8  
Kpol_489.20 s489 complement(59150..60178) [1029 bp, 342 aa] {ON}...    32   4.2  
Kwal_55.21709 s55 (948619..949641) [1023 bp, 340 aa] {ON} YOR061...    32   4.4  
KNAG0L01860 Chr12 (336795..337817) [1023 bp, 340 aa] {ON} Anc_5....    32   4.5  
KLTH0H04686g Chr8 complement(419384..421726) [2343 bp, 780 aa] {...    32   4.6  
NDAI0E03210 Chr5 complement(686073..687317) [1245 bp, 414 aa] {O...    32   5.3  
TBLA0H00370 Chr8 (71216..73393) [2178 bp, 725 aa] {ON} Anc_2.425...    32   5.3  
TPHA0H01300 Chr8 (293254..294282) [1029 bp, 342 aa] {ON} Anc_5.6...    32   5.4  
NCAS0C05490 Chr3 (1114733..1115755) [1023 bp, 340 aa] {ON} Anc_5...    32   6.3  
Smik_16.346 Chr16 (617471..618802) [1332 bp, 443 aa] {ON} YPR106...    32   6.5  
TDEL0B02610 Chr2 complement(470263..471282) [1020 bp, 339 aa] {O...    31   7.3  
ZYRO0B16038g Chr2 (1300484..1301515) [1032 bp, 343 aa] {ON} high...    31   7.4  
KLTH0F17490g Chr6 (1413752..1414774) [1023 bp, 340 aa] {ON} high...    31   7.8  
KLLA0A06776g Chr1 (612115..614517) [2403 bp, 800 aa] {ON} simila...    31   9.1  
CAGL0G02035g Chr7 (179911..180930) [1020 bp, 339 aa] {ON} highly...    31   9.3  

>Smik_14.311 Chr14 complement(558013..559926) [1914 bp, 637 aa] {ON}
           YNL020C (REAL)
          Length = 637

 Score = 1192 bits (3083), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 586/637 (91%), Positives = 586/637 (91%)

Query: 1   MNQPQIGTYNVGTRLTVGSHQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIV 60
           MNQPQIGTYNVGTRLTVGSHQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIV
Sbjct: 1   MNQPQIGTYNVGTRLTVGSHQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDF 120
           PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDF 120

Query: 121 MNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGS 180
           MNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGS
Sbjct: 121 MNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGS 180

Query: 181 VCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLC 240
           VCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLC
Sbjct: 181 VCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQ 300
           YYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQ
Sbjct: 241 YYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQ 300

Query: 301 NVPCPINDIQTVQAPSSHLNLTELHQLSATQNIQSLNSHLVMGNSIPTTAFQFSTPVNMA 360
           NVPCPINDIQTVQAPSSHLNLTELHQLSATQNIQSLNSHLVMGNSIPTTAFQFSTPVNMA
Sbjct: 301 NVPCPINDIQTVQAPSSHLNLTELHQLSATQNIQSLNSHLVMGNSIPTTAFQFSTPVNMA 360

Query: 361 TAQTLPIKEESNIFYDPTSCNFAKDSQSRLNNALSRSPFELEAVSDLNNVKDEANSTTRL 420
           TAQTLPIKEESNIFYDPTSCNFAKDSQSRLNNALSRSPFELEAVSDLNNVKDEANSTTRL
Sbjct: 361 TAQTLPIKEESNIFYDPTSCNFAKDSQSRLNNALSRSPFELEAVSDLNNVKDEANSTTRL 420

Query: 421 KQTIVSEAHNFRQNNSLNLSLPNMIPHNXXXXXXXXXXYPGDTDELKKTQSLSSYSTRSN 480
           KQTIVSEAHNFRQNNSLNLSLPNMIPHN          YPGDTDELKKTQSLSSYSTRSN
Sbjct: 421 KQTIVSEAHNFRQNNSLNLSLPNMIPHNDDSSSSSDESYPGDTDELKKTQSLSSYSTRSN 480

Query: 481 TKRDQPVEEYLTSSSLPGSSFTAVHTKVNLDHKSSSFKPTSTNTVDGXXXXXXXXXXXXX 540
           TKRDQPVEEYLTSSSLPGSSFTAVHTKVNLDHKSSSFKPTSTNTVDG             
Sbjct: 481 TKRDQPVEEYLTSSSLPGSSFTAVHTKVNLDHKSSSFKPTSTNTVDGLKNNTLSLSKNNL 540

Query: 541 PAYDYVGGSKQDLKNSIQQRMLEKLNSSEESFNARKISNVKEGGQEGTNIPIILKSKAST 600
           PAYDYVGGSKQDLKNSIQQRMLEKLNSSEESFNARKISNVKEGGQEGTNIPIILKSKAST
Sbjct: 541 PAYDYVGGSKQDLKNSIQQRMLEKLNSSEESFNARKISNVKEGGQEGTNIPIILKSKAST 600

Query: 601 XXXXXXXXXXXXXXXXXXXXXXXXXXXXAGQKLSLEK 637
                                       AGQKLSLEK
Sbjct: 601 LKDKKIKPTPPPKPLHLKPKPPPKPLFLAGQKLSLEK 637

>YNL020C Chr14 complement(595623..597539) [1917 bp, 638 aa] {ON}
           ARK1Serine/threonine protein kinase involved in
           regulation of the cortical actin cytoskeleton; involved
           in control of endocytosis
          Length = 638

 Score =  876 bits (2263), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/644 (70%), Positives = 497/644 (77%), Gaps = 13/644 (2%)

Query: 1   MNQPQIGTYNVGTRLTVGSHQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIV 60
           MNQPQIGTYNVGT+LTVGSHQVEIIKYLTSGGFAQVYS LI+PPDPH+N++VACLKRVIV
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDF 120
           PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKA+L NGSYEVFVLMEYCERGGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDF 120

Query: 121 MNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGS 180
           MNTRLQNRLHEFEILQI+SQVTQGVAAMHALQPPLIHRDIKIENVLIS NNEYKLCDFGS
Sbjct: 121 MNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGS 180

Query: 181 VCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLC 240
           VCGIIR PRNSQELSYVQQDILKNTTAQYRSPEMID FRGLPIDEKSDIWALGIFLYKLC
Sbjct: 181 VCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQ 300
           YYTTPFEKGG+ AILSGKFEFPLYPNYSEQLK LIRDILVQ+P HRP+V+QLLKRISIMQ
Sbjct: 241 YYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQ 300

Query: 301 NVPCPINDIQTVQAPSSHLNLTELHQLSATQNIQSLNSHLVMGNSIPTTAFQFSTPVNMA 360
           NVPCPINDIQ VQAPSSHLNLTELHQLSATQNI SLNS   M N++P   FQ S   N  
Sbjct: 301 NVPCPINDIQVVQAPSSHLNLTELHQLSATQNILSLNSPTTMENTMPNATFQISMADNTT 360

Query: 361 TAQTLPIKEESNIFYDPTSCNFAKDSQSRLN------NALSRSPFELEAVSDLNNVKD-E 413
           TAQ  P ++ S I YD +  N AK SQ   +      +AL     E  A S  NN  + +
Sbjct: 361 TAQMHPNRKPSQIAYDASFSNSAKGSQPLFDKSQNMYHALDPPLVEPLASSVSNNDNELK 420

Query: 414 ANSTTRLKQTIVSEAHNFRQNNSLNLSLPNMIPHNXXXXXXXXXXYPGDTDELKKTQSLS 473
           ANS T+LKQ IVSEAH FRQNNS++  L N+IP            Y GD DELKKT+SL 
Sbjct: 421 ANSATKLKQAIVSEAHTFRQNNSIDFPLQNIIPQYEDSSSSSDESYSGDVDELKKTRSLG 480

Query: 474 SYSTRSNTKRDQPVEEYLTSSSLPGSSFTAVHTKVNLDHKSSSFKPTSTNTVDGXXXXXX 533
           SYSTR N K++Q V+E LTSSSLPG+SFT   TKVNL H++S FK T  NT+D       
Sbjct: 481 SYSTRGNIKKNQSVKESLTSSSLPGTSFTPTSTKVNLKHENSPFKSTFVNTIDN------ 534

Query: 534 XXXXXXXPAYDYVGGSKQDLKNSIQQRMLEKLNSSEESFNARKISNVKEGGQEGTNIPII 593
                  P+Y+ +  SKQ+LKNSIQQRM++KLNSSEESFNARK+S VK   +   + P +
Sbjct: 535 SKDDLNKPSYEDLDVSKQNLKNSIQQRMIDKLNSSEESFNARKMSKVKLHEKGEIDKPTM 594

Query: 594 LKSKASTXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGQKLSLEK 637
           LKS                                AG+KLSL+K
Sbjct: 595 LKSSGPISKDKKTKPTPPPKPSHLKPKPPPKPLLLAGRKLSLDK 638

>Skud_14.309 Chr14 complement(566344..568263) [1920 bp, 639 aa] {ON}
           YNL020C (REAL)
          Length = 639

 Score =  832 bits (2148), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/612 (70%), Positives = 482/612 (78%), Gaps = 21/612 (3%)

Query: 1   MNQPQIGTYNVGTRLTVGSHQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIV 60
           MNQPQIGTYNVGT+LTVGSHQVEI+KYLTSGGFAQVYS LISPPDPH+++N+ACLKRVIV
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIVKYLTSGGFAQVYSALISPPDPHSHSNIACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDF 120
           PDKPSLNTLRAEVDAMRLL+NNRYVVSYIDSHAAKA+L NGSYEVFVLMEYCERGGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMRLLRNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDF 120

Query: 121 MNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGS 180
           MNTRLQNRLHEFEILQI+SQVTQGVAAMHALQPPLIHRDIKIENVLIS NNEYKLCDFGS
Sbjct: 121 MNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGS 180

Query: 181 VCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLC 240
           VCG+IR PRN QELSYVQQDI KNTTAQYRSPEM+DIFRGLPIDEKSDIWALGIFLYKLC
Sbjct: 181 VCGVIRPPRNPQELSYVQQDIFKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQ 300
           YYTTPFEKGGEPAILSG FEFP YP+YSEQL+ LIRDILVQNPC RP+V+QLLKRISIMQ
Sbjct: 241 YYTTPFEKGGEPAILSGHFEFPPYPDYSEQLRDLIRDILVQNPCQRPNVYQLLKRISIMQ 300

Query: 301 NVPCPINDIQTVQAPSSHLNLTELHQLSATQNIQSLNSHLVMGNSIPTTAFQFSTPVNMA 360
           NVPCPI+DIQ  QAP SHLNLTELHQLSATQNI+SLNSH  +   IP  AFQ S P   A
Sbjct: 301 NVPCPISDIQVPQAPDSHLNLTELHQLSATQNIRSLNSHSTIERPIPNAAFQSSMPD--A 358

Query: 361 TAQTLPIKEESNIFYDPTSCNF-AKDSQSRLNNALSRS----PFELEA-----VSDLNNV 410
             QTL  +++S    D T+ N+ A++ Q+ L+ + S S    P   E+        LN  
Sbjct: 359 ATQTLFSRKKSQT-SDNTTLNYSAENPQTSLDKSESVSHVLDPLLFESGMSNTSKSLNRA 417

Query: 411 KDEANSTTRLKQTIVSEAHNFRQNNSLNLSLPNMIPHNXXXXXXXXXXYPGDTDELKKTQ 470
           K   +STT+LKQ I SEAHNFR N ++NL L N+IP +          YP D D+L+KTQ
Sbjct: 418 K--VSSTTKLKQVIDSEAHNFRHNYTMNLPLRNIIPQDDDSSSSSDELYPEDVDKLEKTQ 475

Query: 471 SLSSYSTRSNTKRDQPVEEYLTSSSLPGSSFTAVHTKVNLDHKSSSFKPTST--NTVDGX 528
           SL SY +R N K+ + V+E LTSSSLPGSS TA  TK++L  ++    P ST  NTVD  
Sbjct: 476 SLGSYISRDN-KKGESVKESLTSSSLPGSSLTATPTKLDLKLET---LPNSTFVNTVDNS 531

Query: 529 XXXXXXXXXXXXPAYDYVGGSKQDLKNSIQQRMLEKLNSSEESFNARKISNVKEGGQEGT 588
                        AYD V  S+QDLKNSI+QRML+KLNSSEESFNARK+   K   +E T
Sbjct: 532 KNSFRNFSKSNPLAYDDVSVSRQDLKNSIRQRMLDKLNSSEESFNARKMPKAKASEKEST 591

Query: 589 NIPIILKSKAST 600
             PI LK   ST
Sbjct: 592 GKPIALKPGIST 603

>Suva_14.327 Chr14 complement(578572..580470) [1899 bp, 632 aa] {ON}
           YNL020C (REAL)
          Length = 632

 Score =  773 bits (1995), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/608 (66%), Positives = 448/608 (73%), Gaps = 37/608 (6%)

Query: 1   MNQPQIGTYNVGTRLTVGSHQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIV 60
           MNQPQIGTYNVGT+LTVGSHQVEIIKYLTSGGFAQVYS LISPPDPHTN+NVACLKRVIV
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDF 120
           PDK SLNTLRAEVDAM+LL+NNRYVVSYIDSHAAKA L NGSYEVFVLMEYCERGGLIDF
Sbjct: 61  PDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDF 120

Query: 121 MNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGS 180
           MNTRLQNRLHE EILQI+ QVTQGVAAMHALQPPLIHRDIKIENVLIS  NEYKLCDFGS
Sbjct: 121 MNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGS 180

Query: 181 VCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLC 240
           VCG+IR PRN QELSYV+QD+LKNTTAQYRSPEM+DIFRGLPIDEKSDIWALGIFLYKLC
Sbjct: 181 VCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQ 300
           YYTTPFEKGGEPAIL+G+FEF  YPNYSEQL++LI  +LVQNP  RP+VFQLLK+I+ MQ
Sbjct: 241 YYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQITNMQ 300

Query: 301 NVPCPINDIQTVQAPSSHLNLTELHQLSATQNIQSLNSHLVMGNSIPTTAFQFSTPVNMA 360
           N P PI D+QTVQ PS+HLNL ELHQ SATQNIQSLNSH +  NS+    FQF  P N+ 
Sbjct: 301 NAPYPIRDVQTVQRPSNHLNLMELHQNSATQNIQSLNSHSINENSMSNQNFQFRMPANVI 360

Query: 361 TAQTLPIKEESNIFYDPTSCNFAKDSQSRLNNALSRSP--FELEAVSDLNNV-KDEANST 417
           TAQ+LP +E S  F + TS            ++L+ SP  FE    + LN   +   N T
Sbjct: 361 TAQSLPTRENSQAFINATS------------SSLTGSPSIFETGVCNTLNIFNQPNTNPT 408

Query: 418 TRLKQTIVSEAHNFRQNNSLNLSLPNMIPHNXXXXXXXXXXYPGDTDELKKTQSLSSYST 477
           T+LKQ I SEAH+FR+++ +NLSLPN+IP +          Y GD DELKKT+SL SYST
Sbjct: 409 TKLKQAIDSEAHSFRKSDPINLSLPNIIPQDNDSSSSSDESYTGDVDELKKTRSLGSYST 468

Query: 478 RSNTKRDQPVEEYLTSSSLPGSSFTAVHTKVNLDHKSSSFKPTS-------------TNT 524
             N K  + V+         G S  A  T  +    SS+ KP                  
Sbjct: 469 HENAKGGESVK---------GESVKASLTTSSSPGSSSALKPAKIESKRQSLPETAFVGV 519

Query: 525 VDGXXXXXXXXXXXXXPAYDYVGGSKQDLKNSIQQRMLEKLNSSEESFNARKISNVKEGG 584
           VD              P  D V  SKQDLKNSIQQRM+  LNSSEESFNARK S  K   
Sbjct: 520 VDSGKDSLPSDPKSNRPVKDSVSVSKQDLKNSIQQRMINLLNSSEESFNARKKSRAKATE 579

Query: 585 QEGTNIPI 592
            EG   PI
Sbjct: 580 DEGPGKPI 587

>KAFR0H03330 Chr8 complement(635910..637019) [1110 bp, 369 aa] {ON}
           Anc_2.284 YNL020C
          Length = 369

 Score =  499 bits (1285), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 233/319 (73%), Positives = 273/319 (85%), Gaps = 1/319 (0%)

Query: 1   MNQPQIGTYNVGTRLTVGSHQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIV 60
           MNQP+I TY+ GT L VGSHQV IIKY+TSGGFAQ+Y+V ISPPD   ++N+ACLKRVIV
Sbjct: 1   MNQPKIDTYHPGTILPVGSHQVRIIKYITSGGFAQIYTVEISPPDSFCDSNIACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDF 120
           PDKPSLNTLRAEVDAM+LL+NN++VVSYIDSHA+K+   NGSYEVF+LMEYCERGGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDF 120

Query: 121 MNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGS 180
           MNTRLQNRL E E+L I SQV QG+AAMHALQPPL+HRDIKIENVLIS +N+YK+CDFGS
Sbjct: 121 MNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGS 180

Query: 181 VCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLC 240
           V GIIR P N QEL YVQ D+LKNTTAQYRSPEMID +RGLPIDEKSDIWA+G+FLYKLC
Sbjct: 181 VSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLC 240

Query: 241 YYTTPFEK-GGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIM 299
           YYTTPFEK GGE AILS ++E+P +P YSE+LK LI  +L++NP  RP+++Q+++ IS M
Sbjct: 241 YYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEISKM 300

Query: 300 QNVPCPINDIQTVQAPSSH 318
           QNVPCPI +   V     H
Sbjct: 301 QNVPCPIVNFYLVTQQQKH 319

>NCAS0G03810 Chr7 complement(703842..705827) [1986 bp, 661 aa] {ON} 
          Length = 661

 Score =  501 bits (1291), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 234/356 (65%), Positives = 285/356 (80%), Gaps = 3/356 (0%)

Query: 1   MNQPQIGTYNVGTRLTVGSHQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIV 60
           MNQPQI  Y  GT LTVGSH+V+++KYLTSGGFAQ+Y+V ISPPD  TNTNVACLKRVIV
Sbjct: 1   MNQPQIPLYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDF 120
           PDKPSLNTLRAEVD M+LL+NN +VVSYIDSHAAK     GSYEVF+LMEYC+ GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDF 120

Query: 121 MNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGS 180
           MNTRLQ RL E EIL I+SQVTQG+AAMHAL PPL+HRDIKIENVL+++  EYK+CDFGS
Sbjct: 121 MNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGS 180

Query: 181 VCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLC 240
           VCGIIR P N+QE+SYVQ DI+KNTTAQYR+PEMID++RGLPIDEKSDIWALG+FLYKLC
Sbjct: 181 VCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQ 300
           YYTTPFEK GE AIL   F+FP YP YS++LK LI  +L++ P  RP+ +Q+L+ +S MQ
Sbjct: 241 YYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEVSSMQ 300

Query: 301 NVPCPINDIQTVQAPSSHLNLTELHQLSATQNIQSLNSHLVMGNSIPTTAFQFSTP 356
           NV CPI +   +   ++++   ++   +  QN  ++ +   M   +P   F ++TP
Sbjct: 301 NVQCPIPNFYLM---NNNVTQGQMAMQTQPQNNGAMMASPNMQPYVPNNNFVYNTP 353

>SAKL0E07722g Chr5 complement(625066..627441) [2376 bp, 791 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095W PRK1 Protein serine/threonine kinase regulates
           the organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 791

 Score =  503 bits (1294), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 227/309 (73%), Positives = 269/309 (87%), Gaps = 1/309 (0%)

Query: 1   MNQPQIGTYNVGTRLTVGSHQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIV 60
           M+QP + TY  GT LTVGSH+  IIKYLTSGGFA +YS  ISPPDP++++ +ACLKRV+V
Sbjct: 1   MSQPPLETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEISPPDPNSSS-IACLKRVLV 59

Query: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDF 120
           PDKPSLN+LRAEVDAM+LLK +++VVSYIDSHAAK+ L NGSYEVF+LMEYC RGGLIDF
Sbjct: 60  PDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDF 119

Query: 121 MNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGS 180
           MNTRLQNRL EFE+L+I+SQV+QGVAAMHALQPPLIHRDIKIENVLIS +  +K+CDFGS
Sbjct: 120 MNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGS 179

Query: 181 VCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLC 240
           VCG+IR P+N QEL+YVQ DILKNTTAQYRSPEMID++RGLP+DEKSDIWALG+FLYKLC
Sbjct: 180 VCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLC 239

Query: 241 YYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQ 300
           YYTTPFEK GE AIL  KF+FP YP YS+QLK+LI  +L +NP  RP++ QLL  +S +Q
Sbjct: 240 YYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLAEVSRIQ 299

Query: 301 NVPCPINDI 309
            VPCP+ + 
Sbjct: 300 GVPCPVKNF 308

>KAFR0J01370 Chr10 complement(250424..252766) [2343 bp, 780 aa] {ON}
           Anc_2.284 YNL020C
          Length = 780

 Score =  499 bits (1286), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 241/388 (62%), Positives = 301/388 (77%), Gaps = 27/388 (6%)

Query: 1   MNQPQIGTYNVGTRLTVGSHQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIV 60
           MN PQI T+  G  LTVGSH  ++IKYLTSGG+AQVY V ISP DP+ N+N+ACLKRVIV
Sbjct: 1   MNHPQIETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDF 120
           PDKPSLNTLRAEVDAM+LLKNNR+VVSYIDSHA+K+ + NG+YEVFVLME+CERGGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDF 120

Query: 121 MNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGS 180
           MN+RLQ+RL E EIL I+S  +QG+AAMH LQP L+HRDIKIENVLIS NNEYK+CDFGS
Sbjct: 121 MNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGS 180

Query: 181 VCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLC 240
           VCGI+R P+N QE ++V  DI+KNTTAQYRSPEM+D+ +GLPI+EKSDIWALG+FLYKLC
Sbjct: 181 VCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEK-GGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIM 299
           YYTTPFEK GGE AIL  +F++P YP YS++LK+LIR +L +NP  RP+V Q+L+ +S +
Sbjct: 241 YYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEVSRL 300

Query: 300 QNVPCPI----------NDIQTVQAPSSHLNL-TELHQLSATQNIQSLNSHLVMGNSIPT 348
           Q +PCPI          N+ +T++ P  ++ + T L Q S   N+ SLN      +++PT
Sbjct: 301 QGIPCPIRNFYLLRAMENNKRTIEQPVQNVYMPTTLSQPSTQMNLASLN------DTLPT 354

Query: 349 TAFQFST----PVNMAT-----AQTLPI 367
            A +F+     P N  +      QTLP+
Sbjct: 355 AALKFNQTTIPPTNQHSPHLLHTQTLPL 382

>NDAI0G00640 Chr7 (139655..141520) [1866 bp, 621 aa] {ON} Anc_2.284
          Length = 621

 Score =  491 bits (1263), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 226/309 (73%), Positives = 263/309 (85%)

Query: 1   MNQPQIGTYNVGTRLTVGSHQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIV 60
           MNQPQ+  Y+ GT L+VGSHQ  IIKYLTSGGFAQVY+  ISP DP  N+++ CLKRVIV
Sbjct: 1   MNQPQVAIYHPGTLLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDF 120
           PDKPSLNTLRAEVDAM+LL+NN +VVSYIDSHAAK     GSYEVF+LMEYC+RGGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDF 120

Query: 121 MNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGS 180
           MNTRLQNRLHE EIL I+SQV+QGVAAMHALQPPL+HRDIKIENVL+++   YKLCDFGS
Sbjct: 121 MNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGS 180

Query: 181 VCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLC 240
           VCGIIR P N QE +YVQ DI+KNTTAQYRSPEMI++ +GLPI+EKSDIWALG+FLYKLC
Sbjct: 181 VCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQ 300
           YYTTPFEK GE AIL   F+FP +P+YS+++KSLIR  L   P  RP+++QLL+ +S +Q
Sbjct: 241 YYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEVSKIQ 300

Query: 301 NVPCPINDI 309
           NVPCPI D 
Sbjct: 301 NVPCPIPDF 309

>Smik_9.84 Chr9 (162983..165409) [2427 bp, 808 aa] {ON} YIL095W
           (REAL)
          Length = 808

 Score =  491 bits (1265), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 249/396 (62%), Positives = 298/396 (75%), Gaps = 17/396 (4%)

Query: 1   MNQPQIGTYNVGTRLTVGSHQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIV 60
           MN PQI  Y  GT LTVGSH  +IIKYLTSGGFAQVY+  ISPPDP+TN N+ACLKRVIV
Sbjct: 1   MNAPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTNANIACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNG-SYEVFVLMEYCERGGLID 119
           PDK  LNTLRAEVDAM+LLKNN++VVSYIDSHAAK++  NG +YEVFVLME+CERGGLID
Sbjct: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSV--NGVAYEVFVLMEFCERGGLID 118

Query: 120 FMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFG 179
           FMNTRLQNRL E EIL+I+SQ  QG+AAMHALQPPLIHRDIKIENVLIS N  YK+CDFG
Sbjct: 119 FMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFG 178

Query: 180 SVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKL 239
           SV G+IR PRN+QE +YVQ DIL NTTAQYRSPEMID++RGLPIDEKSDIWALGIFLYK+
Sbjct: 179 SVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKI 238

Query: 240 CYYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIM 299
           CYYTTPFEK GE  IL  ++++P +P YS++LK+LIR +L++ P  RP++ Q+L+ +S +
Sbjct: 239 CYYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEVSRL 298

Query: 300 QNVPCPINDIQTVQAPSSHLNLTE---LHQLSATQNI---QSLNSHLVMGNSIPTTAFQF 353
           Q  PCPI +   ++A S    L       +   TQ     Q L S   + N IP +  + 
Sbjct: 299 QIKPCPIRNFYLLRAMSQTAQLASEPPSMKYVPTQKFLPAQGLQSMKPISNMIPVSHVR- 357

Query: 354 STPVNMATAQTLPIKEESNIFYDPT---SCNFAKDS 386
           +TP N++   TLP   + N   D T   S  F  DS
Sbjct: 358 TTP-NLS---TLPRSIDDNNMTDVTKQISLQFVGDS 389

>KNAG0H02020 Chr8 complement(357248..359026) [1779 bp, 592 aa] {ON}
           Anc_2.284 YNL020C
          Length = 592

 Score =  481 bits (1238), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 228/345 (66%), Positives = 275/345 (79%), Gaps = 13/345 (3%)

Query: 1   MNQPQIGTYNVGTRLTVGSHQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIV 60
           MNQP I TY  GT LTVGSHQV+IIKYLT+GGFAQ+Y   ISP DP + TN+ACLKRVIV
Sbjct: 1   MNQPNISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDF 120
           PDKPSLN LRAEVDAM+LL+NNR VVSYIDSHAAK+  QNG+YEVF+LMEYCE GGLI+F
Sbjct: 61  PDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINF 120

Query: 121 MNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGS 180
           +N+RLQNRL E E++ I+  V+QGVAAMHALQPPL+HRDIKIENVL+S NNE+KLCDFGS
Sbjct: 121 LNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGS 180

Query: 181 VCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLC 240
           V G IR P N QEL+ VQ DI++NTTAQYRSPEMID+ RG PIDEKSDIWALG+FLYK+C
Sbjct: 181 VSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKIC 240

Query: 241 YYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQ 300
           YYTTPFEK GE  IL+ ++EFP +P YS++L+ LI  +L   P HRP+++ ++K +S M+
Sbjct: 241 YYTTPFEKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKELSDMK 300

Query: 301 NVPCPINDIQTVQAPSSHLNLTELHQLSATQNIQSLNSHLVMGNS 345
           N+ CPI  I     P    N+T+     A+ NIQ L  H +M N+
Sbjct: 301 NISCPI--INFYLKP----NMTD-----ASNNIQHL--HSIMNNT 332

>Suva_9.104 Chr9 (178011..180428) [2418 bp, 805 aa] {ON} YIL095W
           (REAL)
          Length = 805

 Score =  488 bits (1256), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 232/357 (64%), Positives = 282/357 (78%), Gaps = 15/357 (4%)

Query: 1   MNQPQIGTYNVGTRLTVGSHQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIV 60
           MN PQI  Y  GT LTVGSH  +IIKYLTSGGFAQVYS  ISPPDP+++ N+ACLKRVIV
Sbjct: 1   MNTPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYSAEISPPDPYSSANIACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNG-SYEVFVLMEYCERGGLID 119
           PDK  LNTLRAEVDAM+LLKNN++VVSYIDSHAAK++  NG +YEVFVLMEYCERGGLID
Sbjct: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSV--NGVAYEVFVLMEYCERGGLID 118

Query: 120 FMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFG 179
           FMNTRL+NRL E EIL I+ Q  QG+AAMHALQPPLIHRDIKIENVLIS    YK+CDFG
Sbjct: 119 FMNTRLKNRLQESEILDIMGQTVQGIAAMHALQPPLIHRDIKIENVLISHEGLYKVCDFG 178

Query: 180 SVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKL 239
           SV G+IR P+N QE +YVQ DIL NTTAQYRSPEMID++RGLPIDEKSDIWALG+FLYK+
Sbjct: 179 SVSGVIRPPKNPQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGVFLYKI 238

Query: 240 CYYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIM 299
           CYYTTPFEK GE AIL  ++++P +P YS++LK+LIR +L++ P  RP++ Q+L+ +S +
Sbjct: 239 CYYTTPFEKTGEAAILHARYQYPSFPQYSDRLKNLIRLMLMEAPSQRPNICQVLEEVSRL 298

Query: 300 QNVPCPINDIQTVQA---------PSSHLNLTELHQLSATQNIQSLNSHLVMGNSIP 347
           QN PCPI +   ++A          S+ +  T   QL + Q+ Q++ +   M N +P
Sbjct: 299 QNRPCPIRNFYLLRAMNQNAQFGSESTSMTYTPAQQLVSPQSFQNIQA---MPNIVP 352

>YIL095W Chr9 (183937..186369) [2433 bp, 810 aa] {ON}  PRK1Protein
           serine/threonine kinase; regulates the organization and
           function of the actin cytoskeleton and reduces endocytic
           ability of cell through the phosphorylation of the
           Pan1p-Sla1p-End3p protein complex
          Length = 810

 Score =  485 bits (1249), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 227/349 (65%), Positives = 280/349 (80%), Gaps = 14/349 (4%)

Query: 1   MNQPQIGTYNVGTRLTVGSHQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIV 60
           MN PQI  Y  GT LTVGSH  +IIKYLTSGGFAQVY+  ISPPDP++N N+ACLKRVIV
Sbjct: 1   MNTPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANIACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNG-SYEVFVLMEYCERGGLID 119
           P K  LNTLRAEVDAM+LL+NN++VVSYIDSHAA+++  NG +YEVFVLME+CERGGLID
Sbjct: 61  PHKQGLNTLRAEVDAMKLLRNNKHVVSYIDSHAARSV--NGIAYEVFVLMEFCERGGLID 118

Query: 120 FMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFG 179
           FMNTRLQNRL E EIL+I+SQ  QG+ AMHALQPPLIHRDIKIENVLIS +  YK+CDFG
Sbjct: 119 FMNTRLQNRLQESEILEIMSQTVQGITAMHALQPPLIHRDIKIENVLISHDGLYKVCDFG 178

Query: 180 SVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKL 239
           SV G+IR PRN+QE +YVQ DIL NTTAQYRSPEMID++RGLPIDEKSDIWALG+FLYK+
Sbjct: 179 SVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGVFLYKI 238

Query: 240 CYYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIM 299
           CYYTTPFEK GE  IL  ++++P +P YS++LK+LIR +L++ P  RP++ Q+L+ +S +
Sbjct: 239 CYYTTPFEKSGEAGILHARYQYPSFPQYSDRLKNLIRLMLMEAPSQRPNICQVLEEVSRL 298

Query: 300 QNVPCPINDIQTVQAPSSHLNLTELHQLSAT-----------QNIQSLN 337
           QN PCPI +   ++A + + N     + S+T           Q++QS+N
Sbjct: 299 QNKPCPIRNFYLLRAMNQNANTQLAGEPSSTTYVPTQKFIPVQSLQSIN 347

>Kwal_27.11542 s27 complement(841389..843764) [2376 bp, 791 aa] {ON}
           YIL095W (PRK1) - probable serine/threonine-protein
           kinase [contig 27] FULL
          Length = 791

 Score =  484 bits (1246), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 219/309 (70%), Positives = 261/309 (84%)

Query: 1   MNQPQIGTYNVGTRLTVGSHQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIV 60
           MNQP  G Y  GT LTVGSHQ  IIKYLTSGGFA +YS  ISP DP++  NVACLKRV+V
Sbjct: 1   MNQPSSGIYTQGTALTVGSHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLV 60

Query: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDF 120
           PDK SLN LRAEVDAM+LL+ N++VVSYIDSHAAK+  Q+GSYEVF+LMEYC  GGLIDF
Sbjct: 61  PDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDF 120

Query: 121 MNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGS 180
           MNTRLQNRL E E+L+I+S +TQG+AAMHAL PPLIHRDIKIENVLIS +  +K+CDFGS
Sbjct: 121 MNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGS 180

Query: 181 VCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLC 240
           VCG+IR P+N+QE SYVQ DILKNTTAQYRSPEMID++RG PI+EKSDIWALG+FLYKLC
Sbjct: 181 VCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQ 300
           YYTTPFEK G+ AIL  +F+FP YP YS++LK+LI  +L +NP  RP++ Q+L+ +S +Q
Sbjct: 241 YYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEVSRIQ 300

Query: 301 NVPCPINDI 309
           NVPCP+ + 
Sbjct: 301 NVPCPLRNF 309

>KLLA0E08405g Chr5 complement(756205..758538) [2334 bp, 777 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095W PRK1 Protein serine/threonine kinase regulates
           the organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 777

 Score =  483 bits (1242), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 227/372 (61%), Positives = 282/372 (75%), Gaps = 10/372 (2%)

Query: 1   MNQPQIGTYNVGTRLTVGSHQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIV 60
           MNQPQI  Y  GT L VGSHQV+++KYL SGGFA VYSV ISPPDP    NVACLKRV+V
Sbjct: 1   MNQPQIEKYASGTILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVV 60

Query: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDF 120
           PDK SLNTLRAEVD+M+ L+ N+++VSYIDSHA K+ +  G YEV++LMEYC  GGLIDF
Sbjct: 61  PDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDF 120

Query: 121 MNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGS 180
           MNTRLQNRL EFEIL I+SQV+QGVAAMHALQPPLIHRDIKIENVL+S N+E+KLCDFGS
Sbjct: 121 MNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGS 180

Query: 181 VCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLC 240
           V G+IR PRN++E +YVQ DI+KNTTAQYR PEMID++RGLPIDEKSDIWALG+FLYK C
Sbjct: 181 VSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTC 240

Query: 241 YYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQ 300
           YYTTPFEK GE AIL+ KFEFP YP YS+++K+LI  +L  +P  RP++ Q+++ +S +Q
Sbjct: 241 YYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEVSRIQ 300

Query: 301 NVPCPINDIQTVQAPSSHLNLTELHQLSATQNIQSLNSHLVMGNSI------PTTAFQFS 354
            +PCPI +   ++     ++  E  ++S   ++  +     +  S+      P       
Sbjct: 301 GIPCPIKNFYLLRM----MDKQEQPRVSPPPHVPQMTVPATVPTSVSTQHLPPQVVSNVQ 356

Query: 355 TPVNMATAQTLP 366
           TP   A+ Q LP
Sbjct: 357 TPSKTASIQHLP 368

>NCAS0B06260 Chr2 complement(1180650..1182821) [2172 bp, 723 aa]
           {ON} Anc_2.284
          Length = 723

 Score =  481 bits (1237), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 221/323 (68%), Positives = 269/323 (83%), Gaps = 3/323 (0%)

Query: 1   MNQPQIGTYNVGTRLTVGSHQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIV 60
           MNQP I TY  GT LTVGSH  +IIKYLTSGGFAQ+Y+  ISP +P+ N+  ACLKRVIV
Sbjct: 1   MNQPNIPTYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDF 120
           PDK  LNTLRAEVDAM+LLKNNR+VVSYIDSHAA++ +  G+YEVF+LMEYC+ GGLIDF
Sbjct: 61  PDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDF 120

Query: 121 MNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGS 180
           MNTRLQNRL E EIL I+SQ  QGV+AMHALQP LIHRDIKIENVLIS   E+K+CDFGS
Sbjct: 121 MNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGS 180

Query: 181 VCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLC 240
           VC  IR PRN QEL+YVQ D+LKNTTAQYR+PEM+D++RGLPI+EKSDIWALG+FLYKLC
Sbjct: 181 VCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQ 300
           YYTTPFEKGGE AIL  ++++P +P Y+++LK+LIR  L+++P  RP++ QLL+ IS +Q
Sbjct: 241 YYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEISRIQ 300

Query: 301 NVPCPINDI---QTVQAPSSHLN 320
            +PCPIN+    +T+   +S +N
Sbjct: 301 GIPCPINNFYLSRTINVQASLMN 323

>Skud_9.78 Chr9 (160531..162960) [2430 bp, 809 aa] {ON} YIL095W
           (REAL)
          Length = 809

 Score =  482 bits (1240), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 221/315 (70%), Positives = 264/315 (83%), Gaps = 3/315 (0%)

Query: 1   MNQPQIGTYNVGTRLTVGSHQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIV 60
           MN PQI  Y+ GT LTVGSH  +IIKYLTSGGFAQVY+  ISPPDP++N N ACLKRVIV
Sbjct: 1   MNAPQISLYDPGTVLTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANTACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNG-SYEVFVLMEYCERGGLID 119
           PDK  LNTLRAEVDAM+LLKNN++VVSYIDSHAAK++  NG +YEVFVLME+CERGGLID
Sbjct: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSV--NGIAYEVFVLMEFCERGGLID 118

Query: 120 FMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFG 179
           FMNTRLQ+RL E EIL+I+SQ  QG+AAMH LQPPLIHRDIKIENVLIS +  YK+CDFG
Sbjct: 119 FMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFG 178

Query: 180 SVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKL 239
           SV G+IR PRNSQE +YVQ DIL NTTAQYRSPEMID++R  PIDEKSDIWALG+FLYK+
Sbjct: 179 SVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKI 238

Query: 240 CYYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIM 299
           CYYTTPFEK GE AIL  ++++P +P YS++LK LI  +L++ P  RP++ Q+L+ +S +
Sbjct: 239 CYYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEVSRL 298

Query: 300 QNVPCPINDIQTVQA 314
           QN PCPI +   ++A
Sbjct: 299 QNEPCPIRNFYLLRA 313

>NDAI0B03560 Chr2 complement(892839..895109) [2271 bp, 756 aa] {ON}
           Anc_2.284
          Length = 756

 Score =  475 bits (1222), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 229/343 (66%), Positives = 274/343 (79%), Gaps = 5/343 (1%)

Query: 1   MNQPQIGTYNVGTRLTVGSHQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIV 60
           MNQP I  Y  GT LTVG+H+  I KYLTSGGFAQ+Y+V I+P D ++ +NVACLKRVIV
Sbjct: 1   MNQPNIPLYPNGTLLTVGTHRALIKKYLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDF 120
           P K  LNTLRAEVDAM+LLKNNR+VVSYIDS+A K+   NGSYEV +LMEYCE GGLIDF
Sbjct: 61  PTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDF 120

Query: 121 MNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGS 180
           MN+RLQNRL E EIL I+SQ  QGVA MHALQP L+HRDIKIENVL S N E+KLCDFGS
Sbjct: 121 MNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGS 180

Query: 181 VCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLC 240
           VCG IR PRN QELSYVQ DILKNTTAQYR PEM+D++RGLPIDEKSDIWALG+FLYKLC
Sbjct: 181 VCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQ 300
           YYTTPFEK GE AIL  KF++P +P YS++LK+LIR +L +NP  RP++ +LL+ IS +Q
Sbjct: 241 YYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEISSIQ 300

Query: 301 NVPCPINDIQTVQAP--SSHLNL---TELHQLSATQNIQSLNS 338
            VPCPI +   ++A   ++ + L   T + +++  Q IQ LN+
Sbjct: 301 GVPCPIQNFYLIRAQQLANQIQLQRQTTVPKIATAQPIQQLNA 343

>CAGL0G02607g Chr7 complement(240244..242310) [2067 bp, 688 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095w PRK1
          Length = 688

 Score =  467 bits (1202), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 215/314 (68%), Positives = 261/314 (83%)

Query: 1   MNQPQIGTYNVGTRLTVGSHQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIV 60
           MNQP++   NVGT+LTVG+H V+I+KYLTSGGFAQ+Y+V I        +NVACLKRV V
Sbjct: 1   MNQPELDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKV 60

Query: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDF 120
           PDK SLN LRAEVDAM+LL NN++VVSYIDSHA ++   +G+YEVF+LMEYCE GGLIDF
Sbjct: 61  PDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDF 120

Query: 121 MNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGS 180
           MNTRLQNRL E EIL I+SQ TQG+A MHAL PPL+HRDIKIENVL+S    YK+CDFGS
Sbjct: 121 MNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGS 180

Query: 181 VCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLC 240
           V G+IR PRN QEL YVQ DI+KNTTAQYR PEM+D++RGLPIDEK+DIWALG+FLYKLC
Sbjct: 181 VSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLC 240

Query: 241 YYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQ 300
           YYTTPFEK GEPAIL  +F+FP +PNYS++LK+LI+ +L ++P  RP+V Q+L+ +S MQ
Sbjct: 241 YYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEVSRMQ 300

Query: 301 NVPCPINDIQTVQA 314
           NVPCPI +   ++A
Sbjct: 301 NVPCPIRNFYLLRA 314

>Kpol_1003.35 s1003 (89266..91407) [2142 bp, 713 aa] {ON}
           (89266..91407) [2142 nt, 714 aa]
          Length = 713

 Score =  463 bits (1191), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 211/309 (68%), Positives = 252/309 (81%)

Query: 1   MNQPQIGTYNVGTRLTVGSHQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIV 60
           MNQP I TY  G  L VG H   I+KYLTSGG+AQVY   ISPPD  T +++ CLKR+IV
Sbjct: 1   MNQPDIPTYPQGISLQVGVHHATILKYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIV 60

Query: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDF 120
           PDK SLNT RAEVDAM+LL+N  +VVSYIDS+AAK+ L NG+YEV +LME+C  GGLIDF
Sbjct: 61  PDKASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDF 120

Query: 121 MNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGS 180
           MNTRLQNRL EFEIL I+SQVTQGVAAMH+L+PPL+HRDIKIENVLIS + EYKLCDFGS
Sbjct: 121 MNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGS 180

Query: 181 VCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLC 240
           VCG+IR P + QE ++VQ DILKNTTAQYR+PEMID+ R LPIDEKSDIWALG+FLYKLC
Sbjct: 181 VCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQ 300
           YYTTPFEK GE AIL  ++E+  YP+YS+ LK+LIR +L   P  RP++ Q+L+ +S +Q
Sbjct: 241 YYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLEEVSRLQ 300

Query: 301 NVPCPINDI 309
            +PCPI + 
Sbjct: 301 GIPCPIKNF 309

>KLTH0G10318g Chr7 (872129..874501) [2373 bp, 790 aa] {ON} similar
           to uniprot|P40494 Saccharomyces cerevisiae YIL095W PRK1
           Protein serine/threonine kinase regulates the
           organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p- Sla1p-End3p
           protein complex
          Length = 790

 Score =  465 bits (1196), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 210/314 (66%), Positives = 253/314 (80%)

Query: 1   MNQPQIGTYNVGTRLTVGSHQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIV 60
           MNQ     Y  GT LTVGSH+  IIKYLTSGGFA +Y+  I P D  +   +ACLKRV+V
Sbjct: 1   MNQSLNDIYQPGTELTVGSHRARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLV 60

Query: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDF 120
           PDKPSLN LRAEVDAM+LL+ N++VVSYIDSHAAK+ + +GSYEVF+LMEYC  GGLIDF
Sbjct: 61  PDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDF 120

Query: 121 MNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGS 180
           MNTRLQNRL E E+L+I S +TQG+AAMHALQPPLIHRDIKIENVLIS +  +K+CDFGS
Sbjct: 121 MNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGS 180

Query: 181 VCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLC 240
           VCG+IR P+N QE +YVQ DILKNTTAQYR+PEMID++RG PI+EKSDIWALG+FLYKLC
Sbjct: 181 VCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQ 300
           YYTTPFEK GE AIL  +F+FP YP YS+ LK LI  +L +NP  RP++ Q+L+ +S +Q
Sbjct: 241 YYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEVSRIQ 300

Query: 301 NVPCPINDIQTVQA 314
             PCP+ +    +A
Sbjct: 301 GTPCPLRNFYVTRA 314

>TPHA0C03380 Chr3 (740939..743032) [2094 bp, 697 aa] {ON} Anc_2.284
           YNL020C
          Length = 697

 Score =  462 bits (1188), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 213/313 (68%), Positives = 257/313 (82%), Gaps = 4/313 (1%)

Query: 1   MNQPQIGTYNVGTRLTVGSHQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIV 60
           MNQP+I  Y  G  L VGSHQ +I+KYLTSGGFAQVY V ISP D H+ +N+ACLKRVIV
Sbjct: 1   MNQPEIPLYTPGIILPVGSHQAKILKYLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAI----LQNGSYEVFVLMEYCERGG 116
           PDK SLN  RAEV+AM+LL+NN+YVVSYIDSHAAK+     + NGSYEVF+LMEYC   G
Sbjct: 61  PDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKG 120

Query: 117 LIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLC 176
           LIDFMNTRLQNRL EFEIL I+S V+QGVAAMHALQPPL+HRDIKIENVLIS  NE+KLC
Sbjct: 121 LIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLC 180

Query: 177 DFGSVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFL 236
           DFGSVCG+IR P N  EL +VQ DILKNTTAQYRSPEM+ + + +PI+EKSDIWALG+FL
Sbjct: 181 DFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFL 240

Query: 237 YKLCYYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRI 296
           YK+CYYTTPFEK GE AIL  ++++P YP YS+ LK+LIR +L+ +P  RP++ Q+++ +
Sbjct: 241 YKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEEV 300

Query: 297 SIMQNVPCPINDI 309
           S +Q VPCP+ + 
Sbjct: 301 SRLQGVPCPLKNF 313

>TBLA0B05930 Chr2 (1400163..1402316) [2154 bp, 717 aa] {ON}
           Anc_2.284 YNL020C
          Length = 717

 Score =  460 bits (1184), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 205/306 (66%), Positives = 256/306 (83%)

Query: 1   MNQPQIGTYNVGTRLTVGSHQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIV 60
           MNQP I  Y+ GT+L VG HQV IIKYLTSGGFAQ+Y V ++PP+P    N+ACLKRVIV
Sbjct: 1   MNQPHIKNYDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDF 120
           P+K  LNTLRAEV+AM+LLK   +VV YIDS+AA++I  +G+YEV  LME+C  GGLIDF
Sbjct: 61  PEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDF 120

Query: 121 MNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGS 180
           MNTRLQNRL EFE+L I++QVTQG+ AMH+L PPLIHRDIKIENVLIS+N EYK+CDFGS
Sbjct: 121 MNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGS 180

Query: 181 VCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLC 240
           V GIIR P+N++E ++VQQDI+KNTTAQYR PEM+D++RG PI+EKSDIWALG+FLYK+C
Sbjct: 181 VSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKIC 240

Query: 241 YYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQ 300
           YYTTPFE GGE AIL  ++++P YP YS +LK+LIR +L++ P  RP+V Q+L+ +S MQ
Sbjct: 241 YYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEVSSMQ 300

Query: 301 NVPCPI 306
            +PCP+
Sbjct: 301 GIPCPL 306

>ZYRO0A01848g Chr1 (152134..154248) [2115 bp, 704 aa] {ON} similar
           to uniprot|P40494 Saccharomyces cerevisiae YIL095W PRK1
           Protein serine/threonine kinase regulates the
           organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 704

 Score =  452 bits (1164), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 208/314 (66%), Positives = 255/314 (81%)

Query: 1   MNQPQIGTYNVGTRLTVGSHQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIV 60
           MN P+I TY  GT L+VG+H  +I+KY+ SGGFAQVYS  + P D  T TN  CLKRVI+
Sbjct: 1   MNHPEIPTYTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVII 60

Query: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDF 120
           P+K  LN LRAEV+AM+LLK +++VV YIDSHAA+++LQNG+YEVF+LME+C  GGLIDF
Sbjct: 61  PEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDF 120

Query: 121 MNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGS 180
           MNTRLQNRL E+EIL I+SQVTQG+AAMHALQPPLIHRDIKIENVLIS + EYK+CDFGS
Sbjct: 121 MNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGS 180

Query: 181 VCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLC 240
           V G IR PRN QE ++VQ DILKNTTAQYRSPEMID++R   IDEKSDIWALGIFLYKLC
Sbjct: 181 VSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQ 300
           YYTTPFEKGG+ AIL  +++F  +P YS++LK+LI  +L Q P  RP++ Q+L+ +S MQ
Sbjct: 241 YYTTPFEKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEEVSRMQ 300

Query: 301 NVPCPINDIQTVQA 314
            V  P+ +   ++A
Sbjct: 301 GVSSPMRNFYLLRA 314

>Ecym_3323 Chr3 (618386..620632) [2247 bp, 748 aa] {ON} similar to
           Ashbya gossypii ADL217W
          Length = 748

 Score =  454 bits (1167), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 206/309 (66%), Positives = 253/309 (81%), Gaps = 1/309 (0%)

Query: 1   MNQPQIGTYNVGTRLTVGSHQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIV 60
           MNQ    ++  GT LTVGSH+V+++KYLTSGGFAQ+Y   +  PD     +VACLKRV V
Sbjct: 1   MNQLPQDSFQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPDSKVK-DVACLKRVHV 59

Query: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDF 120
           PDK SLNTLRAEVDAM+LL+ N+++VSYIDSHA+K++L NGSYEV +LMEYC RGGLI F
Sbjct: 60  PDKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISF 119

Query: 121 MNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGS 180
           MNTRLQ+RL EFE+L+I++QV QG+ AMHALQPPLIHRDIKIENVLI+ N + K+CDFGS
Sbjct: 120 MNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGS 179

Query: 181 VCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLC 240
           VCG+IR P+N+ ELSYVQ DILKNTTAQYR+PEMID++RG  +DEKSDIWALG+FLYKLC
Sbjct: 180 VCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLC 239

Query: 241 YYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQ 300
           YYTTPFEK GE AIL   F+FP YP YS +LK+LI  +L +NP HRP+  Q+L+ +  +Q
Sbjct: 240 YYTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEVCRIQ 299

Query: 301 NVPCPINDI 309
             PCP+ + 
Sbjct: 300 GQPCPVKNF 308

>ADL217W Chr4 (321491..323743) [2253 bp, 750 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL095W (PRK1) and
           YNL020C (ARK1)
          Length = 750

 Score =  447 bits (1151), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 216/371 (58%), Positives = 274/371 (73%), Gaps = 16/371 (4%)

Query: 1   MNQPQIGTYNVGTRLTVGSHQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIV 60
           MNQ        G  LTVGSH+V+II+YLTSGGFAQ+YS  +  P P    ++ACLKRV V
Sbjct: 1   MNQVPQDCLQPGIILTVGSHEVKIIQYLTSGGFAQIYSCEVLSPGP-IQGSLACLKRVHV 59

Query: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDF 120
           PDKPSLNTLRAEVDAM++LK +R+VVSYIDSHAAK+   +G+YEV++LMEYC RGGLIDF
Sbjct: 60  PDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDF 119

Query: 121 MNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGS 180
           MN+RLQ RL EFE+L+I+S V QG+ AMHAL PPLIHRDIKIENVLIS + ++K+CDFGS
Sbjct: 120 MNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGS 179

Query: 181 VCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLC 240
           V G+IR P+N+ E +YVQ DILKNTTAQYR+PEMID++R LP+DEKSDIWALG+FLYK+C
Sbjct: 180 VSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVC 239

Query: 241 YYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQ 300
           Y+TTPFEK GE AIL  KF+FP YP Y+++LK+LI  +L ++P  RP++ Q+L+ +S +Q
Sbjct: 240 YFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVSRIQ 299

Query: 301 NVPCPINDIQTVQAPSSHLNLTELHQLSATQNIQSLNSHLVMGNSIPTTAFQFSTPVNMA 360
            VPCP+ +    +    H   T +H  SA+Q             ++P    QFST   M 
Sbjct: 300 GVPCPLPNFYLERM--KHGACTPVHH-SASQ------------PALPLATHQFSTSTPMV 344

Query: 361 TAQTLPIKEES 371
           T    P  + S
Sbjct: 345 THPQPPANQMS 355

>CAGL0J03432g Chr10 (330031..331899) [1869 bp, 622 aa] {ON} similar
           to uniprot|P53974 Saccharomyces cerevisiae YNL020c ARK1
           or uniprot|P40494 Saccharomyces cerevisiae YIL095w PRK1
          Length = 622

 Score =  441 bits (1134), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 200/310 (64%), Positives = 249/310 (80%)

Query: 1   MNQPQIGTYNVGTRLTVGSHQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIV 60
           MN P I  Y  GT +TVGSH V I+KYLTSGG+AQ+YS  I P D    TN+A LKRVIV
Sbjct: 1   MNTPHIPKYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDF 120
           PDK  LNTLRAEVDAM+ LK+++Y+VSYIDSHAAK+   +G+YEVF++MEYC RGGLIDF
Sbjct: 61  PDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDF 120

Query: 121 MNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGS 180
           MNTRLQNRL E EIL I   ++QGVAAMH LQPPLIHRDIKIENVLIS +++YKLCDFGS
Sbjct: 121 MNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGS 180

Query: 181 VCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLC 240
           V G IR P+  +EL+YV+ DI+ +TTAQYR+PEM+D+ +G  +++KSDIWALG+FLYKLC
Sbjct: 181 VSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQ 300
           YYTTPFE+ GE  IL+G  EFP YP+YS+ +K LI  +L +NP HRP++FQ+++ +S + 
Sbjct: 241 YYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTVSKLL 300

Query: 301 NVPCPINDIQ 310
           NV CPI +I 
Sbjct: 301 NVNCPIPNIH 310

>Kpol_1039.33 s1039 complement(102096..104201) [2106 bp, 701 aa]
           {ON} complement(102096..104201) [2106 nt, 702 aa]
          Length = 701

 Score =  424 bits (1091), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 195/314 (62%), Positives = 246/314 (78%)

Query: 1   MNQPQIGTYNVGTRLTVGSHQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIV 60
           MNQ Q+  Y   T +TVGSH  +I+KYL SGG+AQVYS  ++P D    TN+ACLKRV+V
Sbjct: 1   MNQDQLPLYVPDTVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVV 60

Query: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDF 120
           PDK SLN LRAEVDA+++L+N +YVVSYIDSHA+K     GSYEVFVLMEYC  G LIDF
Sbjct: 61  PDKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDF 120

Query: 121 MNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGS 180
           +NTRL+NRL E EIL I++QV  GVA MH LQP LIHRDIKIEN+LIS N EYK+CDFGS
Sbjct: 121 LNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGS 180

Query: 181 VCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLC 240
           VCG+IR PR+ +E+ Y+Q DI+KNTTAQYRSPEM+D+ +G  I+EKSDIWALG+FL+KLC
Sbjct: 181 VCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLC 240

Query: 241 YYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQ 300
           YYTTPFEK GE AIL  +F++P YP YS+ LK++IR +L  +P  RP++ QL++ +S +Q
Sbjct: 241 YYTTPFEKEGEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQ 300

Query: 301 NVPCPINDIQTVQA 314
            +  P+ +    +A
Sbjct: 301 GIVPPMKNFYLSRA 314

>TBLA0B06940 Chr2 (1639189..1643520) [4332 bp, 1443 aa] {ON}
           Anc_2.284 YNL020C
          Length = 1443

 Score =  437 bits (1125), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 199/308 (64%), Positives = 244/308 (79%), Gaps = 2/308 (0%)

Query: 1   MNQPQIGTYNVGTRLTVGSHQVEIIKYLTSGGFAQVYSVLISPPDPHTNT--NVACLKRV 58
           MNQP+I  Y  G  L +G+HQV I KYL  GGFAQVYSV +       N    +ACLKRV
Sbjct: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRV 60

Query: 59  IVPDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLI 118
           IVPDK  LNTLRAEVDAM+LLK N+Y+VSYIDSHA ++ L+ G YEVF+LMEYC RGG+I
Sbjct: 61  IVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVI 120

Query: 119 DFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDF 178
           DF+NTRL +RL EFEIL+I+S V QGVAAMH LQPPLIHRDIKIENVLIS N +YK+CDF
Sbjct: 121 DFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDF 180

Query: 179 GSVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYK 238
           GS C ++R P+  QE +++  DI+ NTTAQYRSPEMID + G PIDEKSDIWALG+FLYK
Sbjct: 181 GSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYK 240

Query: 239 LCYYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISI 298
           LCYYTTPFEK GE AIL+ KF+FP YP YS+ ++++I  +L ++P  RP++ Q+L+++S 
Sbjct: 241 LCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSK 300

Query: 299 MQNVPCPI 306
           +Q VPCPI
Sbjct: 301 LQGVPCPI 308

>KNAG0A05430 Chr1 complement(800787..803153) [2367 bp, 788 aa] {ON}
           Anc_2.284 YNL020C
          Length = 788

 Score =  410 bits (1053), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 194/312 (62%), Positives = 246/312 (78%), Gaps = 6/312 (1%)

Query: 1   MNQPQIGTYNVGTRLTVGSHQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIV 60
           MNQP I  Y  G  + VGSHQ +I+KYLTSGGFAQ+YSV ISP D +TN+N+ACLKRVIV
Sbjct: 1   MNQPVIPNYPPGFVIKVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDF 120
           P+K  LN LR EVDAM+LLKNNR+VVSYIDS+AAK+   NGSYEVF+LMEYCERG L+DF
Sbjct: 61  PNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDF 120

Query: 121 MNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGS 180
           MNT+L+ RL E E+L I++QV QG+AAMH L PPLIHRDIKIENVLIS +  +K+CDFGS
Sbjct: 121 MNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGS 180

Query: 181 VCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKS---DIWALGIFLY 237
           VCGIIR PRN QEL YVQ D++KNTTAQYRSPEMID+ +G PI+ K      W + + + 
Sbjct: 181 VCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERKIRHLGSWCVALQIM 240

Query: 238 KLCYYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRIS 297
            L +YT  F +  E AIL+G++++P YP YS++LK+++R +L  +P  RP++ QLL+ IS
Sbjct: 241 -LLHYT--FREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEEIS 297

Query: 298 IMQNVPCPINDI 309
            +QN+PCPI++ 
Sbjct: 298 KIQNIPCPIDNF 309

>TPHA0D01540 Chr4 complement(316471..318594) [2124 bp, 707 aa] {ON}
           Anc_2.284 YNL020C
          Length = 707

 Score =  386 bits (991), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 183/320 (57%), Positives = 237/320 (74%), Gaps = 1/320 (0%)

Query: 9   YNVGTRLTVGSHQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIVPDKPSLNT 68
           Y  GT+L V SH+V I  YLTSGGFAQVY+  I+    +    + CLKRVIVP+K SLN 
Sbjct: 9   YKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPNKQSLNI 68

Query: 69  LRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFMNTRLQNR 128
           LRAEVDAM++LKNN+Y+VSYIDSHA +      SY V +LMEYC   GL+DFMN RL+ R
Sbjct: 69  LRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNLRLKER 128

Query: 129 LHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGSVCGIIRLP 188
           L E EIL+I++ V+QGV  MH LQPPL+HRDIKIENVL+S +  +KLCDFGSV G++R P
Sbjct: 129 LKEEEILKIMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSP 188

Query: 189 RNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEK 248
            +S+E  Y+Q DILKNTTAQYRSPEM+++  G PI+EKSDIWALGI LYKLCYYTTPFE+
Sbjct: 189 TSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPFEE 248

Query: 249 GGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQNVPCPIND 308
            G  AI+ GKF +P YP Y++ LK++IR +L  NP  RP++ QLL+ +  +Q+   P+ +
Sbjct: 249 HGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELFRIQHKSSPLPN 308

Query: 309 IQTVQAPSS-HLNLTELHQL 327
               +A SS  ++ T+ H++
Sbjct: 309 FYVQRAMSSLQMDTTQPHRI 328

>KAFR0A01040 Chr1 complement(197612..200350) [2739 bp, 912 aa] {ON}
           Anc_3.273 YBR059C
          Length = 912

 Score =  309 bits (791), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 165/347 (47%), Positives = 220/347 (63%), Gaps = 25/347 (7%)

Query: 9   YNVGTRLTVGSHQVEIIKYLTSGGFAQVYSV--------LISPPDPHTNTNV-------- 52
           +N G  + VG H+VEIIKYL  GGFAQ+YSV          + PD   ++N+        
Sbjct: 19  FNPGAVVAVGRHKVEIIKYLAEGGFAQIYSVNFIEYLNEFSNEPDSTEDSNIDEFQQFKL 78

Query: 53  -----ACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFV 107
                ACLKRV+VPD+  LN LR EV+ MR LK    +V Y DS+A++    N  +EV +
Sbjct: 79  EPGNLACLKRVMVPDENGLNELRNEVNVMRKLKGTPNIVQYYDSNASRRHDGNPGFEVLL 138

Query: 108 LMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLI 167
           LME C    L+D+MN RL  +L E EIL+I+  VT G++ MH LQ PLIHRDIKIENVL+
Sbjct: 139 LMELCPNNSLLDYMNQRLTTKLSEKEILKIMYDVTLGISQMHYLQKPLIHRDIKIENVLV 198

Query: 168 STNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKS 227
            ++N +KLCDFGS      +  + QE++ + Q+I  +TT QYRSPEMID++R LPIDEKS
Sbjct: 199 DSSNNFKLCDFGSTSACFPIVTSHQEIAVLTQNIYVHTTPQYRSPEMIDLYRNLPIDEKS 258

Query: 228 DIWALGIFLYKLCYYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRP 287
           DIWALG+FLYKL +YTTPFE  G+ AIL  K+E P   NYS +L +LI  +L +NP  RP
Sbjct: 259 DIWALGVFLYKLLFYTTPFEMTGQFAILHSKYEIPPN-NYSSRLINLIIIMLAENPNLRP 317

Query: 288 SVFQLLKRISIMQNVPCPINDIQTVQAPSSHLNLTELHQLSATQNIQ 334
           +++Q++ ++ I   +  PI D +    P    N T  H  +  QNIQ
Sbjct: 318 NIYQVMHQVCITIGIEPPIKD-KYEMGPYDFENYT--HFQNKLQNIQ 361

>Kpol_251.4 s251 (5802..8318) [2517 bp, 838 aa] {ON} (5802..8318)
           [2517 nt, 839 aa]
          Length = 838

 Score =  303 bits (775), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 153/312 (49%), Positives = 210/312 (67%), Gaps = 10/312 (3%)

Query: 6   IGTYNVGTRLTVGSHQVEIIKYLTSGGFAQVYSV----LISPPDPH-----TNTNVACLK 56
           + +Y  GT + VG H+VE++KYL  GGFA++Y V     +S  DP+      N +  CLK
Sbjct: 26  LDSYVPGTIVIVGIHKVEVVKYLAEGGFAKIYVVKFLEYLSTVDPNGKEVLQNGDQLCLK 85

Query: 57  RVIVPDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGG 116
           RV+V D   LN +R EV+ MR LK    VV Y DS+A++ I     YEV +LME C    
Sbjct: 86  RVLVQDDNGLNEMRNEVEVMRKLKGAPCVVQYYDSNASRRIDGAPGYEVLLLMELCSNNS 145

Query: 117 LIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLC 176
           L+D+MN RL  +L E EIL+I+  VT  VA MH L  PLIHRDIKIENVL+ + N +KLC
Sbjct: 146 LLDYMNQRLATKLSEDEILKIMFDVTLAVAQMHYLPSPLIHRDIKIENVLVDSKNNFKLC 205

Query: 177 DFGSVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFL 236
           DFGS    + +  + Q+++ + Q+I  +TT QYRSPEMID++R LP++EKSDIWALG+FL
Sbjct: 206 DFGSTSTCLPIVSSHQDIAILTQNIYVHTTPQYRSPEMIDLYRCLPVNEKSDIWALGVFL 265

Query: 237 YKLCYYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRI 296
           YKL +YTTPFE+ G+ AIL  K+EFPL  NYS +L +LI  +L +NP  RP+++Q+L +I
Sbjct: 266 YKLMFYTTPFERTGQFAILHSKYEFPLN-NYSSKLINLIIVMLAENPNLRPNIYQVLNQI 324

Query: 297 SIMQNVPCPIND 308
             +  +  P++D
Sbjct: 325 CYISGIKNPMDD 336

>SAKL0D03234g Chr4 (262365..264941) [2577 bp, 858 aa] {ON} some
           similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 858

 Score =  296 bits (757), Expect = 9e-89,   Method: Compositional matrix adjust.
 Identities = 148/305 (48%), Positives = 202/305 (66%), Gaps = 9/305 (2%)

Query: 12  GTRLTVGSHQVEIIKYLTSGGFAQVYSV--------LISPPDPHTNTNVACLKRVIVPDK 63
           GT + VGSH+VEI+KYL  GGFA +Y V        L +P       ++ACLKRV+V D+
Sbjct: 35  GTLIIVGSHKVEIVKYLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACLKRVLVTDE 94

Query: 64  PSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFMNT 123
             LN LR EV+ M+ LKN+  +V Y DS+A++    +  YEV +LME C    L+D+MN 
Sbjct: 95  NGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQ 154

Query: 124 RLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGSVCG 183
           RL  +L E E+L+I+  VT+ VA MH L  PLIHRDIKIENVL+ + N +KLCDFGS   
Sbjct: 155 RLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSS 214

Query: 184 IIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLCYYT 243
              +    Q+++ +  +I  +TT QYR+PEMID++R LPIDEKSDIWALGIFLYKL +YT
Sbjct: 215 CFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFLYKLLFYT 274

Query: 244 TPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQNVP 303
           TPFE  G+ AIL  K++ P   NYS +L +LI  +L +NP  RP+++Q++ ++  +  V 
Sbjct: 275 TPFELTGQFAILHSKYDIPAN-NYSSKLINLIIIMLAENPNLRPNIYQVIYQVCAIMKVD 333

Query: 304 CPIND 308
            P  D
Sbjct: 334 VPFED 338

>TBLA0E02590 Chr5 complement(651679..654864) [3186 bp, 1061 aa] {ON}
           Anc_3.273 YBR059C
          Length = 1061

 Score =  299 bits (765), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 151/316 (47%), Positives = 205/316 (64%), Gaps = 15/316 (4%)

Query: 7   GTYNVGTRLTVGSHQVEIIKYLTSGGFAQVYSV--------LISPPDPHTNT------NV 52
           G Y  GT + VGSH+VE+IKY+  GGFAQ+Y+V          S P  + N       ++
Sbjct: 97  GNYPAGTPVAVGSHKVEVIKYIAEGGFAQIYTVKFIERLNEFASLPGGNQNQKPLQPGDI 156

Query: 53  ACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYC 112
           ACLKRV+V D   LN +R EV+ M+ L+    VV Y DS+A+        YEV +LME+C
Sbjct: 157 ACLKRVLVNDDNGLNEMRNEVNVMQKLQGAPCVVQYYDSNASHRSDSAPGYEVLLLMEFC 216

Query: 113 ERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNE 172
               L+D+MN RL  RL E EI++I+   T G+A +H L+ PLIHRDIKIENVL+   N 
Sbjct: 217 PNNSLLDYMNDRLATRLSEKEIMKIMYDTTLGIAQLHYLKTPLIHRDIKIENVLVDQENN 276

Query: 173 YKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWAL 232
           +KLCDFGS      +  N ++++   Q+I  NTT QYRSPEMID++R  PIDEKSDIWAL
Sbjct: 277 FKLCDFGSTSICFPIVTNHRDIAIFTQNIYVNTTPQYRSPEMIDLYRYQPIDEKSDIWAL 336

Query: 233 GIFLYKLCYYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQL 292
           G+FLYKL ++TTPFE+ G+ AIL  K+EFP   NYS +L +LI  +L +NP  RP+++Q+
Sbjct: 337 GVFLYKLLFFTTPFERTGQFAILHSKYEFPKN-NYSSKLINLIIIMLAENPSVRPNIYQV 395

Query: 293 LKRISIMQNVPCPIND 308
           L+ +  +     P+ND
Sbjct: 396 LQYLCSINGWKVPLND 411

>NDAI0A05700 Chr1 (1288604..1292077) [3474 bp, 1157 aa] {ON}
           Anc_3.273
          Length = 1157

 Score =  299 bits (765), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 165/355 (46%), Positives = 221/355 (62%), Gaps = 30/355 (8%)

Query: 6   IGT--YNVGTRLTVGSHQVEIIKYLTSGGFAQVYSV-----LISPPDPHTNTN------- 51
           +GT  +  GT++ VGSH+VEIIKY+  GGFAQ+Y+V     L    D +T+ N       
Sbjct: 19  VGTEKFPAGTQVAVGSHKVEIIKYIAEGGFAQIYAVKYVESLNEFEDSNTDENAHLSGDR 78

Query: 52  ------------VACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQ 99
                       +ACLKRV+V D+  LN +R EV+ M+ LK    VV Y DS+A++    
Sbjct: 79  QAPNPMILKLGDIACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNVVQYFDSNASRRHNG 138

Query: 100 NGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRD 159
              +EV +LME C    L+D+MN RL  +L E EIL+I+  +T  V+ MH L+ PL+HRD
Sbjct: 139 ASGFEVLLLMELCPNKSLLDYMNQRLTTKLTEHEILKIMYDITFAVSHMHYLKIPLLHRD 198

Query: 160 IKIENVLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFR 219
           IKIENVL+   N +KLCDFGS    + +    Q+++ + Q+I  +TT QYRSPEMID++R
Sbjct: 199 IKIENVLVDAQNNFKLCDFGSTSTRLPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYR 258

Query: 220 GLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDIL 279
            LPIDEKSDIWALGIFLYKL ++ TPFE  G+ AIL  K+EFP   NYS +L +LI  +L
Sbjct: 259 CLPIDEKSDIWALGIFLYKLLFFITPFEMTGQFAILHSKYEFPKN-NYSSKLINLIIIML 317

Query: 280 VQNPCHRPSVFQLLKRISIMQNVPCPINDIQTVQAPSSHLNLTELHQLSATQNIQ 334
            +NP  RP+++Q+L  I  M NV  PI DI   Q P +    T  H  +  QNIQ
Sbjct: 318 AENPNLRPNIYQVLDNICSMMNVEVPIEDIYE-QGPYNFEKYT--HFQNKIQNIQ 369

>KNAG0H01220 Chr8 (209884..212625) [2742 bp, 913 aa] {ON} Anc_3.273
           YBR059C
          Length = 913

 Score =  295 bits (755), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 156/324 (48%), Positives = 212/324 (65%), Gaps = 24/324 (7%)

Query: 6   IGTYNVGTRLTVGSHQVEIIKYLTSGGFAQVYSVLI-----------SP--PDPHTNTNV 52
           +  Y  G  + VGSH+VEI++Y+  GGFAQ+YSV             SP   D     ++
Sbjct: 15  VEKYQPGKVIVVGSHRVEILQYIAEGGFAQIYSVKFLEYANEFDREESPGSKDQLQVGDL 74

Query: 53  ACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGS--------YE 104
           ACLKRVIV D+  LN LR EV+ M+ L     +V Y DS+A++  L+NG+        +E
Sbjct: 75  ACLKRVIVQDQNGLNELRNEVNVMKKLVGAPNIVQYYDSNASR--LRNGTDSQPQENKFE 132

Query: 105 VFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIEN 164
           V +LME C    L+D+MN RL  +L E EIL+++  V+  +A MH L+ PLIHRDIKIEN
Sbjct: 133 VLLLMELCPNKSLLDYMNLRLATKLSEQEILEVMYDVSLAIAQMHYLRKPLIHRDIKIEN 192

Query: 165 VLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPID 224
           VL+   N +KLCDFGS      +    ++++Y+ Q+I  +TT QYRSPEMID++R LPID
Sbjct: 193 VLVDQKNRFKLCDFGSTSTCFPMVVTHRDIAYLTQNIYVHTTPQYRSPEMIDLYRCLPID 252

Query: 225 EKSDIWALGIFLYKLCYYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPC 284
           EKSDIWALGIFLYKL ++TTPFE+ G+ AIL  KFEFP   NYS +L +LI  +L +NP 
Sbjct: 253 EKSDIWALGIFLYKLLFFTTPFERTGQFAILHSKFEFPQN-NYSFKLINLIIVMLSENPN 311

Query: 285 HRPSVFQLLKRISIMQNVPCPIND 308
            RP+++Q+L +I  ++ VP PI D
Sbjct: 312 LRPNIYQVLHQICQLKQVPIPIAD 335

>KNAG0J00820 Chr10 complement(137927..141202) [3276 bp, 1091 aa]
           {ON} Anc_3.273 YBR059C
          Length = 1091

 Score =  297 bits (760), Expect = 9e-88,   Method: Compositional matrix adjust.
 Identities = 153/322 (47%), Positives = 208/322 (64%), Gaps = 22/322 (6%)

Query: 6   IGTYNVGTRLTVGSHQVEIIKYLTSGGFAQVYSVLISPPDPHTNT--------------- 50
           I  ++ G  + VGSH VEI+KYLT GGFAQ+Y V ++    + N                
Sbjct: 26  IEKFSAGESVAVGSHGVEIVKYLTEGGFAQIYLVKLTE---YLNEFDAIDIQNQRQQQEL 82

Query: 51  ---NVACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFV 107
              ++ CLKRV+V D+  L+ ++ EV+ M+ L+    VV Y DS+A +    NG +EVF+
Sbjct: 83  KIGDLVCLKRVMVYDEAGLSEMKNEVNVMKQLRGKPNVVQYYDSNATRNRGANGGFEVFL 142

Query: 108 LMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLI 167
           LMEYC    L+D+MN RL  +L E EIL I+  +T GV+ +H L  PLIHRDIKIENVL+
Sbjct: 143 LMEYCPNKSLLDYMNQRLTTKLTESEILNIMYDITLGVSQLHFLDNPLIHRDIKIENVLV 202

Query: 168 STNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKS 227
             NN +KLCDFGS      +   +Q++S +  DI  +TT QYRSPEMID+FR LP++EK+
Sbjct: 203 DHNNRFKLCDFGSTNICPPIATTNQDISVLTHDIYVHTTPQYRSPEMIDLFRCLPVNEKA 262

Query: 228 DIWALGIFLYKLCYYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRP 287
           DIWALG+FLYKL +YTTPFE  G+ AIL  K+E P   +YSE+L +LI  +L +NP  RP
Sbjct: 263 DIWALGVFLYKLLFYTTPFELTGQFAILHSKYEIP-QSHYSERLLNLIVVMLAENPNLRP 321

Query: 288 SVFQLLKRISIMQNVPCPINDI 309
           +++Q+L  I  + NV  PI DI
Sbjct: 322 NIYQVLSEICSILNVEVPIPDI 343

>CAGL0H10208g Chr8 complement(996853..999936) [3084 bp, 1027 aa]
           {ON} similar to uniprot|P38080 Saccharomyces cerevisiae
           YBR059c AKL1 Ark-family Kinase-Like protein
          Length = 1027

 Score =  295 bits (754), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 150/319 (47%), Positives = 210/319 (65%), Gaps = 13/319 (4%)

Query: 1   MNQPQIGTYNVGTRLTVGSHQVEIIKYLTSGGFAQVYSVL----------ISPPDPHTNT 50
           +N P    Y  G  ++VG+H+VEI+ YL  GGFAQ+Y V           +      T  
Sbjct: 12  LNSPNEEKYPNGQMISVGAHRVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVG 71

Query: 51  NVACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLME 110
           ++ACLKRVIV D+  LN +R EV+ M+ LK++  +V Y DS+A++       +EV +LME
Sbjct: 72  DIACLKRVIVNDEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLME 131

Query: 111 YCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTN 170
            C    L+D+MN RL+ +L E EIL+I+  V+ G++ MH L  PLIHRDIKIENVL+  N
Sbjct: 132 LCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDAN 191

Query: 171 NEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIW 230
           N +KLCD GS         ++Q+++ + Q+I  +TT QYR+PEMID++R LPI+EKSDIW
Sbjct: 192 NNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIW 251

Query: 231 ALGIFLYKLCYYTTPFEKGGEPAILSGKFEFPLYPN-YSEQLKSLIRDILVQNPCHRPSV 289
           ALGIFLYKL +YTTPFE  G+ AIL  K++FP  PN YS ++ +LI  +L +NP  RP++
Sbjct: 252 ALGIFLYKLLFYTTPFEITGQMAILHSKYDFP--PNKYSSKIINLIIIMLAENPNLRPNI 309

Query: 290 FQLLKRISIMQNVPCPIND 308
           FQ++  I  + N+P PI D
Sbjct: 310 FQVVYHICSIMNLPVPIED 328

>KLTH0C07260g Chr3 (626334..629039) [2706 bp, 901 aa] {ON} similar
           to uniprot|P38080 Saccharomyces cerevisiae YBR059C AKL1
           Ser-Thr protein kinase
          Length = 901

 Score =  290 bits (741), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 147/314 (46%), Positives = 201/314 (64%), Gaps = 10/314 (3%)

Query: 4   PQIGTYNVGTRLTVGSHQVEIIKYLTSGGFAQVYSVLI---------SPPDPHTNTNVAC 54
           P +     G+++ VG+H+VEI+KYL  GGFA +Y V           +P         AC
Sbjct: 24  PVLERLKTGSQVIVGNHRVEIVKYLAEGGFAHIYVVKFVEYANELEQAPSITLKVGETAC 83

Query: 55  LKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCER 114
           LKRV+V D+  LN +R EV  M+ L     +V Y DSHA+++      +EV +LME C  
Sbjct: 84  LKRVLVTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRSRDGVPGFEVMLLMELCPN 143

Query: 115 GGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYK 174
             L+D+MN RL  +L E EIL+I+  VT+ +A MH L  PLIHRD+KIENVL+  +N +K
Sbjct: 144 NSLLDYMNQRLTTKLSEQEILKIMFDVTRALAQMHYLPIPLIHRDVKIENVLVDGDNNFK 203

Query: 175 LCDFGSVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGI 234
           LCDFGS    + +    QE++ +  +I  +TT QYRSPEMID++R LPIDEKSDIWALGI
Sbjct: 204 LCDFGSTSTCLPVANTHQEIAVLTNNIYIHTTPQYRSPEMIDLYRCLPIDEKSDIWALGI 263

Query: 235 FLYKLCYYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLK 294
           FLYKL +YTTPFE  G+ AIL  K+EFP+  NYS +L +LI  +L +NP  RP+++Q++ 
Sbjct: 264 FLYKLLFYTTPFELTGQFAILHSKYEFPIN-NYSSKLINLIIIMLAENPNLRPNIYQIMD 322

Query: 295 RISIMQNVPCPIND 308
            +  +  V  PI D
Sbjct: 323 NLCSIMKVENPIED 336

>NCAS0A10590 Chr1 complement(2108142..2111429) [3288 bp, 1095 aa]
           {ON} Anc_3.273
          Length = 1095

 Score =  292 bits (747), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 155/325 (47%), Positives = 210/325 (64%), Gaps = 16/325 (4%)

Query: 3   QPQIGTYNVGTRLTVGSHQVEIIKYLTSGGFAQVYSV-LISPPDPHTNT---------NV 52
           +P    Y  GT++ VG+H+VEIIKY+  GGFAQ+Y+V  I   +   N          +V
Sbjct: 16  KPNNERYTPGTQVAVGAHKVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDV 75

Query: 53  ACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNG--SYEVFVLME 110
           ACLKRV+V D+  LN +R EV+ M+ L+    +V Y DS+A++    NG   +EV +LME
Sbjct: 76  ACLKRVLVQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRR--HNGFPGFEVLLLME 133

Query: 111 YCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTN 170
            C    L+D+MN RL  +L E EIL+I+  VT  V+ MH L  PL+HRDIKIENVL+   
Sbjct: 134 LCPNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQ 193

Query: 171 NEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIW 230
           N +KLCDFGS      +    Q+++ + Q+I  +TT QYRSPEMID++R LPIDEKSDIW
Sbjct: 194 NNFKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIW 253

Query: 231 ALGIFLYKLCYYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVF 290
           ALGIFLYKL ++TTPFE  G+ AIL  K+EFP   NYS +L +LI  +L +NP  RP+++
Sbjct: 254 ALGIFLYKLLFFTTPFELTGQFAILHSKYEFPKN-NYSSKLINLIIIMLAENPNLRPNIY 312

Query: 291 QLLKRISIMQNVPCPINDIQTVQAP 315
           Q+L  I  +  +  PI D Q  + P
Sbjct: 313 QVLHNICSISGMKVPIED-QYAEGP 336

>Kpol_1052.22 s1052 (72364..75669) [3306 bp, 1101 aa] {ON}
           (72364..75669) [3306 nt, 1102 aa]
          Length = 1101

 Score =  291 bits (744), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 151/307 (49%), Positives = 197/307 (64%), Gaps = 11/307 (3%)

Query: 12  GTRLTVGSHQVEIIKYLTSGGFAQVYSVLI---SPPDPHTNTNV-------ACLKRVIVP 61
           G+ + VG+ +VEI+KYLT GGFAQ+Y V     S      N+N+       ACLKRV+V 
Sbjct: 28  GSTVVVGNKKVEIVKYLTEGGFAQIYIVKFLENSNEFDSNNSNIPLKIGDLACLKRVLVQ 87

Query: 62  DKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFM 121
           D+  LN +R EV+ M+LLK    +V Y DS+A++       +EV +LME C    L+DFM
Sbjct: 88  DENGLNEMRNEVEVMKLLKGAPNIVQYFDSNASRRKDGTNGFEVLLLMELCPNKSLLDFM 147

Query: 122 NTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGSV 181
           N RL  +L E EIL I+  VT  VA MH L PPLIHRDIKIENVL+ + N +KL DFGS 
Sbjct: 148 NQRLTTKLSEKEILTIMHDVTLAVAQMHTLSPPLIHRDIKIENVLVDSQNGFKLADFGST 207

Query: 182 CGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLCY 241
                     Q+++ + QDI  +TT QYRSPEMID+++ LPIDEKSDIWALGIFLYKL +
Sbjct: 208 SKCFPAVSAHQDIAILSQDIFMHTTPQYRSPEMIDLYKCLPIDEKSDIWALGIFLYKLLF 267

Query: 242 YTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQN 301
           Y TPFE  G+ AIL  K++FP   NYS +L +LI  +L +NP  RP+++Q+L  I  +  
Sbjct: 268 YITPFEMTGQFAILHSKYDFP-QTNYSSRLINLIIIMLSENPNLRPNIYQVLHEICSISG 326

Query: 302 VPCPIND 308
               I D
Sbjct: 327 TRLEITD 333

>Kwal_27.10945 s27 (565717..568524) [2808 bp, 935 aa] {ON} YBR059C
           (AKL1) - Serine-threonine protein kinase [contig 32]
           FULL
          Length = 935

 Score =  287 bits (734), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 146/314 (46%), Positives = 202/314 (64%), Gaps = 10/314 (3%)

Query: 4   PQIGTYNVGTRLTVGSHQVEIIKYLTSGGFAQVYSVLI---------SPPDPHTNTNVAC 54
           P +     G+++ VG+H+VEI+KYL  GGFA +Y V            P       ++AC
Sbjct: 66  PVLEQLKTGSQVIVGNHRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLAC 125

Query: 55  LKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCER 114
           LKRV+V D+  LN +R EV  M+ L     +V Y DSHA++A   +  +EV +LME C  
Sbjct: 126 LKRVLVTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPN 185

Query: 115 GGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYK 174
             L+D+MN RL  +L E EIL+I+  VT+ +A MH L  PLIHRD+KIENVL+  N+ +K
Sbjct: 186 NSLLDYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFK 245

Query: 175 LCDFGSVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGI 234
           LCDFGS      +    QE++ +  +I  +TT QYRSPEMID++R LPI+EKSDIWALGI
Sbjct: 246 LCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGI 305

Query: 235 FLYKLCYYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLK 294
           FLYKL +YTTPFE  G+ AIL  K+EFP+  NYS +L +LI  +L +NP  RP+++Q++ 
Sbjct: 306 FLYKLLFYTTPFELTGQFAILHSKYEFPVN-NYSSKLINLIIIMLAENPNLRPNIYQVMD 364

Query: 295 RISIMQNVPCPIND 308
            +  +  V  P+ D
Sbjct: 365 NLCSILKVKNPLED 378

>KAFR0C00430 Chr3 complement(88561..91410) [2850 bp, 949 aa] {ON}
           Anc_3.273 YBR059C
          Length = 949

 Score =  285 bits (729), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 147/321 (45%), Positives = 206/321 (64%), Gaps = 18/321 (5%)

Query: 6   IGTYNVGTRLTVGSHQVEIIKYLTSGGFAQVYSV----LISPPDPHTNT----------- 50
           I  +  G  L VG+H+VEI+ YLT GGFAQ+Y V    +++  D   N            
Sbjct: 28  IEKFEKGQNLAVGTHKVEIVDYLTEGGFAQIYVVKFIEVLNEFDNEDNGSNVRISNYSLK 87

Query: 51  --NVACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVL 108
             +VACLKRV+V D+  LN +R EV+ M+ L+    +V Y DS+A ++   N  YEV +L
Sbjct: 88  LGDVACLKRVLVYDEVGLNEMRNEVNVMKKLRGCPNIVQYYDSNATRSHNGNPGYEVLLL 147

Query: 109 MEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLIS 168
           ME C    L+++MN RL  +L E E+L+I+  VT GVA MH L+ PLIHRDIKIENVL+ 
Sbjct: 148 MELCSNNSLLNYMNQRLATQLSEKEVLKIMYDVTSGVAQMHYLKTPLIHRDIKIENVLVD 207

Query: 169 TNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSD 228
           +NN +KLCDFGS      +    Q+++ + Q++  +TT QYRSPEMID++R LPI+EKSD
Sbjct: 208 SNNNFKLCDFGSATTCPPVATTHQDIALLGQNVYVHTTPQYRSPEMIDLYRYLPINEKSD 267

Query: 229 IWALGIFLYKLCYYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPS 288
           IWALG+FLYKL +YTTPFE  G+ A+L  KF+ P    YS ++ +L+  +L +N   RP+
Sbjct: 268 IWALGVFLYKLLFYTTPFETTGQFAMLHSKFDIPAN-KYSSKIINLVIIMLSENLNLRPN 326

Query: 289 VFQLLKRISIMQNVPCPINDI 309
           ++Q++  I  +  V  PI DI
Sbjct: 327 IYQVMHYICQLIQVDTPILDI 347

>ZYRO0E06864g Chr5 complement(516731..520078) [3348 bp, 1115 aa]
           {ON} some similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 1115

 Score =  286 bits (731), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 144/317 (45%), Positives = 200/317 (63%), Gaps = 10/317 (3%)

Query: 1   MNQPQIGTYNVGTRLTVGSHQVEIIKYLTSGGFAQVYSVLI---------SPPDPHTNTN 51
           + +P +  Y  GT + VG+ QVEII ++  GGFAQ+YSV               P    +
Sbjct: 14  VTKPVVDGYAPGTVVAVGNQQVEIISFIAEGGFAQIYSVKYIKFLGEFNNGSKAPLQPGD 73

Query: 52  VACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEY 111
           +ACLKRV+VPD+  L+ +R EV+ M+ L+  + ++ Y DS+A++       YEV +LME 
Sbjct: 74  IACLKRVLVPDENGLSEMRNEVEVMKQLRGAKAIIQYYDSNASRRTSGQVGYEVLLLMEL 133

Query: 112 CERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNN 171
           C    L+D+MN RL  RL E EIL+++   T  ++ MH L  PLIHRDIKIENVL+   N
Sbjct: 134 CPNNSLLDYMNQRLATRLTEKEILKVMYDTTLAISQMHYLPIPLIHRDIKIENVLVDAQN 193

Query: 172 EYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWA 231
            +KLCDFGS      L    Q+++ + Q+I  NTT QYRSPEMID++R LPI+EKSDIWA
Sbjct: 194 NFKLCDFGSTSTCFPLVTTHQDIAILTQNIYVNTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 232 LGIFLYKLCYYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQ 291
           LGIFLYKL ++ TPFE  G+ +IL  K+EFP    YS +L +LI  +L +NP  RP+++Q
Sbjct: 254 LGIFLYKLLFFITPFEMTGQFSILHSKYEFPAN-KYSSKLINLIIIMLAENPYVRPNIYQ 312

Query: 292 LLKRISIMQNVPCPIND 308
           ++  I  +     PI D
Sbjct: 313 VMHHICSVIGCEVPIED 329

>Suva_4.297 Chr4 complement(523650..526973) [3324 bp, 1107 aa] {ON}
           YBR059C (REAL)
          Length = 1107

 Score =  285 bits (730), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 148/317 (46%), Positives = 202/317 (63%), Gaps = 10/317 (3%)

Query: 1   MNQPQIGTYNVGTRLTVGSHQVEIIKYLTSGGFAQVYSV-LISPPDPHTNT--------N 51
           M  P +  Y  G  + VG+H+VEI+ YL  GGFAQ+Y+V  +   +   NT        +
Sbjct: 14  MGHPAVERYTPGKIVCVGTHKVEIVNYLAEGGFAQIYAVKFLEYLNEFDNTASLPLKIGD 73

Query: 52  VACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEY 111
           VACLKRV+V D+  LN +R EV+ M+ LK    VV Y DS+A++       +EV +LME 
Sbjct: 74  VACLKRVLVHDENGLNEMRNEVEVMKKLKGAANVVQYYDSNASRRRDGVQGFEVLLLMEL 133

Query: 112 CERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNN 171
           C    L+D+MN RL  +L E EI++I+  V   ++ MH L  PLIHRDIKIENVL+   N
Sbjct: 134 CPNKSLLDYMNQRLSTKLSESEIVKIMYDVALSISEMHYLPVPLIHRDIKIENVLVDAEN 193

Query: 172 EYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWA 231
            +KL DFGS      +    Q+++ + Q+I  +TT QYRSPEMID++R LPI+EKSDIWA
Sbjct: 194 NFKLADFGSTSTSFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 232 LGIFLYKLCYYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQ 291
           LGIFLYKL ++TTPFE  G+ AIL  K+EFP+   YS +L +LI  +L +NP  RP+++Q
Sbjct: 254 LGIFLYKLLFFTTPFEMTGQFAILHSKYEFPVN-KYSSKLINLIIIMLAENPNLRPNIYQ 312

Query: 292 LLKRISIMQNVPCPIND 308
           +L  I  + N   PI D
Sbjct: 313 VLYHICDILNAEVPIED 329

>Smik_2.191 Chr2 complement(338792..342118) [3327 bp, 1108 aa] {ON}
           YBR059C (REAL)
          Length = 1108

 Score =  285 bits (730), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 158/381 (41%), Positives = 225/381 (59%), Gaps = 23/381 (6%)

Query: 1   MNQPQIGTYNVGTRLTVGSHQVEIIKYLTSGGFAQVYSVLI---------SPPDPHTNTN 51
           M  P +  +  G  + VG+H+VE+I YL  GGFAQ+Y V           +   P    +
Sbjct: 14  MGHPAVERFTPGHIVCVGTHKVEVINYLAEGGFAQIYMVKFVEYLNEFDNAASVPLKIGD 73

Query: 52  VACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEY 111
           VACLKRV+V D+  LN +R EV+ M+ LK    VV Y DS+A++       +EV +LME 
Sbjct: 74  VACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNVVQYFDSNASRRRDGVQGFEVLLLMEL 133

Query: 112 CERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNN 171
           C    L+D+MN RL  +L E EI++I+  V   ++ MH L  PLIHRDIKIENVL+  NN
Sbjct: 134 CPNKSLLDYMNQRLSTKLTESEIVKIMYDVVLSISQMHYLPVPLIHRDIKIENVLVDANN 193

Query: 172 EYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWA 231
            +KL DFGS      +    Q+++ + Q+I  +TT QYRSPEMID++R LPI+EKSDIWA
Sbjct: 194 NFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 232 LGIFLYKLCYYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQ 291
           LGIFLYKL ++TTPFE  G+ AIL  K+EFP+   YS +L +LI  +L +NP  RP+++Q
Sbjct: 254 LGIFLYKLLFFTTPFEMTGQFAILHSKYEFPVN-KYSSKLINLIIIMLAENPNLRPNIYQ 312

Query: 292 LLKRISIMQNVPCPINDIQTVQA-------------PSSHLNLTELHQLSATQNIQSLNS 338
           +L  +  + N+  PI D  T  A              +  L + +L Q    QN +  +S
Sbjct: 313 VLYHLCEILNIEVPIEDKYTEGAYNFSKYTQFQNKLQNVQLQMYQLQQKKIMQNNKLSDS 372

Query: 339 HLVMGNSIPTTAFQFSTPVNM 359
              + N +  ++F+ S+ + M
Sbjct: 373 EENLLNDMFLSSFEISSKLPM 393

>Ecym_2650 Chr2 complement(1257641..1260325) [2685 bp, 894 aa] {ON}
           similar to Ashbya gossypii AGR027C
          Length = 894

 Score =  281 bits (720), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 146/306 (47%), Positives = 199/306 (65%), Gaps = 9/306 (2%)

Query: 11  VGTRLTVGSHQVEIIKYLTSGGFAQVYSV----LISPPDPHTNT----NVACLKRVIVPD 62
            G+ L VG H+VEII+YL  GGFA +Y V      +  D H +     ++ACLKRV V D
Sbjct: 30  AGSILLVGVHRVEIIEYLAEGGFAHIYKVSFIEYTNELDRHHSVLQRGDIACLKRVQVND 89

Query: 63  KPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFMN 122
           +  LN LR EV+ M+ LK    VV Y DS+A++       +EV +LME C  G L+D+MN
Sbjct: 90  ENGLNELRNEVEVMKKLKGCGNVVQYYDSNASRHTDGTPGFEVLLLMELCSNGSLLDYMN 149

Query: 123 TRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGSVC 182
            RL  +L E E+L+I+  +T+G++ MH L+ PLIHRDIKIENVL+ + N +KLCDFGS  
Sbjct: 150 QRLATKLSEREVLKIMYDITKGISHMHFLRTPLIHRDIKIENVLVDSANNFKLCDFGSTS 209

Query: 183 GIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLCYY 242
             +      QE++ +  +I  +TT QYRSPEMID++R L I+EKSDIWALGIFLYKL +Y
Sbjct: 210 TCLPAVSTHQEIAMLTNNIYVHTTPQYRSPEMIDLYRCLAINEKSDIWALGIFLYKLLFY 269

Query: 243 TTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQNV 302
           TTPFE  G+ AIL  K++ P   N+S +L +LI  +L +NP  RP+++Q+L  I  +   
Sbjct: 270 TTPFELTGQFAILHSKYDIPQN-NFSSKLINLIIVMLAENPYIRPNIYQILYHICSIMEC 328

Query: 303 PCPIND 308
             PI D
Sbjct: 329 DVPIED 334

>CAGL0K11990g Chr11 complement(1156224..1159199) [2976 bp, 991 aa]
           {ON} some similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059c AKL1 Ark-family Kinase-Like protein
          Length = 991

 Score =  283 bits (725), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 150/322 (46%), Positives = 207/322 (64%), Gaps = 21/322 (6%)

Query: 3   QPQIG-TYNVGTRLTVGSHQVEIIKYLTSGGFAQVYSVLI-------------SPPDPHT 48
           QPQI   +  G  +TVGSH+VE++ YL  GGFAQ+Y V               S   P  
Sbjct: 89  QPQIEEKFPAGKVVTVGSHRVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLK 148

Query: 49  NTNVACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGS----YE 104
             + ACLKRV+V D+  LN +R+EV+ M+ L+    +V Y DS+A++    +G+    +E
Sbjct: 149 PGSPACLKRVLVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFE 208

Query: 105 VFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIEN 164
           V +LME C    L+D+MN RL  +L E EI +I+  +T  VA MH L  PLIHRDIKIEN
Sbjct: 209 VLLLMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIEN 268

Query: 165 VLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPID 224
           VL+  NN +KLCDFGS         + Q+++ + QD+  +TT QYRSPEMID+F+ +PI+
Sbjct: 269 VLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPIN 328

Query: 225 EKSDIWALGIFLYKLCYYTTPFEKGGEPAILSGKFEFPLYPN-YSEQLKSLIRDILVQNP 283
           EKSDIWALG+FLYKL ++TTPFE+ G+ A+L  KFEFP  PN YS +L +LI  +L +NP
Sbjct: 329 EKSDIWALGVFLYKLLFFTTPFERTGQFAMLHSKFEFP--PNSYSSKLINLIIVMLAENP 386

Query: 284 CHRPSVFQLLKRISIMQNVPCP 305
             RP+++Q+L  +S + N   P
Sbjct: 387 SLRPNIYQVLYYLSEVTNREVP 408

>TDEL0D03520 Chr4 (647828..650977) [3150 bp, 1049 aa] {ON} Anc_3.273
           YBR059C
          Length = 1049

 Score =  284 bits (727), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 148/315 (46%), Positives = 199/315 (63%), Gaps = 12/315 (3%)

Query: 4   PQIGTYNVGTRLTVGSHQVEIIKYLTSGGFAQVYSVLI---------SPPDPHTNTNVAC 54
           P +  +  G  + VG+H+VE++ YL  GGFAQ+Y V               P    +VAC
Sbjct: 17  PTMERFLPGAVVAVGTHRVEVVNYLAEGGFAQIYVVKFLEYLNEFENKSKVPMKVGDVAC 76

Query: 55  LKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCER 114
           LKRV+V D+  L+ +R EV+ M+ L   + +V Y DS+A +    N  +EV +LME C  
Sbjct: 77  LKRVLVQDENGLSEMRNEVEVMKQLMGAQNIVQYYDSNACRRHNGNAGFEVLLLMELCPN 136

Query: 115 GGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYK 174
             L+D+MN RL  +L E EIL+I+  V+  V+ MH L+ PLIHRDIKIENVL+   N +K
Sbjct: 137 KSLLDYMNQRLATKLTEKEILKIMYDVSLAVSQMHYLKNPLIHRDIKIENVLVDAQNSFK 196

Query: 175 LCDFGSVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGI 234
           LCDFGS      +    QE++ + Q+I  +TT QYR PEMID++R LPI+EKSDIWALGI
Sbjct: 197 LCDFGSTSQCFPVVTTHQEIAILTQNIYVHTTPQYRCPEMIDLYRCLPINEKSDIWALGI 256

Query: 235 FLYKLCYYTTPFEKGGEPAILSGKFEFPLYPN-YSEQLKSLIRDILVQNPCHRPSVFQLL 293
           FLYKL ++ TPFE  G+ AIL  K+EFP  PN YS QL +LI  +L +NP  RP+++Q+L
Sbjct: 257 FLYKLLFFITPFEMTGQFAILHSKYEFP--PNHYSSQLINLIIIMLAENPFVRPNIYQVL 314

Query: 294 KRISIMQNVPCPIND 308
             I  M  V  PI D
Sbjct: 315 NHICTMIGVEVPIED 329

>TPHA0A04030 Chr1 (901665..904829) [3165 bp, 1054 aa] {ON} Anc_3.273
           YBR059C
          Length = 1054

 Score =  284 bits (726), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 160/346 (46%), Positives = 211/346 (60%), Gaps = 35/346 (10%)

Query: 2   NQP-QIGTYNVGTRLTVGSHQVEIIKYLTSGGFAQVYSV-LISPPDPHTNT--------- 50
           N+P  I  Y  GT LTVG  ++EI+KYLT GGFAQ+Y+V  I   +   N          
Sbjct: 32  NRPGSIEKYKQGTILTVGIRRIEILKYLTEGGFAQIYTVRFIEYLNEFDNDDAENDNNSR 91

Query: 51  -----NVACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNG---- 101
                +VACLKRV+VPD+  L+ +R EVD M+ L N   +V Y DS+A+K I  N     
Sbjct: 92  NLKIGDVACLKRVLVPDENGLSEMRNEVDVMKKLVNCPNIVQYYDSNASK-IKDNSNIDT 150

Query: 102 ------------SYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMH 149
                        +E+ +LMEYC    L+DFMN RL  +L E EIL+ ++ +T  V  MH
Sbjct: 151 TNNNDNNKNTDLGFEILLLMEYCPNKSLLDFMNQRLTTKLTENEILKAMTDITTAVLQMH 210

Query: 150 ALQPPLIHRDIKIENVLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTTAQY 209
            L  PLIHRDIKIENVL+ +NN +KL DFGS   I       Q+++ + +DI  NTT QY
Sbjct: 211 YLAQPLIHRDIKIENVLVDSNNNFKLADFGSTTKIQPPITTHQDIAILNKDIYMNTTPQY 270

Query: 210 RSPEMIDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAILSGKFEFPLYPNYSE 269
           RSPEMID+++ LPIDEKSDIWALG+ LYKL +YTTPFE  G+ AIL  K+EFP   NYS 
Sbjct: 271 RSPEMIDLYKCLPIDEKSDIWALGVLLYKLLFYTTPFELTGQFAILHSKYEFPA-NNYSS 329

Query: 270 QLKSLIRDILVQNPCHRPSVFQLLKRI-SIMQNVPCPINDIQTVQA 314
           +  +LI  +L +NP  RP++FQ+L  + SI   +    N++Q  Q 
Sbjct: 330 KFINLIIIMLAENPNLRPNIFQVLYYLKSISNTMNSNNNEVQNTQV 375

>Skud_2.179 Chr2 complement(325193..328465) [3273 bp, 1090 aa] {ON}
           YBR059C (REAL)
          Length = 1090

 Score =  282 bits (722), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 158/386 (40%), Positives = 225/386 (58%), Gaps = 33/386 (8%)

Query: 1   MNQPQIGTYNVGTRLTVGSHQVEIIKYLTSGGFAQVYSVLI---------SPPDPHTNTN 51
           M  P +  Y  G  + VG+H+VEI+ YL  GGFAQ+Y V           +   P    +
Sbjct: 14  MGHPAVERYTPGDIVCVGTHKVEIVNYLAEGGFAQIYVVKFLEYLNEFDNAASVPLKIGD 73

Query: 52  VACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEY 111
           +ACLKRV+V D+  LN +R EV+ M+ LK    VV Y DS+A++       +EV +LME 
Sbjct: 74  LACLKRVLVHDENGLNEMRNEVEVMKKLKGAANVVQYYDSNASRRRDGVQGFEVLLLMEL 133

Query: 112 CERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNN 171
           C    L+D+MN RL  +L E EI++I+  V   ++ MH L  PLIHRDIKIENVL+   +
Sbjct: 134 CPNKSLLDYMNQRLSTKLTETEIVKIMYDVALSISQMHYLPVPLIHRDIKIENVLVDAKD 193

Query: 172 EYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWA 231
            +KL DFGS      +    Q+++ + Q+I  +TT QYRSPEMID++R LPI+EKSDIWA
Sbjct: 194 SFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 232 LGIFLYKLCYYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQ 291
           LGIFLYKL ++TTPFE  G+ AIL  K+EFP+   YS +L +LI  +L +NP  RP+++Q
Sbjct: 254 LGIFLYKLLFFTTPFEMTGQFAILHSKYEFPVN-KYSSKLINLIIIMLAENPNLRPNIYQ 312

Query: 292 LLKRISIMQNVPCPIND------------------IQTVQAPSSHLNLTELHQLSATQNI 333
           +L  +  + NV  PI D                  +Q VQ     L + +L Q    QN 
Sbjct: 313 VLCHLCDILNVEVPIEDKYAEGPYNFARYTQFQNKLQNVQ-----LQMYQLQQKKIVQNS 367

Query: 334 QSLNSHLVMGNSIPTTAFQFSTPVNM 359
           +  +S   + N +  ++F+ S+ + M
Sbjct: 368 KLSDSEENLLNDMFLSSFEISSKLPM 393

>TPHA0M01120 Chr13 complement(223548..225914) [2367 bp, 788 aa] {ON}
           Anc_3.273 YBR059C
          Length = 788

 Score =  276 bits (705), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 146/319 (45%), Positives = 200/319 (62%), Gaps = 22/319 (6%)

Query: 6   IGTYNVGTRLTVGSHQVEIIKYLTSGGFAQVYSV---------------LISPPDPHTNT 50
           I TY  G  + VG H+VEIIKYL  GGFA++Y                 ++ P D     
Sbjct: 96  IDTYVPGHIVEVGIHKVEIIKYLAEGGFAKIYVAKFLQYIKQIDINKIQVLQPGD----- 150

Query: 51  NVACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLME 110
            + CLKRV+V D   LN +R EV  M+ L     +V   DS+A++       YEV +LME
Sbjct: 151 -LICLKRVLVTDDNGLNEMRNEVSVMKKLIGAPNIVQLYDSNASRRTDGIAGYEVLLLME 209

Query: 111 YCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTN 170
            C    L+D+MN RL  +L E EIL+I+  VT  VA MH L  PLIHRDIKIENVL+ + 
Sbjct: 210 LCSNKSLLDYMNQRLAVKLTEPEILKIMFDVTLAVAQMHYLPIPLIHRDIKIENVLVDSQ 269

Query: 171 NEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIW 230
           N +KLCDFGS    + +    ++++ + Q++  +TT QYRSPEMID++R + I+EKSDIW
Sbjct: 270 NNFKLCDFGSTSTCMPIATTHRDMAALTQNLYVHTTPQYRSPEMIDVYRCIHINEKSDIW 329

Query: 231 ALGIFLYKLCYYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVF 290
           ALGIFLYKL +Y TPFE+ G+ AIL  K+EFP + +YS +L +LI  +L +NP  RP+++
Sbjct: 330 ALGIFLYKLLFYITPFERTGQFAILHSKYEFPQH-SYSMKLINLIIIMLAENPNLRPNIY 388

Query: 291 QLLKRISIMQNVPCPINDI 309
           Q+L  I  + N+  PI+DI
Sbjct: 389 QVLAYICKIINIKTPIDDI 407

>AGR027C Chr7 complement(763303..766188) [2886 bp, 961 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR059C
           (AKL1)
          Length = 961

 Score =  278 bits (712), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 143/313 (45%), Positives = 198/313 (63%), Gaps = 21/313 (6%)

Query: 11  VGTRLTVGSHQVEIIKYLTSGGFAQVYSV--------------LISPPDPHTNTNVACLK 56
            G+ + VG HQVE+I+YL  GGFA +Y V              ++ P D        CLK
Sbjct: 31  AGSTVLVGVHQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGD------TVCLK 84

Query: 57  RVIVPDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGG 116
           RV V D+  LN LR EV+ M+ L+N   +V Y DS+A++       YEV +LME C  G 
Sbjct: 85  RVRVSDENGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGS 144

Query: 117 LIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLC 176
           L+D+MN RL  +L E E+L+I+  +T G++ MH  + PLIHRDIKIENVL+  +N +KLC
Sbjct: 145 LLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLC 204

Query: 177 DFGSVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFL 236
           DFGS    +    + QE++ +  +I  +TT QYRSPEMID++R LPI+EKSDIWALGIFL
Sbjct: 205 DFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFL 264

Query: 237 YKLCYYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRI 296
           YKL +YTTPFE  G+ AIL  K+E P   ++S +L +L+  +L +NP  RP+V+Q++  I
Sbjct: 265 YKLLFYTTPFELTGQFAILHSKYEIPRN-SFSSKLINLVIIMLAENPYLRPNVYQVMYHI 323

Query: 297 SIMQNVPCPINDI 309
             M      I+D+
Sbjct: 324 CSMMECEVKIDDL 336

>YBR059C Chr2 complement(356861..360187) [3327 bp, 1108 aa] {ON}
           AKL1Ser-Thr protein kinase, member (with Ark1p and
           Prk1p) of the Ark kinase family; involved in endocytosis
           and actin cytoskeleton organization
          Length = 1108

 Score =  280 bits (716), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 144/317 (45%), Positives = 201/317 (63%), Gaps = 10/317 (3%)

Query: 1   MNQPQIGTYNVGTRLTVGSHQVEIIKYLTSGGFAQVYSV-LISPPDPHTNT--------N 51
           M  P +  Y  G  + VG+H+VE++ YL  GGFAQ+Y V  +   +   NT        +
Sbjct: 14  MGHPAVERYTPGHIVCVGTHKVEVVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGD 73

Query: 52  VACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEY 111
           VACLKRV+V D+  LN +R EV+ M+ LK    +V Y DS+A++       +EV +LME 
Sbjct: 74  VACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMEL 133

Query: 112 CERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNN 171
           C    L+D+MN RL  +L E EI++I+  V   ++ MH L   LIHRDIKIENVL+   N
Sbjct: 134 CPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKN 193

Query: 172 EYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWA 231
            +KL DFGS      +    Q+++ + Q+I  +TT QYRSPEMID++R LPI+EKSDIWA
Sbjct: 194 NFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 232 LGIFLYKLCYYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQ 291
           LG+FLYKL ++TTPFE  G+ AIL  K+EFP+   YS +L +LI  +L +NP  RP+++Q
Sbjct: 254 LGVFLYKLLFFTTPFEMTGQFAILHSKYEFPVN-KYSSKLINLIIIMLAENPNLRPNIYQ 312

Query: 292 LLKRISIMQNVPCPIND 308
           +L  +  + NV  PI D
Sbjct: 313 VLYHLCEILNVEVPIED 329

>KLLA0F18612g Chr6 (1711131..1713575) [2445 bp, 814 aa] {ON} some
           similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 814

 Score =  275 bits (703), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 137/307 (44%), Positives = 200/307 (65%), Gaps = 11/307 (3%)

Query: 12  GTRLTVGSHQVEIIKYLTSGGFAQVYSV----LISPPDPHTNT------NVACLKRVIVP 61
            T++ VG+H+ EI+++L  GGFA +Y V    L +  D   ++      ++ACLKRVIVP
Sbjct: 32  NTQVVVGTHRCEILEHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIACLKRVIVP 91

Query: 62  DKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFM 121
           D+  LN LR EV+ M+ L+ +  +V Y DS+A++    +  +E+ +LME C +  L+D+M
Sbjct: 92  DENGLNELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYM 151

Query: 122 NTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGSV 181
           N +L  +L E EIL+I+  V+  +A MH L  PLIHRDIKIENVL+  ++ +KLCDFGS 
Sbjct: 152 NNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGST 211

Query: 182 CGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLCY 241
                +    Q+++ +  +I  +TT QYRSPEMID++R LPI+EKSDIWALGIFLYKL +
Sbjct: 212 SMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLF 271

Query: 242 YTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQN 301
           YTTPFE  G+ AIL  K+E P    YS +L +LI  +L +NP  RP+++Q++  +  +  
Sbjct: 272 YTTPFELTGQFAILHSKYEIPQN-GYSSKLINLIIIMLAENPSLRPNIYQVMHHVCSILK 330

Query: 302 VPCPIND 308
              P  D
Sbjct: 331 CDVPFTD 337

>TBLA0I01930 Chr9 complement(436511..440596) [4086 bp, 1361 aa] {ON}
           Anc_3.273 YBR059C
          Length = 1361

 Score =  275 bits (704), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 138/314 (43%), Positives = 201/314 (64%), Gaps = 12/314 (3%)

Query: 6   IGTYNVGTRLTVGSHQVEIIKYLTSGGFAQVYSV-LISPPDPHTNT----------NVAC 54
           I  Y  G  ++VG+HQV+I  YL  GGFAQ+Y V  I   +   N           ++AC
Sbjct: 32  IEKYKPGKLISVGAHQVKIEDYLAEGGFAQIYKVKFIDYLNEFENKKDQLNSLKSGDIAC 91

Query: 55  LKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCER 114
           LKRV+V D+  LN +R EV+ M+LL+    +V Y DS+A +       YE+ +LME C  
Sbjct: 92  LKRVLVNDENGLNEMRNEVEVMKLLQGCPNIVQYYDSNALRRNDGLNGYEILLLMELCPN 151

Query: 115 GGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYK 174
             L+D+MN RL+ +L+E EI++I+   T  V+ MH L  PLIH+DIK+EN+L+ +NN +K
Sbjct: 152 NSLLDYMNQRLKTKLNETEIVKIMYDTTLAVSQMHYLDKPLIHKDIKVENILVDSNNNFK 211

Query: 175 LCDFGSVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGI 234
           LCDFGS      +  +  +++ + Q+I  +TT QYRSPEMID++R LPI+E SDIWALG+
Sbjct: 212 LCDFGSTSPCYEIVTSHHDIAVLTQNIYMHTTPQYRSPEMIDLYRCLPINETSDIWALGV 271

Query: 235 FLYKLCYYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLK 294
           FLYKL ++ TPFE+ G+ +IL  KF+ P+  NY  +L +LI  +L +N   RP+++Q++ 
Sbjct: 272 FLYKLLFFITPFERTGQFSILHAKFDIPVN-NYHPKLINLIIIMLSENLNLRPNIYQVMY 330

Query: 295 RISIMQNVPCPIND 308
            I  + N P PI D
Sbjct: 331 EICSITNTPLPIED 344

>SAKL0A03344g Chr1 complement(305149..306243) [1095 bp, 364 aa] {ON}
           similar to uniprot|Q7LGU7 Saccharomyces cerevisiae
           YPL236C Hypothetical ORF
          Length = 364

 Score =  107 bits (267), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 95/350 (27%), Positives = 158/350 (45%), Gaps = 77/350 (22%)

Query: 18  GSHQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIVPDKPSLNTLRAEVDAMR 77
           G H   I + L  GGF+ VY V         N ++  LK++  P       + +  +AMR
Sbjct: 25  GQHYA-IQRLLGEGGFSFVYLV-----QSRENNDLFALKKIHCP----FGNIESVSEAMR 74

Query: 78  LLKN-NRYVVSYIDSHAAKAILQ--NGSYEVFVLMEYCERGGLIDFMNTRLQN--RLHEF 132
            + +  ++   YI    +  +LQ  +GS  VF+L+ Y   G L+D +NT L +   + E 
Sbjct: 75  EVNSYKKFRSPYITHCVSSQVLQEQDGSKTVFILLPYFPTGSLLDKINTHLLDGTTISEE 134

Query: 133 EILQIISQVTQGVAAMH-------------ALQPPLIHRD-------------------- 159
           EI++I+  V +G+  MH             ++   L +RD                    
Sbjct: 135 EIVRILVSVARGLRTMHNPAGQEDSIEDQTSVNTDLQYRDTVSMTYNEDLRLLNDSLELD 194

Query: 160 --------------------IKIENVLISTNNEYKLCDFGSVCGIIRLPRNSQ-ELSYVQ 198
                               IK  N++ S++    +CD GS C    +  +S+ +L   Q
Sbjct: 195 VLSGNTSSFMASTTAYSHKDIKPANIMFSSDGLPVICDLGS-CSRAHVDISSRSQLVEFQ 253

Query: 199 QDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEP------ 252
           +   ++ T  +RSPE++++     IDEK DIW+LG  LY +C+  +PFE+  +       
Sbjct: 254 EWCNEHCTLPFRSPELLNVTLNSKIDEKVDIWSLGCTLYCMCFGISPFEREEQLSGASMT 313

Query: 253 -AILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQN 301
            AI +GKF  P   NYS +L  +I+D +  +   RPS+ +LL R+  +Q 
Sbjct: 314 YAIATGKFSIPPNTNYSPELIKIIKDCIEVDSKKRPSIDELLARLQDLQG 363

>Kwal_56.24274 s56 (932404..933444) [1041 bp, 346 aa] {ON} YPL236C -
           Hypothetical ORF [contig 165] FULL
          Length = 346

 Score =  101 bits (251), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 88/337 (26%), Positives = 145/337 (43%), Gaps = 63/337 (18%)

Query: 15  LTVGSHQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIVPDKPSLNTLRAEVD 74
           +++   +  I K L  GG + VY V            +  LK+   P      ++ +   
Sbjct: 19  VSINGRKYRIQKLLGEGGLSFVYLV------ESKEGELFALKKTRCP----FGSIGSISP 68

Query: 75  AMRLLKNNR-----YVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFMNTRLQN-- 127
           AM+ + N +     Y+   +DS   +   ++GS  V+VL+ Y  +G L D +N  L +  
Sbjct: 69  AMKEVANYQRFSSPYIAQIVDSQVVQE--KDGSKTVYVLLPYFAKGSLQDLINRHLLDCT 126

Query: 128 RLHEFEILQIISQVTQGVAAMHALQP---------------------------------- 153
           ++ E +IL++   + +G+  +H   P                                  
Sbjct: 127 QMSELDILRMALGIARGLLCIHEANPNHETDVAYSIVSAPYAEDSSLLNDLELDTFGESQ 186

Query: 154 -PLIHRDIKIENVLISTNNEYKLCDFGSVCGIIRLPRNS-QELSYVQQDILKNTTAQYRS 211
               HRD+K  N++IS  +   + D GS C   R+  NS Q L   Q+    N T  Y +
Sbjct: 187 QSYAHRDVKPSNIMISPEDLPVISDLGS-CSRARIDINSRQALLRFQEWSSDNCTLSYAA 245

Query: 212 PEMIDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEP-------AILSGKFEFPLY 264
           PE++D+     I EK DIW+ G  +Y +C+  +PFE+  +        AI +GK+  P  
Sbjct: 246 PEILDVKLNSVITEKCDIWSFGCTMYSMCFGISPFEREEQISGASVTYAITTGKYTVPRG 305

Query: 265 PNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQN 301
            +YS  L  LI   L  NP  RPSV +L+  +  +Q 
Sbjct: 306 TSYSSSLIELIGKCLSVNPEQRPSVNELIALLMELQG 342

>KLTH0H03080g Chr8 complement(274038..275078) [1041 bp, 346 aa] {ON}
           similar to uniprot|Q7LGU7 Saccharomyces cerevisiae
           YPL236C Hypothetical ORF
          Length = 346

 Score = 96.3 bits (238), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 86/334 (25%), Positives = 152/334 (45%), Gaps = 57/334 (17%)

Query: 15  LTVGSHQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIVP--DKPSLNTLRAE 72
           ++V  H+  I + L  GGF+ VY V     +   N  +A LK++  P     S++    E
Sbjct: 19  VSVNGHRYHIKRLLGEGGFSFVYLV-----ESRENGLMA-LKKIRCPFGSIGSISPAMKE 72

Query: 73  VDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFMNTRLQN--RLH 130
           VD  +  K+  Y+   IDS   +   ++GS  V++L+ Y  +G L D +N  L +  ++ 
Sbjct: 73  VDNYQKFKSP-YIAQIIDSQVVQE--RDGSKTVYILLPYFSKGSLQDEINRHLLDCTQVP 129

Query: 131 EFEILQIISQVTQGVAAMHALQPP-----------------------------------L 155
           E E++++   V +G+  +H   P                                     
Sbjct: 130 ELEVVRLALGVARGLLCIHDAAPADESDVTYSIVSAPYAEDSSLLNDLELDTFGESHQAY 189

Query: 156 IHRDIKIENVLISTNNEYKLCDFGSVCGIIRLPRNS-QELSYVQQDILKNTTAQYRSPEM 214
            H DIK  N++IS+     + D GS C    +  NS Q L   Q+   ++ T  + +PE+
Sbjct: 190 AHHDIKPSNIMISSEGMPVISDLGS-CSRACVEINSRQALLQFQEWRSEHCTLTFMAPEI 248

Query: 215 IDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEP-------AILSGKFEFPLYPNY 267
           +D+     I EK D+W+ G  +Y +C+  +PFE+  +        ++ +GK+  P   NY
Sbjct: 249 LDVKLNSVITEKCDVWSFGCTIYTMCFGISPFEREEQISGASVTYSLTTGKYSIPSGTNY 308

Query: 268 SEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQN 301
           S  L  +++  L  +P  RPSV +L+  +  +Q+
Sbjct: 309 SSGLIDVVKKCLNVDPDGRPSVDELISLLMDLQS 342

>KAFR0A05090 Chr1 (1011918..1013924) [2007 bp, 668 aa] {ON} 
          Length = 668

 Score = 99.0 bits (245), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 83/309 (26%), Positives = 147/309 (47%), Gaps = 54/309 (17%)

Query: 14  RLTVG-----SHQVEIIKYLTSGGFAQV-------YSVLISPPDPHTNTNVACLKRVIVP 61
           RLT+      SH    + YL +G + Q+       +S++     P ++  +A  K  I  
Sbjct: 27  RLTISRKRKDSHTTIHVPYL-AGPYKQLNKIGKGSHSIVYKVTHPTSDATLALKKLPIND 85

Query: 62  DKPSLN---TLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLI 118
            K   N   T+  E++  +L+  ++ ++S ID     A +       ++++E C  G L 
Sbjct: 86  YKLKTNRRSTILKEIEIHKLVNGHKNIISMIDHFEIDATM-------YMVLELCGAGSLY 138

Query: 119 DFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDF 178
           D +  R +  L E+E  +++ Q+   V  +H  +  ++H D+K+ N+LI ++N  +LCDF
Sbjct: 139 DII-CRSKRSLREWEAKRLMIQLCGAVDWIH--EKNIVHADLKLSNILIDSSNNLQLCDF 195

Query: 179 GSVCGIIRLPRNSQELSYVQQDILKNT-----TAQYRSPEMIDIF-----RGLPIDEKSD 228
           G               S+V  DI  N+     T  Y SPE+I  F     + L   ++SD
Sbjct: 196 GH--------------SFVSTDIDNNSINKFGTPNYLSPEIISNFILSDKKDLYFPKESD 241

Query: 229 IWALGIFLYKLCYYTTPFE----KGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPC 284
           IW++GI LY + +  TPFE    +     I+  K+ F      S ++K LI++IL   P 
Sbjct: 242 IWSIGIVLYAMIFDKTPFEATTLRSTYENIVECKYGFVENKRVSNKVKKLIQNILKIQPL 301

Query: 285 HRPSVFQLL 293
            R ++ +++
Sbjct: 302 ERKTIVEIV 310

>Suva_16.70 Chr16 complement(110631..111725) [1095 bp, 364 aa] {ON}
           YPL236C (REAL)
          Length = 364

 Score = 92.0 bits (227), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 86/348 (24%), Positives = 153/348 (43%), Gaps = 64/348 (18%)

Query: 13  TRLTVGSHQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVAC-----LKRVIVPDKPSLN 67
           T + V   + +I + L  GG + VY V +          VA      LK++I P+  S++
Sbjct: 21  TTIRVNDKRYKIQRLLGEGGLSFVYLVQLLKGSLIMENGVAAPELYALKKIICPNVESIS 80

Query: 68  TLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFMNTRL-- 125
               E++  +  ++  YV+  IDS   +   ++GS  +++++ +   G L D +N RL  
Sbjct: 81  NGMREIENYKRFQSP-YVIQSIDSQVMQE--KDGSKSIYIILPFYTLGSLQDSINRRLLE 137

Query: 126 QNRLHEFEILQIISQVTQGVAAMH---------------------------------ALQ 152
              + E E ++I+  V +G+  +H                                  L+
Sbjct: 138 GTFISEAECVRIMLGVIRGLLCLHDPASRQDNTNSRTTVDTVSMTYSDETAFLLEDTPLE 197

Query: 153 PPLI-----------HRDIKIENVLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDI 201
             ++           HRDI   N+L S++    + D GS         N  +L  +Q+ +
Sbjct: 198 MDMLSSNLGASIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIGNRNQLRELQEWV 257

Query: 202 LKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEP-------AI 254
             N T  Y +PE++ +     +D K DIW+LG   Y L +  +PFE+  +        AI
Sbjct: 258 NDNCTLPYTAPELLGLKLNQTLDCKVDIWSLGCTFYTLMFGISPFEREEQIHGASITYAI 317

Query: 255 LSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQNV 302
            +GK+ FP    +SE L S+I+  +  +P  RP+  QLL   +I+Q++
Sbjct: 318 NTGKYSFPRNSRFSEGLLSVIKKCIQVDPVQRPTTSQLL---NILQDL 362

>YPL236C Chr16 complement(101608..102702) [1095 bp, 364 aa] {ON}
           ENV7Protein proposed to be involved in vacuolar
           functions; mutant shows defect in CPY processing; has
           sequence similarity with the human serine/threonine
           protein kinase STK16
          Length = 364

 Score = 91.7 bits (226), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 82/332 (24%), Positives = 141/332 (42%), Gaps = 61/332 (18%)

Query: 15  LTVGSHQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVA-----CLKRVIVPDKPSLNTL 69
           + V   +  I + L  GG + VY V +S      +  +A      LK++I P   S++  
Sbjct: 23  IRVNDKRYRIQRLLGEGGMSFVYLVQLSKNSLIIDNGIATPELYALKKIICPSVESISNG 82

Query: 70  RAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFMNTRL--QN 127
             E++  +  ++  YV+  IDS   +   ++GS  +++++ Y   G L D +N RL    
Sbjct: 83  MREIENYKRFQSP-YVIKSIDSQVMQE--KDGSKTIYIVLPYYSLGSLQDSINRRLLEGT 139

Query: 128 RLHEFEILQIISQVTQGVAAMH-------------------------------------- 149
            + E E ++I+  VT+G+  +H                                      
Sbjct: 140 FVSEAECVRIMLGVTRGLLCLHDPASRQDNATSRVNVDAVSMTYSDETAMLLEDTPLEMD 199

Query: 150 ------ALQPPLIHRDIKIENVLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILK 203
                 A      HRDI   N+L S++    + D GS         N  +LS +Q+ +  
Sbjct: 200 MLSSNSAGSIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIENRHQLSELQEWVND 259

Query: 204 NTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEP-------AILS 256
           N T  Y  PE++++     +  K DIW+LG   Y L +  +PFE+  +        AI +
Sbjct: 260 NCTLPYTPPELLNLKLNQVLSSKVDIWSLGCTFYTLMFGISPFEREEQIHGASLTYAINT 319

Query: 257 GKFEFPLYPNYSEQLKSLIRDILVQNPCHRPS 288
           GK+ FP    +SE L S+I+  +  +P  RP+
Sbjct: 320 GKYSFPRNSRFSEGLLSVIKKCIQVDPIQRPT 351

>KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52
           YDR507C
          Length = 1125

 Score = 94.4 bits (233), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 92/322 (28%), Positives = 151/322 (46%), Gaps = 49/322 (15%)

Query: 5   QIGTYNVGTRLTVGS-HQVEIIKYLTSGGFA--QVYSVLISPPDPHTNTNVACLKRVIVP 61
           QIG++ +G  L +GS  +V++    T+G  A  +V S  I       ++NV  +     P
Sbjct: 14  QIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTI-----FQDSNVTSMVDNTTP 68

Query: 62  DKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFM 121
           D       R E+  M+LL N+  V+   D     + L       ++++EY E+G L + +
Sbjct: 69  DALPYGIER-EIVIMKLL-NHANVLRLYDVWETNSNL-------YMVLEYAEKGELFNLL 119

Query: 122 NTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGSV 181
             R    L E E ++   Q+  G++  HAL   ++HRD+K EN+L+ T    K+ DFG  
Sbjct: 120 VER--GPLPENEAIRFFRQIIIGISYCHALG--IVHRDLKPENLLLDTKYNIKIADFGMA 175

Query: 182 CGIIRLPRNSQELSYVQQDILKNTTA---QYRSPEMIDIFRGLPIDE-KSDIWALGIFLY 237
                            +D L  T+     Y +PE++    G+P     SD+W+ G+ LY
Sbjct: 176 A-------------LETEDKLLETSCGSPHYAAPEIVS---GIPYHGFASDVWSCGVILY 219

Query: 238 KLCYYTTPF--EKGGEPAIL----SGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQ 291
            L     PF  E G    +L    +G+FE P     S++ ++LI  ILV NP  R +   
Sbjct: 220 ALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARD 279

Query: 292 LLKRISIMQNVPCPINDIQTVQ 313
           +LK   ++Q  P  I D ++++
Sbjct: 280 ILKH-PLLQKYPS-IKDSKSIR 299

>TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {ON}
           Anc_6.31 YMR001C
          Length = 798

 Score = 92.8 bits (229), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 81/314 (25%), Positives = 137/314 (43%), Gaps = 39/314 (12%)

Query: 28  LTSGGFAQVYSVLISPPDPHTNTNVACLKRVIVPDKPSLNTLRAE---VDAMRLLKNNRY 84
           L  GGFA+ +         H   +V       +  K S+ T R +   +  +++ +N RY
Sbjct: 99  LGEGGFARCF---------HIKDDVGISFACKIVSKKSIKTERTKFKLLSEIQIHQNLRY 149

Query: 85  --VVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVT 142
             +V ++D              V++L+E C  G L+D +  R    L E E+  + +QV 
Sbjct: 150 SHIVKFMDCFE-------DELNVYILLELCPNGSLMDLLKKR--KILTEAEVKFMTTQVC 200

Query: 143 QGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDIL 202
             +  MH+    +IHRD+K+ NV    N   K+ DFG    +     N  E  Y      
Sbjct: 201 GAINYMHS--NNIIHRDLKLGNVFFDKNFNIKIGDFGLAATL----SNVSEKKYTMCG-- 252

Query: 203 KNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAILSG----K 258
              T  Y +PE+I + + +    ++DIW+LGI +Y +     PF+      I       +
Sbjct: 253 ---TPNYIAPEVI-LSKQIGHSFEADIWSLGIMIYAMVLGKPPFQAKDVTTIYEKIKLCQ 308

Query: 259 FEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQNVPCPINDIQTVQAPSSH 318
           +EFP     +  +K LI+D+LV +P  RP +  +LK      + P  +      + P   
Sbjct: 309 YEFPPDKYITNDVKVLIQDLLVLDPSQRPRIMDILKYNWFKHSFPPKLPSTIFTEVPLYF 368

Query: 319 LNLTELHQLSATQN 332
           + L+ L+ L   +N
Sbjct: 369 IELSTLNSLKHFKN 382

>Smik_1.79 Chr1 complement(149839..152763) [2925 bp, 974 aa] {ON}
           YAR019C (REAL)
          Length = 974

 Score = 92.8 bits (229), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 84/287 (29%), Positives = 134/287 (46%), Gaps = 33/287 (11%)

Query: 14  RLTVGSHQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIVPDKPSLNTLRAEV 73
           R +  S Q  + + +  G +  VY  +    + HT+  VA +K ++  +   LN + AE+
Sbjct: 17  RASEKSVQYHLKQVIGRGSYGVVYKAI----NKHTDQVVA-IKEIVYENDEELNDIMAEI 71

Query: 74  DAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFE 133
             ++ L N+  +V Y   H         SYE+++L+EYC  G L   + +R    L E E
Sbjct: 72  SLLKNL-NHHNIVKY---HG----FIRKSYELYILLEYCANGSLRRLI-SRSSTGLSENE 122

Query: 134 ILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGSVCGIIRLPRNSQE 193
               ++Q   G+  +H     +IHRDIK  N+L+S +N  KL DFG V  I+    NS  
Sbjct: 123 SKTYVTQTLLGLKYLHG--EGVIHRDIKAANILLSADNTVKLADFG-VSTIV----NSSA 175

Query: 194 LSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPA 253
           L+          T  + +PE++   RG      SDIW+LG  + ++     P+    +  
Sbjct: 176 LTLAG-------TLNWMAPEILGN-RG--ASTLSDIWSLGATVVEMLTKNPPYHNLTDAN 225

Query: 254 ILSGKFEFPLYP--NYSEQLKSLIRDILVQNPCHRPSVFQLLKRISI 298
           I         YP  ++SE LK  +    V+N   RP+  QLLK + I
Sbjct: 226 IYYAVENDTYYPPSSFSESLKDFLSKCFVKNMYKRPTADQLLKHVWI 272

>YAR019C Chr1 complement(172211..175135) [2925 bp, 974 aa] {ON}
           CDC15Protein kinase of the Mitotic Exit Network that is
           localized to the spindle pole bodies at late anaphase;
           promotes mitotic exit by directly switching on the
           kinase activity of Dbf2p; required for spindle
           disassembly after meiosis II
          Length = 974

 Score = 92.4 bits (228), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 85/287 (29%), Positives = 134/287 (46%), Gaps = 33/287 (11%)

Query: 14  RLTVGSHQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIVPDKPSLNTLRAEV 73
           R +  S Q  + + +  G +  VY  +    + HT+  VA +K V+  +   LN + AE+
Sbjct: 17  RASEKSVQYHLKQVIGRGSYGVVYKAI----NKHTDQVVA-IKEVVYENDEELNDIMAEI 71

Query: 74  DAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFE 133
             ++ L +N  +V Y   H         SYE+++L+EYC  G L   + +R    L E E
Sbjct: 72  SLLKNLNHNN-IVKY---HG----FIRKSYELYILLEYCANGSLRRLI-SRSSTGLSENE 122

Query: 134 ILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGSVCGIIRLPRNSQE 193
               ++Q   G+  +H     +IHRDIK  N+L+S +N  KL DFG V  I+    NS  
Sbjct: 123 SKTYVTQTLLGLKYLHG--EGVIHRDIKAANILLSADNTVKLADFG-VSTIV----NSSA 175

Query: 194 LSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPA 253
           L+          T  + +PE++   RG      SDIW+LG  + ++     P+    +  
Sbjct: 176 LTLAG-------TLNWMAPEILG-NRG--ASTLSDIWSLGATVVEMLTKNPPYHNLTDAN 225

Query: 254 ILSGKFEFPLYP--NYSEQLKSLIRDILVQNPCHRPSVFQLLKRISI 298
           I         YP  ++SE LK  +    V+N   RP+  QLLK + I
Sbjct: 226 IYYAVENDTYYPPSSFSEPLKDFLSKCFVKNMYKRPTADQLLKHVWI 272

>Smik_11.139 Chr11 (235511..240115) [4605 bp, 1534 aa] {ON} YKL101W
           (REAL)
          Length = 1534

 Score = 92.8 bits (229), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 68/234 (29%), Positives = 117/234 (50%), Gaps = 32/234 (13%)

Query: 85  VVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQG 144
           ++S+ +  A   + +N S E+++++EY + G L D++ ++   +L E E +    Q+ +G
Sbjct: 170 LISHTNVMALFEVWENKS-ELYLVLEYVDGGELFDYLVSK--GKLPEREAIHYFKQIVEG 226

Query: 145 VAAMHALQPPLIHRDIKIENVLISTNNEY-KLCDFGSVCGIIRLPRNSQELSYVQQDILK 203
           V+  H+    + HRD+K EN+L+   N   K+ DFG     + LP            +LK
Sbjct: 227 VSYCHSFN--ICHRDLKPENLLLDKKNRRIKIADFG--MAALELP----------NKLLK 272

Query: 204 NT--TAQYRSPEMI--DIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAIL---- 255
            +  +  Y SPE++    + G P    SD+W+ GI L+ L     PF       +L    
Sbjct: 273 TSCGSPHYASPEIVMGRPYHGGP----SDVWSCGIVLFALLTGHLPFNDDNIKKLLLKVQ 328

Query: 256 SGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQNVPCPINDI 309
           SGK++ P+  N S + + LI  ILV +P  R +  ++LK   I +    P+N I
Sbjct: 329 SGKYQMPM--NLSAEARDLISKILVIDPAKRITTQEILKHPLIKKYDDLPVNKI 380

>TDEL0A06750 Chr1 (1179818..1180936) [1119 bp, 372 aa] {ON}
           Anc_6.262 YPL236C
          Length = 372

 Score = 90.1 bits (222), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 73/301 (24%), Positives = 132/301 (43%), Gaps = 58/301 (19%)

Query: 55  LKRVIVP--DKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYC 112
           LKR+  P  +  S++    EVD  +  ++  Y+++ +DS   +   ++GS  + +L+ Y 
Sbjct: 73  LKRIRCPFGNIESISAAMKEVDNYKRFQSP-YIITLVDSQVVQE--KDGSKTLCILLPYF 129

Query: 113 ERGGLIDFMNTRL--QNRLHEFEILQIISQVTQGVAAMH--------------------- 149
             G L D +N  L     + E E ++I+  + +G+  +H                     
Sbjct: 130 PLGSLQDMVNRNLLKGTFVSEAECIRIMIGIARGLRCLHDPSARETSDAETMRDTVSLSY 189

Query: 150 -------ALQPPL----------------IHRDIKIENVLISTNNEYKLCDFGSVCGIIR 186
                      PL                +HRDI++ N+L S+     + D GS C    
Sbjct: 190 SDEAAFLLDDTPLELDVLSSHNTVNTRSYVHRDIRLANILFSSEGLPVVSDLGSCCKADI 249

Query: 187 LPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLCYYTTPF 246
                 +L+ +Q  +  N +  Y +PE++++     ID K+DIW++G   Y + +  +PF
Sbjct: 250 TVSTKHQLNELQDWVTANCSFPYTAPELLNVKLNSTIDCKADIWSVGCTCYAMLFGMSPF 309

Query: 247 EKGGEP-------AILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIM 299
           E+  +        AI  GK+ FP    YSE L ++I+  L  +P  RP + +LL  +  +
Sbjct: 310 ERELQVSGASLTYAIGCGKYTFPKQTRYSESLLAVIKSCLQVDPTARPDINELLDTLQDL 369

Query: 300 Q 300
           Q
Sbjct: 370 Q 370

>YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}
           HSL1Nim1p-related protein kinase that regulates the
           morphogenesis and septin checkpoints; associates with
           the assembled septin filament; required along with Hsl7p
           for bud neck recruitment, phosphorylation, and
           degradation of Swe1p
          Length = 1518

 Score = 92.4 bits (228), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 86/332 (25%), Positives = 150/332 (45%), Gaps = 57/332 (17%)

Query: 6   IGTYNVGTRLTVGSH-QVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIVPDKP 64
           +G + +G  L  GS  +V + K + +G  A +  V      P     V C     VP+  
Sbjct: 78  VGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIV------PKKKAFVHCSNNGTVPNSY 131

Query: 65  SLNTLRAEVDAMRLL--------KNNRY----------VVSYIDSHAAKAILQNGSYEVF 106
           S + + + V +  +         + N Y          ++S+ +  A   + +N S E++
Sbjct: 132 SSSMVTSNVSSPSIASREHSNHSQTNPYGIEREIVIMKLISHTNVMALFEVWENKS-ELY 190

Query: 107 VLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVL 166
           +++EY + G L D++ ++   +L E E +    Q+ +GV+  H+    + HRD+K EN+L
Sbjct: 191 LVLEYVDGGELFDYLVSK--GKLPEREAIHYFKQIVEGVSYCHSFN--ICHRDLKPENLL 246

Query: 167 ISTNNEY-KLCDFGSVCGIIRLPRNSQELSYVQQDILKNT--TAQYRSPEMI--DIFRGL 221
           +   N   K+ DFG     + LP            +LK +  +  Y SPE++    + G 
Sbjct: 247 LDKKNRRIKIADFG--MAALELP----------NKLLKTSCGSPHYASPEIVMGRPYHGG 294

Query: 222 PIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAIL----SGKFEFPLYPNYSEQLKSLIRD 277
           P    SD+W+ GI L+ L     PF       +L    SGK++ P   N S + + LI  
Sbjct: 295 P----SDVWSCGIVLFALLTGHLPFNDDNIKKLLLKVQSGKYQMP--SNLSSEARDLISK 348

Query: 278 ILVQNPCHRPSVFQLLKRISIMQNVPCPINDI 309
           ILV +P  R +  ++LK   I +    P+N +
Sbjct: 349 ILVIDPEKRITTQEILKHPLIKKYDDLPVNKV 380

>Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON}
           similar to Ashbya gossypii ABL034W
          Length = 1434

 Score = 91.7 bits (226), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 97/358 (27%), Positives = 158/358 (44%), Gaps = 69/358 (19%)

Query: 2   NQPQIGTYNVGTRLTVGSH-QVEIIKYLTSGGFAQVYSVLISPPD--PHTNTNVACLKRV 58
           N+  +G + +G  L  GS  +V + K + +G  A   ++ I P     H NT +  L   
Sbjct: 57  NRDTVGPWKLGKTLGKGSSGRVRLAKNMETGKLA---AIKIVPKRNVRHNNTQLTSLPYG 113

Query: 59  IVPDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLI 118
           I            E+  M+L       +S+ +  A   + +N   E+++++EY E G L 
Sbjct: 114 I----------EREIIIMKL-------ISHPNVMALYEVWENKP-ELYLVLEYVEGGELF 155

Query: 119 DFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNN-EYKLCD 177
           D++ +R   +L E E +    Q+ QGV+  H     + HRD+K EN+L+   N   K+ D
Sbjct: 156 DYLISR--GKLPEQEAVHYFKQIVQGVSYCHHFN--ICHRDLKPENLLLDKKNLSVKIAD 211

Query: 178 FGSVCGIIRLPRNSQELSYVQQDILKNTTA---QYRSPEMI--DIFRGLPIDEKSDIWAL 232
           FG                    D L  T+     Y SPE++    + G P    SD+W+ 
Sbjct: 212 FGMAA-------------LETTDKLLETSCGSPHYASPEIVMGQKYHGSP----SDVWSC 254

Query: 233 GIFLYKLCYYTTPFEKGGEPAIL----SGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPS 288
           GI L+ L     PF       +L    SGK++ P   N S + K LI  IL+ +P  R +
Sbjct: 255 GIILFALLTGHLPFNDDNVKKLLLKVQSGKYQMPQ--NISNEAKDLIAKILIVDPAMRIT 312

Query: 289 VFQLLKRISIMQNVPCPINDIQTVQAPSSHLNLTELHQLSATQNIQSLNSHLVMGNSI 346
           + ++L+   +++         Q  ++ SS    + LH L +T NI  L S   +  SI
Sbjct: 313 IDEVLEHPLLLK--------YQKTRSKSS----SNLHALDSTPNIVVLESEDKIDESI 358

>ZYRO0E07876g Chr5 (616134..617243) [1110 bp, 369 aa] {ON} similar
           to uniprot|Q7LGU7 Saccharomyces cerevisiae YPL236C
           Hypothetical ORF
          Length = 369

 Score = 88.2 bits (217), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 89/337 (26%), Positives = 145/337 (43%), Gaps = 68/337 (20%)

Query: 15  LTVGSHQVEIIKYLTSGGFAQVYSV-----LISPPDPHTNTNVACLKRVIVP--DKPSLN 67
           L++   +  I K L    F+ +Y V     + +   P TN  +  LKR+  P  +  S++
Sbjct: 26  LSINGRRYSIKKLLGESNFSFIYLVQQIGSVTASSTPRTN--LYALKRIRCPFGNIESIS 83

Query: 68  TLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFMNTRLQN 127
               EVD  +  ++  Y++  +DS  A+   ++GS  V++L+ Y   G L D  +  L N
Sbjct: 84  GAMKEVDNYKRFQSP-YIIHLVDSQVAQQ--RDGSKTVYILLPYFPLGSLQDSTSRNLLN 140

Query: 128 R--LHEFEILQIISQVTQGVAAMH--------ALQ---------------------PPL- 155
              + E E ++I+  + +G+  +H        A Q                      PL 
Sbjct: 141 GTFISEAECIRIVIGIARGLRCLHDPSARSQDAEQQQEHDAVSMSYSDEAAFLLEDTPLE 200

Query: 156 ---------------IHRDIKIENVLISTNNEYKLCDFGSVCGIIRLPRNS-QELSYVQQ 199
                           HRDIK  N+L S++    + + GS C    L  N+  +L+ +Q 
Sbjct: 201 LDILSSANTINSNFYAHRDIKPSNILFSSDGLPVISNLGS-CSKADLSINTGMQLTELQA 259

Query: 200 DILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEP------- 252
            +  + T  Y +PE++ I     +D K DIW+LG   Y + +  +PFE+  +        
Sbjct: 260 WVSDHCTVAYTAPELLHITLNRSVDTKVDIWSLGCTCYFMLFGISPFEREEQISGASLKY 319

Query: 253 AILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSV 289
           AI +G F FP    YSE L  LI   L  NP  RP +
Sbjct: 320 AIGTGNFSFPSQDRYSEGLLKLITKCLQVNPAARPDI 356

>NCAS0B04490 Chr2 (814474..815523) [1050 bp, 349 aa] {ON} Anc_8.141
          Length = 349

 Score = 87.8 bits (216), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 68/203 (33%), Positives = 98/203 (48%), Gaps = 23/203 (11%)

Query: 105 VFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIEN 164
           V++LMEY   G L   +  R     ++    + + Q+   +  +H  Q  +IHRD+K EN
Sbjct: 164 VYLLMEYLVYGELYKLL--RSHGPFNDVIASRFVFQIADALNYLHDKQ--IIHRDLKPEN 219

Query: 165 VLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPID 224
           +LI  NN  KL DFG    II  PR  +  +          T  Y SPEMI   R    D
Sbjct: 220 ILIGFNNVIKLTDFG--WSIIN-PRGVKRKTLC-------GTIDYLSPEMI---RSREYD 266

Query: 225 EKSDIWALGIFLYKLCYYTTPFEKGGE----PAILSGKFEFPLYPNYSEQLKSLIRDILV 280
           +K D+WALG+  Y+L   + PFE+  +      IL    +FP     S  +K LI  +L 
Sbjct: 267 DKVDVWALGVLTYELIVGSPPFEEDTKELTYKRILKNDIKFP--ETVSHDVKDLISKLLK 324

Query: 281 QNPCHRPSVFQLLKRISIMQNVP 303
            NP  R S+  ++K   I++N P
Sbjct: 325 YNPSERISMRDVMKHPWIIRNKP 347

>Skud_16.42 Chr16 complement(75193..76287) [1095 bp, 364 aa] {ON}
           YPL236C (REAL)
          Length = 364

 Score = 87.8 bits (216), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 79/334 (23%), Positives = 146/334 (43%), Gaps = 61/334 (18%)

Query: 13  TRLTVGSHQVEIIKYLTSGGFAQVYSVLI-----SPPDPHTNTNVACLKRVIVPDKPSLN 67
           T + V   + +I + L  GG + VY V +     S  +      +  LK++I P   +++
Sbjct: 21  TTIRVNDRRYKIQRLLGEGGMSFVYLVQLLKGSLSMENSAATAELYALKKIICPSVENIS 80

Query: 68  TLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFMNTRL-- 125
               E++  +  ++  YV+  IDS   +   ++GS  +++++ Y   G L D +N RL  
Sbjct: 81  NGMREIENYKRFQSP-YVIQSIDSQVMQE--KDGSKTIYIILPYYSLGSLQDSINRRLLE 137

Query: 126 QNRLHEFEILQIISQVTQGVAAMH---------------------------------ALQ 152
              + E E ++I+  VT+G+  +H                                  L+
Sbjct: 138 GTFISEAECVRIMLGVTRGLLCLHDPASRQDNVTTRTTVDTISMTYSDETAMLLEDTPLE 197

Query: 153 PPLI-----------HRDIKIENVLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDI 201
             ++           HRDI   N+L S++    + D GS         N  +LS +Q+ +
Sbjct: 198 MDMLSSSSAGLIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIGNRNQLSELQEWV 257

Query: 202 LKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEP-------AI 254
             N T  Y +PE++++     +  K DIW++G   Y L +  +PFE+  +        AI
Sbjct: 258 NDNCTLPYTAPELLNLKLNQALSCKVDIWSMGCTFYTLMFGISPFEREEQIHGASLTYAI 317

Query: 255 LSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPS 288
            +GK+ FP    +SE+L  +I+  +  +P  RP+
Sbjct: 318 NTGKYSFPRNSRFSERLLDVIKRCIQVDPIQRPT 351

>KAFR0D01220 Chr4 (246927..250094) [3168 bp, 1055 aa] {ON} Anc_7.86
            YAL017W
          Length = 1055

 Score = 90.1 bits (222), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 67/218 (30%), Positives = 101/218 (46%), Gaps = 27/218 (12%)

Query: 84   YVVSYIDSHAAKAILQ------NGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQI 137
            Y++S  ++H    I Q      +  Y    L  + E G +  F    L+  + EFE   I
Sbjct: 850  YIMSKFNAHPHDNITQIMDFFEDDDYYYIELESHGETGSIDLFDLIELKTNMTEFEAKLI 909

Query: 138  ISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGSVCGIIRLPRNSQELSYV 197
              Q+  G+  +H     ++HRDIK ENV++ +N   KL DFGS       P       +V
Sbjct: 910  FKQIVSGIKYLH--DQGIVHRDIKDENVIVDSNGFVKLIDFGSAAYTKTGPFE----VFV 963

Query: 198  QQDILKNTTAQYRSPEMI--DIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAIL 255
                    T  Y +PE++  + ++G P     DIWALG+ LY L Y   PF    E  IL
Sbjct: 964  G-------TIDYAAPEILGGNPYKGKP----QDIWALGVLLYTLIYKENPFYNVDE--IL 1010

Query: 256  SGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLL 293
             G+  F    N ++    LIR IL ++   RPS+ +++
Sbjct: 1011 EGQLRFDGTCNVTQDCIDLIRWILTKSVNDRPSIDEIV 1048

>Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON}
           (44906..47596) [2691 nt, 897 aa]
          Length = 896

 Score = 90.1 bits (222), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 81/294 (27%), Positives = 135/294 (45%), Gaps = 66/294 (22%)

Query: 17  VGSHQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIVP--DKPSLNTLRAEVD 74
           VG+++  I+K +  G F +VY  L  P            K+V++   DK   N +R    
Sbjct: 36  VGNYK--ILKQIGEGSFGKVYLALHKP----------THKKVVLKSSDKTDPNVVR---- 79

Query: 75  AMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEI 134
              +  + ++   YI       I +    +V++++EYC    L D++ ++   R+   E 
Sbjct: 80  --EIFYHRQFDFPYITKLYEVIITET---KVWMVIEYCPNKELYDYLLSK--KRISLDES 132

Query: 135 LQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGSVCGIIRLPRNSQEL 194
            +I +Q+   V   H+L    +HRD+K+EN+L+  +N  KL DFG               
Sbjct: 133 ARIFAQIVGAVYYAHSLS--CVHRDLKLENILLDKDNNAKLTDFG--------------- 175

Query: 195 SYVQQDILKNT-------TAQYRSPEMI--DIFRGLPIDEKSDIWALGIFLYKLCYYTTP 245
               +D  KNT       T  Y +PE++  + + G  I    DIWALGI LY +   T P
Sbjct: 176 --FTRDFSKNTQLETICGTTVYMAPELLRREKYDGYKI----DIWALGILLYTIINGTMP 229

Query: 246 FE----KGGEPAILSGKFEFPLYPN--YSEQLKSLIRDILVQNPCHRPSVFQLL 293
           F+    K  E  I+S     P Y N  +++    L+  +L ++P  RP++ Q+L
Sbjct: 230 FDEDDPKKTELKIISAS---PDYDNKYFNDDSIDLVNRLLSKDPSMRPTIEQIL 280

>Skud_1.72 Chr1 (141337..144261) [2925 bp, 974 aa] {ON} YAR019C
           (REAL)
          Length = 974

 Score = 90.1 bits (222), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 84/287 (29%), Positives = 132/287 (45%), Gaps = 33/287 (11%)

Query: 14  RLTVGSHQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIVPDKPSLNTLRAEV 73
           R +  S Q  + + +  G +  VY  +    + HT+  VA +K ++      LN + AE+
Sbjct: 17  RASEKSVQYHLKQVIGRGSYGVVYKAI----NKHTDQVVA-IKEIVYESDEELNDIMAEI 71

Query: 74  DAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFE 133
             ++ L N+  +V Y   H         SYE+++L+EYC  G L   + +R    L E E
Sbjct: 72  SLLKNL-NHDNIVKY---HG----FIRKSYELYILLEYCANGSLRRLI-SRSSTGLSENE 122

Query: 134 ILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGSVCGIIRLPRNSQE 193
               ++Q   G+  +H     +IHRDIK  N+L+S +N  KL DFG V  I+    NS  
Sbjct: 123 SKSYVTQTLLGLKYLHG--EGVIHRDIKAANILLSADNTVKLADFG-VSTIV----NSSA 175

Query: 194 LSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPA 253
           L+          T  + +PE++   RG      SDIW+LG  + ++     P+    +  
Sbjct: 176 LTLAG-------TLNWMAPEILG-NRG--ASTLSDIWSLGATVVEMLTKNPPYHNLTDAN 225

Query: 254 ILSGKFEFPLYP--NYSEQLKSLIRDILVQNPCHRPSVFQLLKRISI 298
           I         YP  ++SE LK  +    V+N   RP+  QLLK   I
Sbjct: 226 IYYAVENDTYYPPSSFSESLKDFLSKCFVKNMYKRPTADQLLKHAWI 272

>Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL101W
           (REAL)
          Length = 1518

 Score = 90.1 bits (222), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 68/234 (29%), Positives = 117/234 (50%), Gaps = 32/234 (13%)

Query: 85  VVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQG 144
           ++S+ +  A   + +N S E+++++EY + G L D++ ++   +L E E +    Q+ +G
Sbjct: 170 LISHANVMALFEVWENKS-ELYLVLEYVDGGELFDYLVSK--GKLPEREAIHYFKQIVEG 226

Query: 145 VAAMHALQPPLIHRDIKIENVLISTNN-EYKLCDFGSVCGIIRLPRNSQELSYVQQDILK 203
           V+  H+    + HRD+K EN+L+   N + K+ DFG     + LP            +LK
Sbjct: 227 VSFCHSFN--ICHRDLKPENLLLDKKNRKIKIADFG--MAALELP----------NKLLK 272

Query: 204 NT--TAQYRSPEMI--DIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAIL---- 255
            +  +  Y SPE++    + G P    SD+W+ GI L+ L     PF       +L    
Sbjct: 273 TSCGSPHYASPEIVMGRPYHGGP----SDVWSCGIVLFALLTGHLPFNDDNIKKLLLKVQ 328

Query: 256 SGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQNVPCPINDI 309
           SGK++ P+  N S + + LI  ILV NP  R +  ++L    I +    PIN +
Sbjct: 329 SGKYQMPM--NLSAEARDLISKILVINPEKRITTQEILNHPLIKKYDNLPINKM 380

>KNAG0F00170 Chr6 (13778..15409) [1632 bp, 543 aa] {ON} Anc_1.24
           YDR523C
          Length = 543

 Score = 88.6 bits (218), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 91/374 (24%), Positives = 169/374 (45%), Gaps = 46/374 (12%)

Query: 72  EVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHE 131
           E+  M LLK+  Y+  YI +        N  Y ++++MEYC  G   D + T  +  L E
Sbjct: 62  EMRLMSLLKS-PYIARYITT-------INEDYLMWIVMEYCGGGSARDLIKTCYREGLAE 113

Query: 132 FEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGSVCGIIRLPRNS 191
            ++  ++  V  G+  +HA     IHRDIK  N+L++ +   K+ DFG           S
Sbjct: 114 NKVAFVVKSVLLGLQYLHAQHK--IHRDIKAANILLTDSGLVKVADFGV----------S 161

Query: 192 QELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGE 251
            E+    +      T  + +PE++ +  G+  +EKSDIW+LGI  Y+L     P  K   
Sbjct: 162 AEMRSTMKAKTFVGTPYWMAPEVV-MNEGMGYNEKSDIWSLGITTYELLKGVPPLAKYDA 220

Query: 252 PAILSG--KFEFP-LYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQNVPCPIND 308
             ++    K + P L+  Y+  +K  I   L+++P  RPS  +LL+    M   P    +
Sbjct: 221 IRVMRNIPKRKPPKLHGAYTNLVKHFIATCLIKDPEKRPSASELLEH-DFMVKGP---GN 276

Query: 309 IQTVQAPSSHLNLTELHQLSATQNIQ-SLNSHLVMGNSIPTTAFQFS--TPVNMATAQTL 365
           ++ ++   S+L  T+  Q  A +  +  +N    + +S    + Q    +P+   + +  
Sbjct: 277 VENLKNEVSYLKFTKETQAVARKKSRYDINEQGEIHDSENCASEQVDDRSPIFELSTKQP 336

Query: 366 PIKEESNIFYD---------------PTSCNFAKDSQSRLNNALSRSPFELEAVSDLNNV 410
           P K+ES +  +               P S N  K+  S ++   + +P  +E+     + 
Sbjct: 337 PYKKESWVAQEVMSPPELNESSEDPSPISPNILKEKDSGISKNQTETPITMESAPFKKDG 396

Query: 411 KDEANSTTRLKQTI 424
           +D+ N+   +++ +
Sbjct: 397 EDKKNTDHTVERLV 410

>Ecym_2153 Chr2 complement(287697..288788) [1092 bp, 363 aa] {ON}
           similar to Ashbya gossypii AFL143C
          Length = 363

 Score = 86.7 bits (213), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 82/346 (23%), Positives = 146/346 (42%), Gaps = 61/346 (17%)

Query: 7   GTYNVGTRLTVGSHQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIVPDKPSL 66
           G +  G R+++      +   L  G    +Y V   P   H+   V  LK+V  P   + 
Sbjct: 16  GFWFDGVRISINGKSYLVTTLLREGELTALYQVK-CPKRSHSG-GVYALKKVTCPIGRAD 73

Query: 67  NTLRAEVDAMRLLK-NNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFMNTRL 125
              RA  +     + N+ Y+ + +D   A+    NG+  +++L+ Y   G L D +N  +
Sbjct: 74  FVTRAMTEISNYQRFNSPYITNILDFQVAQH--DNGTKIIYMLLPYFPAGSLQDLINNMI 131

Query: 126 --QNRLHEFEILQIISQVTQGVAAMHA--------------------------------- 150
              + L E  +++++  + +GV  MH                                  
Sbjct: 132 IRGDSLSESRVVRLMLDICRGVRCMHEPSESDFRDPYDVAYFDAASLRYSDETHLLVDAM 191

Query: 151 ----LQPPL--------IHRDIKIENVLISTNNEYKLCDFGS-VCGIIRLPRNSQELSYV 197
               L PPL        +H  +  EN+++S+     + +  S V   + L  NS+ L  +
Sbjct: 192 ELDLLSPPLTNSEPSAYVHCGLNPENIMLSSEGLPVIYNMASCVRAPLELTSNSKLLG-L 250

Query: 198 QQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEK----GGEP- 252
           Q+ + +N+   Y  PE++D+     I  + DIW+LG   Y L Y  + F +     G P 
Sbjct: 251 QEWLNENSCLPYTCPELLDLHPNTSITNRCDIWSLGCICYALMYSISSFAREQQLCGTPI 310

Query: 253 --AILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRI 296
             +I +G F FP  P YS+ LK +++  LV +P  RP +++ L + 
Sbjct: 311 KHSISTGNFSFPDEPRYSQSLKRIVQRCLVIDPHKRPDIYETLAQF 356

>Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL101W
           (REAL)
          Length = 1526

 Score = 89.4 bits (220), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 67/234 (28%), Positives = 119/234 (50%), Gaps = 32/234 (13%)

Query: 85  VVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQG 144
           ++S+ +  A   + +N S E+++++EY + G L D++ +R   +L E E +    Q+ +G
Sbjct: 170 LISHANVMALFEVWENKS-ELYLVLEYVDGGELFDYLVSR--GKLPEREAIHYFKQIVEG 226

Query: 145 VAAMHALQPPLIHRDIKIENVLIS-TNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILK 203
           V+  H+    + HRD+K EN+L+   N + K+ DFG     + LP            +LK
Sbjct: 227 VSYCHSFN--ICHRDLKPENLLLDKKNKKIKIADFG--MAALELP----------NKLLK 272

Query: 204 NT--TAQYRSPEMI--DIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAIL---- 255
            +  +  Y SPE++    + G P    SD+W+ GI L+ L     PF       +L    
Sbjct: 273 TSCGSPHYASPEIVMGRPYHGGP----SDVWSCGIVLFALLTGHLPFNDDNIKKLLLKVQ 328

Query: 256 SGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQNVPCPINDI 309
           SGK++ P+  N S + ++LI  ILV +P  R +  ++L+   I +    P+N +
Sbjct: 329 SGKYQMPM--NLSLEARNLISKILVIDPEKRITTQEILEHPLIKKYDNLPVNKM 380

>Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150W
           (REAL)
          Length = 918

 Score = 88.6 bits (218), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 81/291 (27%), Positives = 134/291 (46%), Gaps = 60/291 (20%)

Query: 17  VGSHQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIVPDKPSLNTLRAEVDAM 76
           VG+++  I+K +  G F +VY  L  P    T+  V CLK     DK   N +R      
Sbjct: 38  VGNYK--ILKQVGEGSFGKVYLALHRP----THRKV-CLK---TSDKNDPNIVR------ 81

Query: 77  RLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQ 136
            +  + ++   YI       + +    +V++ +EYC    L D + +   +R+   E  +
Sbjct: 82  EVFYHRQFDFPYITKLYEVIVTET---KVWMALEYCPGKELYDHLLS--LHRISLLECAE 136

Query: 137 IISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGSVCGIIRLPRNSQELSY 196
           + +Q++  V   H++    +HRD+K+EN+L+  N   KL DFG                +
Sbjct: 137 LFAQISGAVYYAHSMH--CVHRDLKLENILLDKNGNAKLTDFG----------------F 178

Query: 197 VQQDILKNT------TAQYRSPEMID--IFRGLPIDEKSDIWALGIFLYKLCYYTTPFEK 248
            ++ + K T      T  Y +PE+I+   + G  I    DIW+LG+ LY L   + PF+ 
Sbjct: 179 TRECMTKTTLETVCGTTVYMAPELIERRTYDGFKI----DIWSLGVILYTLITGSLPFDD 234

Query: 249 GGEPAILSGKFEF-PLYPNYSEQL-----KSLIRDILVQNPCHRPSVFQLL 293
             E   +  K++     PNY   L     K LI  +L +NP  RPS+ Q+L
Sbjct: 235 DDE---VKTKWKIVNEEPNYDSTLIPDDAKDLISRLLAKNPKERPSLPQVL 282

>TBLA0A04720 Chr1 (1168895..1172683) [3789 bp, 1262 aa] {ON} Anc_7.86
            YAL017W
          Length = 1262

 Score = 88.2 bits (217), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 70/228 (30%), Positives = 105/228 (46%), Gaps = 29/228 (12%)

Query: 66   LNTLRAEVDAMRLLK--NNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFMN- 122
            L T+ +E+  M  L   +N+ ++S +D        ++  Y  +V      + G ID  + 
Sbjct: 1049 LGTIPSEIQIMSTLNKTSNKNILSILD------FFEDDDY-YYVEQPVHGKTGCIDLFDL 1101

Query: 123  TRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGSVC 182
               +  + EFE   I  Q+  G++ +H  +  ++HRDIK ENV++      KL DFGS  
Sbjct: 1102 IEFKTNMTEFEAKLIFKQIISGISHLH--ESGIVHRDIKDENVIVDAKGFVKLIDFGSAA 1159

Query: 183  GIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEK-SDIWALGIFLYKLCY 241
             +   P           D+   T   Y SPE   + RG   + K  DIWALGI LY + +
Sbjct: 1160 YVKNGPF----------DVFVGTI-DYASPE---VLRGEKYEGKPQDIWALGILLYTIVF 1205

Query: 242  YTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSV 289
               PF    E  IL G  +FP   N S     LI+ IL ++   RPS+
Sbjct: 1206 KENPFYNIDE--ILEGDMKFPETENISANCIDLIKLILNRSALERPSI 1251

>Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON}
           complement(4445..5575) [1131 nt, 377 aa]
          Length = 376

 Score = 85.5 bits (210), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 80/289 (27%), Positives = 125/289 (43%), Gaps = 41/289 (14%)

Query: 23  EIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVI----VPDKPSLNTLRAEVDAMRL 78
           EI + L  G F +VY V       H  + + C  +V+    + +       + E+D    
Sbjct: 119 EIGRKLGKGKFGKVYCVR------HKPSGLICALKVMNKMEIVNFNVQKQFKREIDIQYH 172

Query: 79  LKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQII 138
           L +      Y   H +K         V+++MEY   G L   +  +    +++      +
Sbjct: 173 LNHKNLTKLYAFFHDSK--------NVYLVMEYLIGGELYKLL--KKNGPMNDITASNYV 222

Query: 139 SQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQ 198
            Q+T  +  MH  +  +IHRD+K EN+LI  NN+ KL DFG     I  P N +  +   
Sbjct: 223 YQMTDALNYMHKRK--IIHRDLKPENILIGFNNQIKLTDFGWS---IYNPNNQKRKTLC- 276

Query: 199 QDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGE----PAI 254
                  T  Y SPE+I        DE  D+WALGI  Y+L     PFE+  +      I
Sbjct: 277 ------GTIDYLSPELIS---SREYDENVDVWALGILTYELVVGAPPFEEDTKEQTYKRI 327

Query: 255 LSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQNVP 303
                +FP  PN S + + LI ++L   P  R ++ Q++    I +N P
Sbjct: 328 AKSDLKFP--PNVSSEARDLITNLLKVVPSERFNLQQVMNHPWIEKNKP 374

>Smik_6.441 Chr6 (721619..722713) [1095 bp, 364 aa] {ON} YPL236C
           (REAL)
          Length = 364

 Score = 85.1 bits (209), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 86/342 (25%), Positives = 149/342 (43%), Gaps = 77/342 (22%)

Query: 13  TRLTVGSHQVEIIKYLTSGGFAQVYSV------------LISPPDPHTNTNVACLKRVIV 60
           T + V   + +I + L  GG + VY V            +I+P        +  LK++I 
Sbjct: 21  TTIRVNDKRYKIQRLLGEGGMSFVYLVQLLKNSLIMENGIITP-------EMYALKKIIC 73

Query: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDF 120
           P   S++    E++  +  ++  YV+  IDS   +   +NGS  +++++ Y   G L D 
Sbjct: 74  PSVESISNGMREIENYKRFQSP-YVIQSIDSQVTQE--KNGSKIIYIILPYYSLGSLQDS 130

Query: 121 MNTRL--QNRLHEFEILQIISQVTQGVAAMHA-------LQP------------------ 153
           +N RL     + E E ++I+  VT+G+  +H        + P                  
Sbjct: 131 INRRLLEGTFISEAECVRIMLGVTRGLLCLHDPASRQDNITPRVNVDAVSMTYSDETAML 190

Query: 154 ----PL---------------IHRDIKIENVLISTNNEYKLCDFGSVC-GIIRLPRNSQE 193
               PL                HRDI   N+L S+     + D GS     IR+   +Q 
Sbjct: 191 LEDTPLEMDVLSSGSAGSIAYAHRDITPSNILYSSEGLPVIADLGSCSQADIRIGSRNQ- 249

Query: 194 LSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEP- 252
           LS +Q+ +  N T  Y +PE++++     +  K DIW++G   Y L +  +PFE+  +  
Sbjct: 250 LSELQEWVNDNCTLPYTAPELLNLKLNQILSCKVDIWSMGCTFYTLMFGISPFEREEQIH 309

Query: 253 ------AILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPS 288
                 AI +GK+ FP    +SE L ++I+  +  +P  RP+
Sbjct: 310 GASITYAINTGKYSFPRNSRFSEALLNVIKKCIQVDPIQRPT 351

>CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]
           {ON} similar to uniprot|P34244 Saccharomyces cerevisiae
           YKL101w serine/threonine-protein kinase
          Length = 1489

 Score = 87.4 bits (215), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 66/219 (30%), Positives = 108/219 (49%), Gaps = 30/219 (13%)

Query: 97  ILQNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLI 156
           + +N S E+++++EY + G L D++ ++   +L E E +   +Q+ QGV+  H+    + 
Sbjct: 194 VWENKS-ELYLVLEYVDGGELFDYLVSK--GKLSEPEAVHYFTQIIQGVSYCHSFN--IC 248

Query: 157 HRDIKIENVLISTNNEY-KLCDFGSVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMI 215
           HRD+K EN+L+   N+  K+ DFG     + LP    E S          +  Y SPE++
Sbjct: 249 HRDLKPENLLLDKKNKVIKIADFG--MAALELPNKLLETSC--------GSPHYASPEIV 298

Query: 216 --DIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAIL----SGKFEFPLYPNYSE 269
               + G P    SD+W+ GI L+ L     PF       +L    +G+F+ P Y   + 
Sbjct: 299 MGKPYHGGP----SDVWSCGIILFALLTGHLPFNDDNIKKLLLKVQAGRFQLPPY--LTN 352

Query: 270 QLKSLIRDILVQNPCHRPSVFQLLKR--ISIMQNVPCPI 306
             K LI  ILV NP  R ++ ++L    I   +N P  I
Sbjct: 353 DAKDLITRILVTNPEKRLTINEILNHPLIKKYRNPPAHI 391

>KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1112

 Score = 87.0 bits (214), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 85/300 (28%), Positives = 136/300 (45%), Gaps = 44/300 (14%)

Query: 6   IGTYNVGTRLTVGSHQVEIIKY-LTSGGFAQVYSVLISPPDPHTNTNVACLKRVIVPDKP 64
           IG + +G+ L VGS    ++ Y  T G  A V  +  S  +   +T +      ++P   
Sbjct: 14  IGPWKLGSTLGVGSTGKVVMAYNETKGQQAAVKIISKSIFNAQGSTMIGGNDPDVLP--- 70

Query: 65  SLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFMNTR 124
               +  E+  M+LL N+  V+   D       +   S ++++++EY E+G L + +  R
Sbjct: 71  --YGIEREIIIMKLL-NHPNVLRLYD-------VWETSKDLYMVLEYVEKGELFNLLVER 120

Query: 125 LQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGSVCGI 184
               L E E ++   Q+  G++  HAL   ++HRD+K EN+L+      KL DFG     
Sbjct: 121 --GPLPENEAVRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKFNVKLADFGMAA-- 174

Query: 185 IRLPRNSQELSYVQQDILKNTTA---QYRSPEMIDIFRGLPIDE-KSDIWALGIFLYKLC 240
                         +D L  T+     Y +PE++    GLP    +SD+W+ G+ LY L 
Sbjct: 175 -----------LESKDKLLETSCGSPHYAAPEIVS---GLPYHGFESDVWSCGVILYALL 220

Query: 241 YYTTPF--EKGGEPAIL----SGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLK 294
               PF  E G    +L    SGKFE P     S + + LI  IL  +P  R    ++LK
Sbjct: 221 TGRLPFDEEDGNIRNLLLKVQSGKFEMPGDDEISSEAQDLIARILTVDPEQRIKTREILK 280

>TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2.479
           YKL101W
          Length = 1369

 Score = 87.0 bits (214), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 64/213 (30%), Positives = 104/213 (48%), Gaps = 32/213 (15%)

Query: 97  ILQNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLI 156
           + +N S E+++++EY + G L D++ +R   RL E E +    Q+ QGV+  HA    + 
Sbjct: 184 VWENKS-ELYLVLEYVDGGELFDYLVSR--GRLCEREAVHYFKQIIQGVSYCHAFN--IC 238

Query: 157 HRDIKIENVLISTNNE-YKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTTA--QYRSPE 213
           HRD+K EN+L+   N   K+ DFG                 V   +L+ +     Y SPE
Sbjct: 239 HRDLKPENLLLDKKNSTIKIADFGMAA------------LEVSNKLLQTSCGSPHYASPE 286

Query: 214 MI--DIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAIL----SGKFEFPLYPNY 267
           ++    + G P    SD+W+ GI L+ L     PF       +L    SGK++ P   N 
Sbjct: 287 IVMGKQYHGGP----SDVWSCGIILFALLTGHLPFNDDSIKKLLLKVQSGKYQMP--QNL 340

Query: 268 SEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQ 300
           S++ + LI  IL  NP  R +  ++L+   I++
Sbjct: 341 SKEAQDLIAKILTVNPAKRLTTEEILRHPLIVK 373

>KNAG0A06540 Chr1 (1002435..1006733) [4299 bp, 1432 aa] {ON}
           Anc_2.479 YKL101W
          Length = 1432

 Score = 87.0 bits (214), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 62/198 (31%), Positives = 98/198 (49%), Gaps = 27/198 (13%)

Query: 104 EVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIE 163
           ++F+++EY + G L D++ ++   +L E+E +    Q+ +GVA  H+    + HRD+K E
Sbjct: 189 DLFLVLEYVDGGELFDYLVSK--GKLPEWEAVHYFKQIIEGVAFCHSYN--ICHRDLKPE 244

Query: 164 NVLISTNNEY-KLCDFGSVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMI--DIFRG 220
           N+L+   N+  K+ DFG     + LP    E S          +  Y SPE++    + G
Sbjct: 245 NLLLDKKNKIIKIADFG--MAALELPNKLLETSC--------GSPHYASPEIVMGKPYHG 294

Query: 221 LPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAIL----SGKFEFPLYPNYSEQLKSLIR 276
            P    SD+W+ GI L+ L     PF       +L    SG+F  P   N S + + LI 
Sbjct: 295 GP----SDVWSCGIILFALLTGHLPFNDDNIRKLLLKVQSGRFRLPR--NISLEAQDLIA 348

Query: 277 DILVQNPCHRPSVFQLLK 294
            ILV NP  R  +  +LK
Sbjct: 349 KILVVNPRQRIKISDILK 366

>Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON}
           (51805..54024) [2220 nt, 740 aa]
          Length = 739

 Score = 86.3 bits (212), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 77/301 (25%), Positives = 132/301 (43%), Gaps = 44/301 (14%)

Query: 27  YLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRY-- 84
           +L  GGFA+ + +            VA   ++ +  + + N L +E+   ++ KN R+  
Sbjct: 103 FLGEGGFARCFQMKDDDGKVFAAKTVA---KISIKSEKARNKLLSEI---QIHKNMRHQN 156

Query: 85  VVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQG 144
           +V +ID              V++L+E C  G L+D +  R    L E E+    +Q+   
Sbjct: 157 IVHFIDCFE-------DDINVYILLEICPNGSLMDLLKRR--KILTEPEVRFFTTQICGA 207

Query: 145 VAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKN 204
           +  MH+    +IHRD+K+ N+    +   K+ DFG +  II    N  E  Y        
Sbjct: 208 LDHMHSRN--IIHRDLKLGNIFFDKDFNLKIGDFG-LAAIIN---NENERKYTIC----- 256

Query: 205 TTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAILS----GKFE 260
            T  Y +PE+I   + +    + DIW+LG+ ++ +     PF+      I        + 
Sbjct: 257 GTPNYIAPEVIMGGKQIGHSFEVDIWSLGVMIFAMITGKPPFQAKEVSTIYDRIKHCNYS 316

Query: 261 FPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKR------------ISIMQNVPCPIND 308
           FP     S+ +K LI+DIL  NP  RP++ ++L              I +M ++P    D
Sbjct: 317 FPTDKYVSKDVKKLIQDILSMNPMERPTIQEILNYNWFKGNFPPCMPIDVMNDIPIYFMD 376

Query: 309 I 309
           I
Sbjct: 377 I 377

>Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {ON}
           YHR102W (KIC1) - PAK/Ste20 kinase family [contig 128]
           FULL
          Length = 865

 Score = 86.3 bits (212), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 68/223 (30%), Positives = 103/223 (46%), Gaps = 40/223 (17%)

Query: 101 GSY----EVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLI 156
           GSY    +++V+MEYC  G L   +      ++ E  I  I+ ++    A MH  +  +I
Sbjct: 83  GSYLNDTKLWVIMEYCAGGSLRTLLRP---GKIGEQYIGVIMRELL--TALMHIHKDGVI 137

Query: 157 HRDIKIENVLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMID 216
           HRDIK  NVLI+ +   KLCDFG    + +     Q ++          T  + +PE+  
Sbjct: 138 HRDIKAANVLITNDGHIKLCDFGVAAQLSQTKIRRQTMA---------GTPYWMAPEV-- 186

Query: 217 IFRGLPIDEKSDIWALGIFLYKLCYYTTPFEK-----------GGEPAILSGKFEFPLYP 265
           I  G+  D K DIW+LGI  Y++     P+ +             +P  L G+       
Sbjct: 187 IMEGVYYDTKVDIWSLGITAYEIATGNPPYCEVEALRAMQLITKSKPPRLEGR------- 239

Query: 266 NYSEQLKSLIRDILVQNPCHRPSVFQLLKR--ISIMQNVPCPI 306
            +S  LK +I   L ++P  RPS   LLK   I + +NVP  I
Sbjct: 240 QHSSALKEIIALCLDEDPKERPSAEDLLKTKFIKLHKNVPVSI 282

>NCAS0A00280 Chr1 (40406..42013) [1608 bp, 535 aa] {ON} Anc_1.24
          Length = 535

 Score = 85.5 bits (210), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 82/284 (28%), Positives = 135/284 (47%), Gaps = 38/284 (13%)

Query: 19  SHQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIVPDKPSLNTLRAEVDAMRL 78
           +H   + + +  G F  VY  +    D  TN  VA     +      L  L  E+  +  
Sbjct: 19  AHNYIVKECVGRGNFGDVYRAI----DRTTNKVVAIKVVDLENTNERLEVLAQEIFFLAE 74

Query: 79  LKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQII 138
           LK+  Y+++YI +     +L++ S  ++++MEYC  G   D +     N L E ++  I 
Sbjct: 75  LKSP-YIINYITT-----LLEDAS--MWIVMEYCGGGSCSDLLKYYFNNGLPEKKVAYIT 126

Query: 139 SQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQ 198
            ++ +G+  +H  +   IHRDIK  N+L++     KL DFG V G ++        S ++
Sbjct: 127 REILKGLQYLHEQKK--IHRDIKAANILLTEEGHVKLGDFG-VSGQLK--------STLR 175

Query: 199 QDILKNTTAQYRSPEM----IDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEP-- 252
           +  +   T  + +PE+    I+ +     DEK DIW+LGI +++L     P  K  +P  
Sbjct: 176 RGTIVG-TPYWMAPEVASQNIEGY-----DEKIDIWSLGITVFELLKGVPPLVK-LDPIR 228

Query: 253 --AILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLK 294
             A LS K    L   YS+  KS +   L++NP  RP+   LLK
Sbjct: 229 VLANLSRKSAPRLQGAYSDAAKSFVALCLIKNPNERPAAVDLLK 272

>TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1391

 Score = 86.7 bits (213), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 88/318 (27%), Positives = 142/318 (44%), Gaps = 42/318 (13%)

Query: 6   IGTYNVGTRLTVGSHQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIVPDKPS 65
           +G + +G  L +GS     + Y +S G      V+      + N N A    ++ PD   
Sbjct: 17  VGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFNNDNAN-ASDSALLTPDSLP 75

Query: 66  LNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFMNTRL 125
               R E+  M+LL N+  V+   D     + L       ++++EY E+G L + +  R 
Sbjct: 76  YGIER-EIIIMKLL-NHPNVLRLYDVWETDSNL-------YMVLEYAEKGELFNLLVER- 125

Query: 126 QNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGSVCGII 185
              L E E ++   Q+  G++  HAL   ++HRD+K EN+L+      K+ DFG      
Sbjct: 126 -GPLPENEAIRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKYNIKIADFGMAA--- 179

Query: 186 RLPRNSQELSYVQQDILKNTTA---QYRSPEMIDIFRGLPIDE-KSDIWALGIFLYKLCY 241
                        +D L  T+     Y +PE+I    GLP    ++D+W+ GI L+ L  
Sbjct: 180 ----------LETEDKLLETSCGSPHYAAPEIIS---GLPYHGLETDVWSCGIILFALLT 226

Query: 242 YTTPF--EKGGEPAIL----SGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKR 295
              PF  E G    +L    SG+FE P     S + + LI  IL  +P  R    ++LK 
Sbjct: 227 GRLPFDEEDGNIRNLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKH 286

Query: 296 ISIMQNVPCPINDIQTVQ 313
             ++Q  P  I D +T++
Sbjct: 287 -PLVQKYPS-IKDSKTIR 302

>ZYRO0G03366g Chr7 (261014..265864) [4851 bp, 1616 aa] {ON} similar
           to uniprot|P34244 Saccharomyces cerevisiae YKL101W HSL1
           Nim1p-related protein kinase that regulates the
           morphogenesis and septin checkpoints associates with the
           assembled septin filament required along with Hsl7p for
           bud neck recruitment phosphorylation and degradation of
           Swe1p
          Length = 1616

 Score = 86.7 bits (213), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 63/206 (30%), Positives = 101/206 (49%), Gaps = 32/206 (15%)

Query: 97  ILQNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLI 156
           + +N S E+++++EY + G L D++ +R   +L E E +    Q+ QGV+  H+    + 
Sbjct: 210 VWENKS-ELYLVLEYVDGGELFDYLVSR--GKLGEREAVHYFKQIVQGVSYCHSFN--IC 264

Query: 157 HRDIKIENVLISTNNE-YKLCDFGSVCGIIRLPRNSQELSYVQQDILKNT--TAQYRSPE 213
           HRD+K EN+L+   N+  K+ DFG                 V   +L+ +  +  Y SPE
Sbjct: 265 HRDLKPENLLLDKKNKSIKIADFGMAA------------LEVSNKLLQTSCGSPHYASPE 312

Query: 214 MI--DIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAIL----SGKFEFPLYPNY 267
           ++    + G P    SD+W+ GI L+ L     PF       +L    SGKF  P   N 
Sbjct: 313 IVMGRPYHGGP----SDVWSCGIILFALLTGHLPFNDDNIKKLLLKVQSGKFHMPQ--NL 366

Query: 268 SEQLKSLIRDILVQNPCHRPSVFQLL 293
           S + K L+  ILV NP  R +  ++L
Sbjct: 367 SAEAKDLMSKILVVNPFKRIATEEIL 392

>KNAG0D04810 Chr4 (867817..872139) [4323 bp, 1440 aa] {ON} Anc_7.86
            YAL017W
          Length = 1440

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 59/177 (33%), Positives = 85/177 (48%), Gaps = 22/177 (12%)

Query: 116  GLIDFMN-TRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYK 174
            G ID  +   L+N + E E+  I  Q+  G+  +H     +IHRDIK ENV++      K
Sbjct: 1272 GCIDLFDLIELKNNMTEMEVKLIFKQIVSGIKHLH--DQAIIHRDIKDENVIVDATGFVK 1329

Query: 175  LCDFGSVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMI--DIFRGLPIDEKSDIWAL 232
            L DFGS   +   P           D+   T   Y +PE++  D + G P     DIWA+
Sbjct: 1330 LIDFGSAAHVKSGPF----------DVFVGTI-DYAAPEVLSGDPYEGKP----QDIWAI 1374

Query: 233  GIFLYKLCYYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSV 289
            GI LY + +   PF    E  IL G+  F    + S + K+LI  IL +N   RP++
Sbjct: 1375 GILLYTIVFKENPFYNIDE--ILEGELTFSESSDVSAECKALISMILNRNVQKRPTI 1429

>Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON}
           (41658..43772) [2115 nt, 705 aa]
          Length = 704

 Score = 85.9 bits (211), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 78/306 (25%), Positives = 131/306 (42%), Gaps = 31/306 (10%)

Query: 27  YLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVV 86
           +L  GGFA+ + +            VA L    +  + +   L +E+   + +K+   VV
Sbjct: 87  FLGEGGFARCFQIKDDSGKIFAAKTVAKLS---IKSEKTRKKLLSEIQIHKSMKHQN-VV 142

Query: 87  SYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVA 146
            +ID              V++L+E C  G L+D +  R    L E E+    +Q+   + 
Sbjct: 143 QFIDCFEDDT-------NVYILLEICPNGSLMDLLKKR--KLLTEPEVRFFTTQICGAIK 193

Query: 147 AMHALQPPLIHRDIKIENVLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTT 206
            MH+ +  +IHRD+K+ N+    N   K+ DFG    +     N +E  Y         T
Sbjct: 194 YMHSRR--VIHRDLKLGNIFFDRNYNLKIGDFGLAAVLA----NDRERKYTV-----CGT 242

Query: 207 AQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAILS----GKFEFP 262
             Y +PE++ + +      + DIW++G+ LY L     PF+      I        F FP
Sbjct: 243 PNYIAPEVL-MGKHSGHSYEVDIWSIGVMLYALLIGKPPFQSKDVNTIYERIKCCDFSFP 301

Query: 263 LYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQNVPCPINDIQTVQAPSSHLNLT 322
              + S + K LI+D+L  +P  RPS+ +++  +      P  I      + P+    LT
Sbjct: 302 KEKHISNEAKVLIQDLLSLDPLERPSISEIMDYVWFRGIFPPYIESTVMTEVPNYDKTLT 361

Query: 323 ELHQLS 328
             HQ S
Sbjct: 362 --HQES 365

>ZYRO0F18062g Chr6 complement(1494752..1496167) [1416 bp, 471 aa]
           {ON} similar to uniprot|P08458 Saccharomyces cerevisiae
           YDR523C SPS1 dispensable for mitosis involved in
           middle/late stage of meiosis required for spore wall
           formation serine/threonine kinase homologous to Ste20p
           expressed in middle/late meiosis
          Length = 471

 Score = 84.3 bits (207), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 77/261 (29%), Positives = 126/261 (48%), Gaps = 29/261 (11%)

Query: 105 VFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIEN 164
           ++++MEYC  G   D +     N + E ++  I SQV +G+  +H  +   IHRDIK  N
Sbjct: 86  MWIVMEYCGGGSCADLIKHIYINGMPEKKVAFITSQVLRGLVYLHEQKK--IHRDIKAAN 143

Query: 165 VLISTNNEYKLCDFGSVCGIIR--LPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLP 222
           +L++     KL DFG V G IR  L R +    +V        T  + +PE++       
Sbjct: 144 ILLTDEGTVKLGDFG-VSGQIRATLKRGT----FV-------GTPYWMAPEVVSK-ENDG 190

Query: 223 IDEKSDIWALGIFLYKLCYYTTPFEKGGEPAILSG--KFEFP-LYPNYSEQLKSLIRDIL 279
            DEK+DIW+LGI +Y+L     P  K     ++    K + P L+ +YS   K+ +   L
Sbjct: 191 YDEKADIWSLGITVYELLKGAPPLSKCDPMKVMINLPKRKPPALHGHYSHSAKNFVSSCL 250

Query: 280 VQNPCHRPSVFQLLKRISIMQ-NVPCPINDIQTVQAPSSHLNLTELHQLSATQNIQSLNS 338
           V+NP  R S +++++   + Q  VP    D++ ++   S+ N +   +        SL +
Sbjct: 251 VKNPVGRASAYEMVEHNFVNQLAVPNLKEDVEYLKIKKSNDNYSRSPKY-------SLEN 303

Query: 339 HLVMGNSIPTTAFQFSTPVNM 359
            L  G S P   + F T  +M
Sbjct: 304 RLYDG-SAPNFTWDFETIRSM 323

>Suva_1.86 Chr1 complement(150761..153685) [2925 bp, 974 aa] {ON}
           YAR019C (REAL)
          Length = 974

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 85/287 (29%), Positives = 131/287 (45%), Gaps = 33/287 (11%)

Query: 14  RLTVGSHQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIVPDKPSLNTLRAEV 73
           R +  S Q  + + +  G +  VY  +    + HT+  VA +K ++  +   LN + AE+
Sbjct: 17  RASEKSVQYHLKQVIGRGSYGVVYKAI----NKHTDQVVA-IKEIVYENDEELNDIMAEI 71

Query: 74  DAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFE 133
            ++    NN  +V Y   H         SYE+++L+EYC  G L   + +R    L E E
Sbjct: 72  -SLLKNLNNNNIVKY---HG----FIRKSYELYILLEYCANGSLRRLV-SRSPTGLSENE 122

Query: 134 ILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGSVCGIIRLPRNSQE 193
               ++Q   G+  +H     +IHRDIK  N+L+S +N  KL DFG V  I+    NS  
Sbjct: 123 SKTYVTQTLWGLKYLHG--EGVIHRDIKAANILLSADNTVKLADFG-VSTIV----NSSA 175

Query: 194 LSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPA 253
           L+          T  + +PE++   RG      SDIW+LG  + +L     P+    +  
Sbjct: 176 LTLAG-------TLNWMAPEILG-NRG--ASTLSDIWSLGATVVELLTKNPPYHNLTDAN 225

Query: 254 ILSGKFEFPLYP--NYSEQLKSLIRDILVQNPCHRPSVFQLLKRISI 298
           I         YP   +SE LK  +    V+N   RP+  QLLK   I
Sbjct: 226 IYYAVENDTYYPPTAFSESLKDFLSKCFVKNMYKRPTADQLLKHAWI 272

>Suva_2.703 Chr2 complement(1238496..1239953) [1458 bp, 485 aa] {ON}
           YDR523C (REAL)
          Length = 485

 Score = 84.3 bits (207), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 65/195 (33%), Positives = 98/195 (50%), Gaps = 22/195 (11%)

Query: 105 VFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIEN 164
           ++++MEYC  G   D +     N L E ++  II QVT G+  +H  +   IHRDIK  N
Sbjct: 84  MWIVMEYCGGGSCSDLLKRNYVNGLPEEKVSFIIHQVTLGLKYLHEQRK--IHRDIKAAN 141

Query: 165 VLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPID 224
           +L++     KL DFG V G IR        S +++D     T  + +PE++       +D
Sbjct: 142 ILLNEEGMVKLGDFG-VSGHIR--------STMKRDTFVG-TPYWMAPEVV----CCEVD 187

Query: 225 ---EKSDIWALGIFLYKLCYYTTPFEKGGEPAILSG--KFEFP-LYPNYSEQLKSLIRDI 278
              EK+DIW+LGI  Y+L     P  K     +++   K + P L  ++SE  K  +   
Sbjct: 188 GYNEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGSFSEAAKEFVAGC 247

Query: 279 LVQNPCHRPSVFQLL 293
           LV+ P  RPS + LL
Sbjct: 248 LVKAPADRPSAYDLL 262

>ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL101W (HSL1)
          Length = 1425

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 81/303 (26%), Positives = 138/303 (45%), Gaps = 51/303 (16%)

Query: 2   NQPQIGTYNVGTRLTVGSH-QVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIV 60
           N+  +G + +G  L  GS  +V + K + SG  A +  V      P  N      +   +
Sbjct: 54  NRDTVGPWKLGKTLGKGSSGRVRLAKNMQSGKLAAIKIV------PKRNVRHNQKQVTAL 107

Query: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDF 120
           P       +  E+  M+L+ +   +  Y        + +N S E+++++EY E G L D+
Sbjct: 108 P-----YGIEREIIIMKLITHPNIMALY-------EVWENKS-ELYLVLEYVEGGELFDY 154

Query: 121 MNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNE-YKLCDFG 179
           +  R   +L E E +    Q+ QGV+  H     + HRD+K EN+L+   N+  K+ DFG
Sbjct: 155 LIAR--GKLPEQEAIHYFKQIVQGVSYCHNFN--ICHRDLKPENLLLDKKNKTVKIADFG 210

Query: 180 SVCGIIRLPRNSQELSYVQQDILKNT--TAQYRSPEMI--DIFRGLPIDEKSDIWALGIF 235
                         L    + +L+ +  +  Y SPE++    + G P    SD+W+ GI 
Sbjct: 211 MAA-----------LETTNR-LLETSCGSPHYASPEIVMGQKYHGSP----SDVWSCGII 254

Query: 236 LYKLCYYTTPFEKGGEPAIL----SGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQ 291
           L+ L     PF       +L     G+++ P   N S++ K LI  ILV +P  R +V +
Sbjct: 255 LFALLTGHLPFNDDNVRKLLLKVQHGRYQMP--SNVSKEAKDLISKILVVDPEKRITVDK 312

Query: 292 LLK 294
           +L+
Sbjct: 313 ILE 315

>KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]
           {ON} weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 878

 Score = 85.1 bits (209), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 68/223 (30%), Positives = 102/223 (45%), Gaps = 40/223 (17%)

Query: 101 GSY----EVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLI 156
           GSY    E++V+MEYC  G L   +      ++ E  I  I+ ++   +A MH  +  +I
Sbjct: 83  GSYLNNTELWVIMEYCAGGSLRTLLRP---GKIGEQYIGVIMRELL--IALMHIHKDGVI 137

Query: 157 HRDIKIENVLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMID 216
           HRDIK  NVLI+ +   KLCDFG    + +     Q ++          T  + +PE+  
Sbjct: 138 HRDIKAANVLITNDGHIKLCDFGVAAQLSQTKIRRQTMA---------GTPYWMAPEV-- 186

Query: 217 IFRGLPIDEKSDIWALGIFLYKLCYYTTPFEK-----------GGEPAILSGKFEFPLYP 265
           I  G+  D K DIW+LGI  Y++     P+               +P  L G+       
Sbjct: 187 IMEGVYYDTKVDIWSLGITAYEIATGNPPYCDVEALRAMQLITKSKPPRLEGR------- 239

Query: 266 NYSEQLKSLIRDILVQNPCHRPSVFQLLKR--ISIMQNVPCPI 306
            +S  LK  I   L ++P  RPS  +LLK   I + +NV   I
Sbjct: 240 QHSSALKEFIALCLDEDPKERPSAEELLKTKFIRLHKNVSASI 282

>TDEL0H03640 Chr8 complement(600211..603924) [3714 bp, 1237 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1237

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 58/180 (32%), Positives = 87/180 (48%), Gaps = 19/180 (10%)

Query: 111  YCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTN 170
            + E G +  F    L+  + EFE   I  QV  G+  +H  +  ++HRDIK ENV++ + 
Sbjct: 1065 HGETGSIDLFDLIELKTNMTEFEAKLIFKQVISGIKHLH--EQGIVHRDIKDENVIVDSK 1122

Query: 171  NEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEK-SDI 229
               KL DFGS   +   P           D+   T   Y +PE   +  G P + K  DI
Sbjct: 1123 GFVKLIDFGSAAYVKSGPF----------DVFVGTI-DYAAPE---VLGGEPYEGKPQDI 1168

Query: 230  WALGIFLYKLCYYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSV 289
            WA+GI LY + +   PF    E  I+ G  +F +    SE+  +LI+ IL +N   RP++
Sbjct: 1169 WAVGILLYTIVFKENPFYNIDE--IMEGTLKFSIGSEVSEECVNLIKKILNKNAPKRPTI 1226

>Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150W
           (REAL)
          Length = 924

 Score = 84.7 bits (208), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 79/294 (26%), Positives = 134/294 (45%), Gaps = 64/294 (21%)

Query: 17  VGSHQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIVPDKPSLNTLRAEVDAM 76
           VG+++  I+K +  G F +VY  L  P    T+  V CLK     DK   N +R      
Sbjct: 38  VGNYK--ILKQIGEGSFGKVYLALHRP----THRKV-CLK---TSDKNDPNIVR------ 81

Query: 77  RLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQ 136
            +  + ++   YI       + ++   +V++ +EYC    L D + +   +R+   E  +
Sbjct: 82  EVFYHRQFDFPYITKLYEVIVTES---KVWMALEYCPGKELYDHLLS--LHRISLLECGE 136

Query: 137 IISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGSVCGIIRLPRNSQELSY 196
           + +Q++  V   H++    +HRD+K+EN+L+  N   KL DFG                +
Sbjct: 137 LFAQISGAVYYAHSMH--CVHRDLKLENILLDKNGNAKLTDFG----------------F 178

Query: 197 VQQDILKNT------TAQYRSPEMI--DIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEK 248
            ++ + K T      T  Y +PE+I    + G  I    D W+LG+ LY L   + PF+ 
Sbjct: 179 TRECMTKTTLETVCGTTVYMAPELIGRKTYDGFKI----DTWSLGVILYTLITGSLPFDD 234

Query: 249 GGEPAILSGKFEFPLY---PNYSEQL-----KSLIRDILVQNPCHRPSVFQLLK 294
             E      K ++ +    P Y  +L     K LI  +L +NP  RPS+ Q+L+
Sbjct: 235 DDE-----AKTKWKIVNEEPKYDPKLIPDDAKDLISRLLAKNPGERPSLPQVLR 283

>NCAS0C04100 Chr3 (834997..837714) [2718 bp, 905 aa] {ON} Anc_8.141
          Length = 905

 Score = 84.7 bits (208), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 89/335 (26%), Positives = 142/335 (42%), Gaps = 75/335 (22%)

Query: 10  NVGTRLTVGSHQVEIIKYLTSGGFAQVYSV-LISPPDPHTNTNVA---------CLKRVI 59
           N  T + VGS +  + K +  G FA V+   LI+P  PH + +V          C    I
Sbjct: 26  NERTTIYVGSDRYIVDKEIGKGSFATVHRAHLITPTSPHLHQSVVDSSSINNPTCFAIKI 85

Query: 60  VPDKPSLNTLRAEVDAMRLLKNNRYVVSYIDS----HAAKAI-LQNGSYEVFVLMEYCER 114
           VP        R+++   +LL+N    ++ +      H  K I  +  S + +++MEYC  
Sbjct: 86  VP--------RSKLKNKKLLENLEIEIAILKKISHPHIVKLIDFERTSKDFYLIMEYCSL 137

Query: 115 GGLIDFMNTRLQ----------------------NRLHEFEILQIISQVTQGVAAMHALQ 152
           G L   +  R Q                      N LH+  IL  + Q++  +  + +  
Sbjct: 138 GDLTFLIKKRQQLIKNHPLLEKIFKKYPPPNEKYNGLHKAFILNYLQQLSSALKFLRSKN 197

Query: 153 PPLIHRDIKIENVLIST-----NNEYKLCDFGSVCGIIRLP-RNSQELSYVQQDILKNTT 206
             L+HRDIK +N+L+S      N+     D G V GI  LP     +  + +   L NT+
Sbjct: 198 --LVHRDIKPQNLLLSAPLINYNDPKSFHDLGFV-GIYNLPILKIADFGFAR--FLPNTS 252

Query: 207 AQ--------YRSPEMIDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAILSGK 258
                     Y +PE+++  +    + K+D+W++G  LY++CY   PF K      L  K
Sbjct: 253 MAETLCGSPLYMAPEILNYQK---YNAKADLWSVGTVLYEMCYGNPPF-KASNHLELYKK 308

Query: 259 FE-------FPLYPNYSEQLKSLIRDILVQNPCHR 286
            +       FP Y      LKSLI  +L  +P  R
Sbjct: 309 IKKANDLIYFPTYIEIDNNLKSLISKLLTFDPQER 343

>Ecym_1058 Chr1 (105835..109329) [3495 bp, 1164 aa] {ON} similar to
           Ashbya gossypii AFR696C
          Length = 1164

 Score = 84.7 bits (208), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 83/301 (27%), Positives = 139/301 (46%), Gaps = 44/301 (14%)

Query: 5   QIGTYNVGTRLTVGS-HQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIVPDK 63
           +IG + +G  L VGS  +V + + + +G  A V  +  S  +   +T V      ++P  
Sbjct: 16  RIGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLP-- 73

Query: 64  PSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFMNT 123
                +  E+  M+LL N+  V+   D       +   S ++++++EY E+G L + +  
Sbjct: 74  ---YGIEREITIMKLL-NHPNVLRLYD-------VWETSTDLYMVLEYVEKGELFNLLIE 122

Query: 124 RLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGSVCG 183
           R    L E E ++   Q+  G++  HAL   ++HRD+K EN+L+      KL DFG    
Sbjct: 123 R--GPLPENEAVRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKFNIKLADFGMAA- 177

Query: 184 IIRLPRNSQELSYVQQDILKNTTA---QYRSPEMIDIFRGLPIDE-KSDIWALGIFLYKL 239
                          +D L  T+     Y +PE++    GLP    +SD+W+ G+ LY L
Sbjct: 178 ------------LESKDKLLETSCGSPHYAAPEIVS---GLPYHGFESDVWSCGVILYAL 222

Query: 240 CYYTTPFEK--GGEPAIL----SGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLL 293
                PF++  G    +L    SG+FE P     S + + LI  IL  +P  R    ++L
Sbjct: 223 LTGRLPFDEDDGNIRKLLLKVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREIL 282

Query: 294 K 294
           K
Sbjct: 283 K 283

>TDEL0A02720 Chr1 complement(491618..494365) [2748 bp, 915 aa] {ON}
           Anc_2.496 YHL007C
          Length = 915

 Score = 84.7 bits (208), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 83/287 (28%), Positives = 134/287 (46%), Gaps = 60/287 (20%)

Query: 30  SGGFAQVYSVLISPPDPHTNTNVACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVVSYI 89
           SGG    Y V        TN +VA +K++ +  +P    +  E+  M+  K+ + +V++I
Sbjct: 634 SGGVYTAYEV-------GTNASVA-IKQMNLEKQPKKELIINEILVMKGSKH-QNIVNFI 684

Query: 90  DSHAAKAILQNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMH 149
           DS+  K        +++V+MEY E G L D +   +   L E +I  +  +  +G+  +H
Sbjct: 685 DSYVLKG-------DLWVVMEYMEGGSLTDVVTHCI---LTEAQIGAVCRETLRGLQFLH 734

Query: 150 ALQPPLIHRDIKIENVLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTTAQY 209
           +    +IHRDIK +N+L+S N E KL DFG  C  I       E++  +  ++   T  +
Sbjct: 735 SKG--VIHRDIKSDNILLSMNGEIKLTDFG-FCAQI------NEINLKRTTMVG--TPYW 783

Query: 210 RSPEMIDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAILSGKFEFPLYPNY-- 267
            +PE++      P   K DIW+LGI + ++          GEP  L+   E PL   Y  
Sbjct: 784 MAPEVVSRKEYGP---KVDIWSLGIMIIEMIE--------GEPPYLN---ETPLRALYLI 829

Query: 268 --------------SEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQ 300
                         S +LKS +   L  NP  R S  +LL+ + I Q
Sbjct: 830 ATNGTPKLKEPEVLSPELKSFLAWCLNVNPDTRASATELLRDVFITQ 876

>TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}
           Anc_6.31 YMR001C
          Length = 787

 Score = 84.3 bits (207), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 65/282 (23%), Positives = 130/282 (46%), Gaps = 29/282 (10%)

Query: 26  KYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYV 85
           ++L  GGFA+ + +            VA   ++ +  + +   L +E+   + +K+   +
Sbjct: 146 QFLGEGGFARCFQIKDESGKIFAAKTVA---KISIKTEKTRRKLLSEIQIHKSMKHQN-I 201

Query: 86  VSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGV 145
           V ++D              V++L+  C  G L++ +  R    L E E+     Q+   +
Sbjct: 202 VQFVDCFEDHI-------NVYILLGMCPNGSLMELLKKR--KILTEPEVRFFTVQICGAI 252

Query: 146 AAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNT 205
             MH+ +  +IHRD+K+ N+    N   K+ DFG    +  +  N +E  Y         
Sbjct: 253 KYMHSRR--VIHRDLKLGNIFFDENYNLKIGDFG----LAAVLANDRERKYTVCG----- 301

Query: 206 TAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAILS----GKFEF 261
           T  Y +PE++ + +      + DIW++G+ ++ L     PF+      I S     ++ F
Sbjct: 302 TPNYIAPEVL-LGKHSGHSYEVDIWSIGVMIFALLIGKPPFQAKDVNTIYSRIKNSEYTF 360

Query: 262 PLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQNVP 303
           P+  + S++ K+LI+DIL+ +P  RPS+ ++++ +      P
Sbjct: 361 PINKSISQEAKTLIQDILINDPIARPSINEIMEYVWFRGTFP 402

>SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1215

 Score = 84.7 bits (208), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 87/322 (27%), Positives = 150/322 (46%), Gaps = 46/322 (14%)

Query: 5   QIGTYNVGTRLTVGSH-QVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIVPDK 63
           +IG + +G+ L  GS  +V + ++ T+G  A V  V  S        N +    ++  + 
Sbjct: 22  KIGPWKLGSILGAGSAGKVLMAQHETTGQQAAVKIVSKSIFGAVAQNNSST---IVGSND 78

Query: 64  PSL--NTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFM 121
           P L    +  E+  M+LL N+  V+   D    K+ L       ++++EY E+G L + +
Sbjct: 79  PDLLPYGIEREIIIMKLL-NHTNVLRLYDVWETKSNL-------YMVLEYVEKGELFNLL 130

Query: 122 NTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGSV 181
             R    L E E ++   Q+  G++  HAL   ++HRD+K EN+L+      K+ DFG  
Sbjct: 131 VER--GPLPENEAVRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKFNIKIADFGMA 186

Query: 182 CGIIRLPRNSQELSYVQQDILKNTTA---QYRSPEMIDIFRGLPIDE-KSDIWALGIFLY 237
                            +D L  T+     Y +PE++    GLP    +SD+W+ G+ LY
Sbjct: 187 A-------------LESKDKLLETSCGSPHYAAPEIVS---GLPYHGFESDVWSCGVILY 230

Query: 238 KLCYYTTPFEK--GGEPAIL----SGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQ 291
            L     PF++  G   ++L    SG++E P     S + + LI  IL  +P  R    +
Sbjct: 231 ALLTGRLPFDEDNGNIRSLLLKVQSGEYEMPGNDEISSEAQDLIAKILTVDPDRRIKTRE 290

Query: 292 LLKRISIMQNVPCPINDIQTVQ 313
           +LK   ++Q  P  I D ++++
Sbjct: 291 ILKH-PLLQKYPS-IKDSKSIR 310

>SAKL0E02860g Chr5 complement(228726..232859) [4134 bp, 1377 aa]
           {ON} similar to uniprot|Q75DQ1 Ashbya gossypii ABL034W
           ABL034Wp and weakly similar to YKL101W uniprot|P34244
           Saccharomyces cerevisiae YKL101W HSL1 Nim1p-related
           protein kinase that regulates the morphogenesis and
           septin checkpoints associates with the assembled septin
           filament required along with Hsl7p for bud neck
           recruitment phosphorylation and degradation of Swe1p
          Length = 1377

 Score = 84.3 bits (207), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 81/297 (27%), Positives = 138/297 (46%), Gaps = 41/297 (13%)

Query: 6   IGTYNVGTRLTVGSH-QVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIVPDKP 64
           +G + +G  L  GS  +V + K + +G  A   ++ I P     +TN +        + P
Sbjct: 58  VGPWKLGKTLGKGSSGRVRLAKNMETGKLA---AIKIVPKKVVRSTNASKKSNAANGNLP 114

Query: 65  SLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFMNTR 124
               +  E+  M+L       +S+ +  A   + +N S E+F+++EY E G L D++ ++
Sbjct: 115 Y--GIEREIIIMKL-------ISHPNIMALYEVWENKS-ELFLVLEYVEGGELFDYLVSK 164

Query: 125 LQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLIS-TNNEYKLCDFGSVCG 183
              +L E E +    Q+ QGVA  H     + HRD+K EN+L+   N++ K+ DFG    
Sbjct: 165 --GKLPEQEAVHYFRQIIQGVAYCHNYN--ICHRDLKPENLLVDKKNHQIKIADFG--MA 218

Query: 184 IIRLPRNSQELSYVQQDILKNTTAQYRSPEMI--DIFRGLPIDEKSDIWALGIFLYKLCY 241
            +       E S          +  Y SPE++    + G P    SD+W+ GI L+ L  
Sbjct: 219 ALETTNKLLETSC--------GSPHYASPEIVMGKNYHGSP----SDVWSCGIILFALLT 266

Query: 242 YTTPFEKGGEPAIL----SGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLK 294
              PF       +L    SGK+  P   N S + + LI  IL+ +P  R ++ ++L+
Sbjct: 267 GHLPFNDDNIKKLLLKVQSGKYHMPQ--NISSEAQDLISKILIVDPRGRITINEVLQ 321

>SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150W
           Hypothetical ORF
          Length = 884

 Score = 84.0 bits (206), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 58/207 (28%), Positives = 97/207 (46%), Gaps = 47/207 (22%)

Query: 104 EVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIE 163
           +V++ +EYC    L +++   +Q+R+   E  ++ +Q+   V   H+LQ   +HRD+K+E
Sbjct: 102 KVWMALEYCPGKELYEYL--LMQHRISLEESGKLFAQIVSAVYYAHSLQ--CVHRDLKLE 157

Query: 164 NVLISTNNEYKLCDFG------------SVCGIIRLPRNSQELSYVQQDILKNTTAQYRS 211
           N+L+      K+ DFG            +VCG                      T  Y +
Sbjct: 158 NILLDKKGRAKITDFGFTRECATKTMLETVCG----------------------TTVYMA 195

Query: 212 PEMID--IFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAILSGKF-EFPLYPN-- 266
           PE+I+   + G  I    DIW+LG+ LY + + T PF++  E         E P Y +  
Sbjct: 196 PELIERKSYDGFKI----DIWSLGVILYTMIHGTMPFDEEDETKTKWKIINEEPFYNDDV 251

Query: 267 YSEQLKSLIRDILVQNPCHRPSVFQLL 293
            S+  K LI  +L ++P  RP + Q+L
Sbjct: 252 VSKDAKDLISQLLCKDPSQRPQLSQVL 278

>SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {ON}
           highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001C
          Length = 695

 Score = 84.0 bits (206), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 79/342 (23%), Positives = 147/342 (42%), Gaps = 38/342 (11%)

Query: 27  YLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVV 86
           +L  GGFA+ + +            VA   ++ +  + +   L +E+   + +K+   +V
Sbjct: 82  FLGEGGFARCFQMKDDSGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMKHPN-IV 137

Query: 87  SYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVA 146
            +ID              V++L+E C  G L+D +  R    L E E+    +Q+   + 
Sbjct: 138 QFIDCFEDDT-------NVYILLEICPNGSLMDLLKKR--KVLTEPEVRYFTTQIVGAIK 188

Query: 147 AMHALQPPLIHRDIKIENVLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTT 206
            MH  +  +IHRD+K+ N+   +N   K+ DFG    +  +  N +E  Y         T
Sbjct: 189 YMHNRR--VIHRDLKLGNIFFDSNYNLKIGDFG----LAAVLANDRERKYTV-----CGT 237

Query: 207 AQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAIL-----SGKFEF 261
             Y +PE++   +      + DIW++G+ +Y L     PF+   E  I+     SG + F
Sbjct: 238 PNYIAPEVL-AGKHSGHSYEVDIWSIGVMIYALLIGKPPFQ-AKEVNIIYERIKSGDYIF 295

Query: 262 PLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQNVPCPINDIQTVQAPSSHLNL 321
           P     S+++  LI+DIL  +P  RPS+ +++  +      P  IN       P      
Sbjct: 296 PREKPTSKEVMVLIQDILSIDPIERPSLDEIMDYVWFRGIFPARINGDVLTSVPV----- 350

Query: 322 TELHQLSATQNIQSLNSHLVMGNSIPTTAFQFSTPVNMATAQ 363
                L   Q++ +  + ++    + T+A     PV +  ++
Sbjct: 351 --YDNLDMDQSLANFKNCMIQSGILGTSAGTTKDPVQIVKSE 390

>CAGL0F00913g Chr6 (97023..100643) [3621 bp, 1206 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017w FUN31 or
            uniprot|Q08217 Saccharomyces cerevisiae YOL045w
          Length = 1206

 Score = 84.3 bits (207), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 61/201 (30%), Positives = 96/201 (47%), Gaps = 33/201 (16%)

Query: 99   QNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHR 158
            Q GS ++F ++E+              ++ + EFE   I  Q+  G+  +H     ++HR
Sbjct: 1036 QTGSVDLFDIIEF--------------KSNMTEFEAKLIFKQIVSGIKHLH--DQGIVHR 1079

Query: 159  DIKIENVLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIF 218
            DIK ENV++ +    KL DFGS   +   P           D+   T   Y +PE   + 
Sbjct: 1080 DIKDENVIVDSKGFVKLIDFGSAAYVKSGPF----------DVFVGTI-DYAAPE---VL 1125

Query: 219  RGLPIDEKS-DIWALGIFLYKLCYYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRD 277
             G P + KS DIWA+GI LY L Y   PF    E  IL G+  F    + S++ K+LI  
Sbjct: 1126 GGNPYEGKSQDIWAIGILLYTLIYKENPFYNIDE--ILEGELRFNDSADVSQECKALITK 1183

Query: 278  ILVQNPCHRPSVFQLLKRISI 298
            IL +    RP++ ++ + + +
Sbjct: 1184 ILNRCVRKRPTIDEICQDVWL 1204

>Smik_4.803 Chr4 complement(1408345..1409817) [1473 bp, 490 aa] {ON}
           YDR523C (REAL)
          Length = 490

 Score = 83.2 bits (204), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 64/199 (32%), Positives = 95/199 (47%), Gaps = 30/199 (15%)

Query: 105 VFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIEN 164
           ++++MEYC  G   D +     N L E ++  II QVT G+  +H  +   IHRDIK  N
Sbjct: 89  MWIVMEYCGGGSCSDLLKRSYVNGLPEEKVSFIIHQVTLGLKYLHEQRK--IHRDIKAAN 146

Query: 165 VLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPID 224
           +L++     KL DFG V G IR        S  ++D     T  + +PE++       +D
Sbjct: 147 ILLNEEGMVKLGDFG-VSGHIR--------STFKRDTFVG-TPYWMAPEVV----CCEVD 192

Query: 225 ---EKSDIWALGIFLYKLCYYTTPFEKGGEPAILSG-------KFEFPLYPNYSEQLKSL 274
              EK+DIW+LGI  Y+L     P  K     +++        K + P    +SE  K  
Sbjct: 193 GYNEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGP----FSEAAKEF 248

Query: 275 IRDILVQNPCHRPSVFQLL 293
           +   LV+ P  RPS + LL
Sbjct: 249 VAGCLVKTPADRPSAYDLL 267

>KAFR0G01200 Chr7 (273238..274761) [1524 bp, 507 aa] {ON} Anc_1.24
           YDR523C
          Length = 507

 Score = 82.8 bits (203), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 77/279 (27%), Positives = 137/279 (49%), Gaps = 27/279 (9%)

Query: 19  SHQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIVPDKPSLNTLRAEVDAMRL 78
           S   +I + +  G F  VY  + +    +    V  L+         ++ L  E+  +  
Sbjct: 13  SSLFDIKECVGRGNFGDVYKAIDNITKKYVAIKVINLEY----SDEDIDLLAQEIFFLAE 68

Query: 79  LKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQII 138
           LK++ Y+++YI +     I+++ S  ++++M+YC  G   D +     N + E ++  I+
Sbjct: 69  LKSD-YIINYITT-----IMEDVS--MWIVMDYCGGGSCSDLIKIVYPNGIVEEKVSFIV 120

Query: 139 SQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQ 198
             V  G+  +H  +   IHRDIK  N+L++ + + KL DFG V G I+        + ++
Sbjct: 121 KNVLLGLQYLHEQKK--IHRDIKAANILLTDDGQVKLGDFG-VSGQIK--------ATLK 169

Query: 199 QDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAILSG- 257
           +D    T   + +PE+I+       DEK DIW+LGI  Y+L     P  K     +++  
Sbjct: 170 RDTFVGT-PYWMAPEVINKEINNGYDEKVDIWSLGITTYELLKGVPPLSKYDPVKVMTSL 228

Query: 258 -KFEFP-LYPNYSEQLKSLIRDILVQNPCHRPSVFQLLK 294
            K + P L+  Y++  KS I   L+++P  RP+V  LLK
Sbjct: 229 VKRKPPKLHGPYNDFTKSFISFCLIKDPKLRPNVQNLLK 267

>KAFR0D04950 Chr4 (971956..974982) [3027 bp, 1008 aa] {ON} Anc_5.406
           YHR102W
          Length = 1008

 Score = 84.0 bits (206), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 68/255 (26%), Positives = 113/255 (44%), Gaps = 41/255 (16%)

Query: 62  DKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFM 121
           D+  +  ++ E+  +  LK    +  Y  S+     L+N S  ++++MEYC  G L   +
Sbjct: 71  DEDEVEDVQKEIQFLASLKQLPNITRYYGSY-----LKNTS--LWIIMEYCGGGSLRSLL 123

Query: 122 NTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGSV 181
                 ++ E  I  I+ ++   +  +H  +  +IHRDIK  NVLI+ +   KLCDFG  
Sbjct: 124 R---PGKIDEKYIGVIMREILIALKYIH--KDNVIHRDIKAANVLINNDGSIKLCDFGVA 178

Query: 182 CGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLCY 241
             + +     Q ++          T  + +PE+  I  G+  D K+DIW+ GI  Y++  
Sbjct: 179 AQLNQTKSRRQTMA---------GTPYWMAPEV--IMEGVYYDTKADIWSTGITAYEVTT 227

Query: 242 YTTPF-----------EKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVF 290
              P+               +P  L G+       NYS  +K  I   L ++P  RP+  
Sbjct: 228 GNPPYCDVEALRAMQLIAKSKPPRLEGR-------NYSALIKEFIATCLDEDPSERPTAD 280

Query: 291 QLLKRISIMQNVPCP 305
           +LLK   I    P P
Sbjct: 281 ELLKTAFIKTYKPLP 295

>Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 83.6 bits (205), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 73/293 (24%), Positives = 126/293 (43%), Gaps = 29/293 (9%)

Query: 27  YLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVV 86
           +L  GGFA+ + +     D      VA   +  +  + +   L +E+   + + +   +V
Sbjct: 87  FLGEGGFARCFQIKDDSGDIFAAKTVA---KASIKSEKTRKKLLSEIQIHKSMAHPN-IV 142

Query: 87  SYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVA 146
            +ID     +        V++L+E C  G L++ +  R    L E E+    +Q+   + 
Sbjct: 143 QFIDCFEDDS-------NVYILLEICPNGSLMELLKRR--KVLSEPEVRFFTTQICGAIK 193

Query: 147 AMHALQPPLIHRDIKIENVLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTT 206
            MH+ +  +IHRD+K+ N+   +N   K+ DFG    +     N  E  Y         T
Sbjct: 194 YMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFGLAAVLA----NESERKYTI-----CGT 242

Query: 207 AQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAILSG----KFEFP 262
             Y +PE++ + +      + DIW+LG+ LY L     PF+      I        F FP
Sbjct: 243 PNYIAPEVL-MGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVNTIYERIKCRDFSFP 301

Query: 263 LYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQNVPCPINDIQTVQAP 315
                S++ K LIRDIL  +P  RPS+ +++  +      P  I      + P
Sbjct: 302 KDKPISDEGKILIRDILSLDPIERPSLTEIMDYVWFRGTFPPSIPSTVMSEVP 354

>YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON}
           CDC5Polo-like kinase with multiple functions in mitosis
           and cytokinesis through substrate phosphorylation, also
           functions in adaptation to DNA damage during meiosis;
           has similarity to Xenopus Plx1 and S. pombe Plo1p;
           possible Cdc28p substrate
          Length = 705

 Score = 83.2 bits (204), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 73/293 (24%), Positives = 127/293 (43%), Gaps = 29/293 (9%)

Query: 27  YLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVV 86
           +L  GGFA+ + +     +      VA   +  +  + +   L +E+   + + +   +V
Sbjct: 87  FLGEGGFARCFQIKDDSGEIFAAKTVA---KASIKSEKTRKKLLSEIQIHKSMSHPN-IV 142

Query: 87  SYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVA 146
            +ID     +        V++L+E C  G L++ +  R    L E E+    +Q+   + 
Sbjct: 143 QFIDCFEDDS-------NVYILLEICPNGSLMELLKRR--KVLTEPEVRFFTTQICGAIK 193

Query: 147 AMHALQPPLIHRDIKIENVLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTT 206
            MH+ +  +IHRD+K+ N+   +N   K+ DFG    +     N  E  Y         T
Sbjct: 194 YMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFGLAAVLA----NESERKYTI-----CGT 242

Query: 207 AQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAILSG----KFEFP 262
             Y +PE++ + +      + DIW+LG+ LY L     PF+      I        F FP
Sbjct: 243 PNYIAPEVL-MGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVNTIYERIKCRDFSFP 301

Query: 263 LYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQNVPCPINDIQTVQAP 315
                S++ K LIRDIL  +P  RPS+ +++  +      P  I      +AP
Sbjct: 302 RDKPISDEGKILIRDILSLDPIERPSLTEIMDYVWFRGTFPPSIPSTVMSEAP 354

>NCAS0A05770 Chr1 (1132854..1137239) [4386 bp, 1461 aa] {ON}
           Anc_2.479
          Length = 1461

 Score = 83.6 bits (205), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 85/337 (25%), Positives = 148/337 (43%), Gaps = 69/337 (20%)

Query: 6   IGTYNVGTRLTVGSH-QVEIIKYLTSGGFAQVYSVLISPPDPH----------------- 47
           +G + +G  L  GS  +V + K + +G  A +  V    P  H                 
Sbjct: 98  VGPWKLGKTLGKGSSGRVRLAKNIETGQLAAIKIV----PKKHKLFMKSSHSNVSFFSAA 153

Query: 48  --TNTNVACLKRVIVP--------DKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAI 97
             +N+N++ L     P        ++P+   +  E+  M+L       +S+ +  A   +
Sbjct: 154 SNSNSNISTL--ATSPPMNNGSEKNQPNPYGIEREIVIMKL-------ISHPNVMALYEV 204

Query: 98  LQNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIH 157
            +N S E+++++EY + G L D++ ++   +L E E +    Q+ QGV+  H+    + H
Sbjct: 205 WENKS-ELYLVLEYVDGGELFDYLVSK--GKLSEKEAVHYFKQIIQGVSYCHSFN--ICH 259

Query: 158 RDIKIENVLISTNNE-YKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMI- 215
           RD+K EN+L+   N+  K+ DFG     + LP    + S          +  Y SPE++ 
Sbjct: 260 RDLKPENLLLDKKNKSIKIADFG--MAALELPNKLLQTSC--------GSPHYASPEIVM 309

Query: 216 -DIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAIL----SGKFEFPLYPNYSEQ 270
              + G P    SD+W+ GI L+ L     PF       +L    +GKF  P     S +
Sbjct: 310 GKSYHGGP----SDVWSCGIILFALLTGHLPFNDDNIKKLLLKVQAGKFRMP--STLSPE 363

Query: 271 LKSLIRDILVQNPCHRPSVFQLLKRISIMQNVPCPIN 307
            + LI  ILV +P  R +  ++L    I++  P   N
Sbjct: 364 AQDLISRILVIDPSKRITTDRILNHPLILKYEPAGKN 400

>AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR507C
           (GIN4) and YCL024W (KCC4)
          Length = 1142

 Score = 83.6 bits (205), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 86/320 (26%), Positives = 146/320 (45%), Gaps = 46/320 (14%)

Query: 5   QIGTYNVGTRLTVGS-HQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIVPDK 63
           +IG + +G  L  GS  +V + +   +G  A V  +  S  +   +T V      ++P  
Sbjct: 15  RIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLP-- 72

Query: 64  PSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFMNT 123
                +  E+  M+LL N+  V+   D       +   + ++++++EY E+G L + +  
Sbjct: 73  ---YGIEREIIIMKLL-NHPNVLRLYD-------VWETAQDLYMVLEYVEKGELFNLLVQ 121

Query: 124 RLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGSVCG 183
           R    L E E ++   Q+  G++  HAL   ++HRD+K EN+L+      KL DFG    
Sbjct: 122 R--GPLPENEAVRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKFNIKLADFGMA-- 175

Query: 184 IIRLPRNSQELSYVQQDILKNTTA---QYRSPEMIDIFRGLPIDE-KSDIWALGIFLYKL 239
                      +   +D L  T+     Y +PE++    GLP    +SD+W+ G+ LY L
Sbjct: 176 -----------ALESKDKLLETSCGSPHYAAPEIVS---GLPYHGFESDVWSCGVILYAL 221

Query: 240 CYYTTPF--EKGGEPAIL----SGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLL 293
                PF  E G    +L    SGK+E P     S + + LI  IL   P  R    ++L
Sbjct: 222 LTGRLPFDEEDGNIRNLLLKVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREIL 281

Query: 294 KRISIMQNVPCPINDIQTVQ 313
           K   ++Q  P  I D ++++
Sbjct: 282 KH-PLLQKYPS-IKDSKSIR 299

>NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {ON}
           Anc_8.668
          Length = 896

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 61/207 (29%), Positives = 103/207 (49%), Gaps = 45/207 (21%)

Query: 104 EVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIE 163
           +V++ +EYC    L D + +   +R+   E +Q+ +Q+  GV   H+L    +HRD+K+E
Sbjct: 103 KVWMALEYCPGKELYDRVLS--MHRVPTDECVQLFAQIVGGVHYAHSLN--CVHRDLKLE 158

Query: 164 NVLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNT------TAQYRSPEMID- 216
           N+L+  + + KL DFG                + ++ + K T      T  Y +PE+I+ 
Sbjct: 159 NILLDKSGDAKLTDFG----------------FTRECMTKTTLETICGTTVYMAPELIER 202

Query: 217 -IFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAILSGKFEFPLY---PNYSEQL- 271
             + G  I    DIW+LG+ LY +   + PF++  E      K E+ +    P  +E + 
Sbjct: 203 KSYDGFKI----DIWSLGVILYTMINGSMPFDEDDET-----KTEWKIVHQTPQLNENIV 253

Query: 272 ----KSLIRDILVQNPCHRPSVFQLLK 294
               K LI  +L +NP  RP+V Q+LK
Sbjct: 254 TADAKDLILRLLAKNPNDRPTVEQILK 280

>TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {ON}
           Anc_2.479 YKL101W
          Length = 1745

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 84/312 (26%), Positives = 139/312 (44%), Gaps = 56/312 (17%)

Query: 6   IGTYNVGTRLTVGSH-QVEIIKYLTSGGFAQVYSVLISPPDPHTNT---NVACLKRVIVP 61
           +G + +G  L  GS  +V + K + +G   Q+ ++ I P + H+     +         P
Sbjct: 70  VGPWKLGKTLGKGSSGRVRLAKNMKTG---QLAAIKIVPKNFHSKKKRQDSPAKSLSSSP 126

Query: 62  DKPSLNTLRAEVDAMRLLKNNRY----------VVSYIDSHAAKAILQNGSYEVFVLMEY 111
           DKP   T   E +      NN Y          ++S+ +      + +N S E+++++EY
Sbjct: 127 DKP-YTTHSNETNP----SNNSYGIEREIVIMKLISHPNVMGLYEVWENKS-ELYLVLEY 180

Query: 112 CERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNN 171
            + G L D++ +R   +L E E +    Q+ QGVA  HA    + HRD+K EN+L+   N
Sbjct: 181 VDGGELFDYLVSR--GKLPEREAVHYFKQIIQGVAYCHAFN--ICHRDLKPENLLLDKKN 236

Query: 172 E-YKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTTA---QYRSPEMI--DIFRGLPIDE 225
           +  K+ DFG     +              D L +T+     Y SPE++    + G P   
Sbjct: 237 KIIKIADFGMAALEV-------------SDKLLSTSCGSPHYASPEIVMGKSYHGSP--- 280

Query: 226 KSDIWALGIFLYKLCYYTTPFEKGGEPAIL----SGKFEFPLYPNYSEQLKSLIRDILVQ 281
            +D+W+ GI L+ L     PF       +L    SG +  P   + S   K LI  ILV 
Sbjct: 281 -TDVWSCGIILFALLTGHLPFNHDNIKKLLLKVQSGVYHMP--SDLSPDAKDLISKILVV 337

Query: 282 NPCHRPSVFQLL 293
           +P  R +  ++L
Sbjct: 338 DPDKRLTTTEIL 349

>KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {ON}
           Anc_6.31 YMR001C
          Length = 711

 Score = 82.4 bits (202), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 72/308 (23%), Positives = 135/308 (43%), Gaps = 38/308 (12%)

Query: 27  YLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVV 86
           +L  GGFA+ + +            VA   ++ +  + +   L +E+   + +++   VV
Sbjct: 96  FLGEGGFARCFQIKDESGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMRHFN-VV 151

Query: 87  SYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVA 146
            +ID              V++L+E C  G L++ +  R    + E E+   ++Q+   + 
Sbjct: 152 QFIDCFEDDT-------NVYILLEICPNGSLMELLKKR--RTVTEPEVRYFMTQICGAIK 202

Query: 147 AMHALQPPLIHRDIKIENVLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTT 206
            MH+ +  +IHRD+K+ N+    N   K+ DFG    +     N +E  Y         T
Sbjct: 203 YMHSRR--VIHRDLKLGNIFFDKNYNLKIGDFGLAAVLA----NDRERKYTV-----CGT 251

Query: 207 AQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAIL----SGKFEFP 262
             Y +PE++ + +      + DIW++G+ +Y L     PF+      I     +  F FP
Sbjct: 252 PNYIAPEVL-MGKHSGHSYEVDIWSIGVMIYALLIGKPPFQSKDVNMIYERIKNRDFAFP 310

Query: 263 LYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQNVP-CPINDI--------QTVQ 313
                S + K+LI DIL  +P  RPS+ +++  +      P C ++ +        Q + 
Sbjct: 311 KDKYISNEAKTLIHDILSTDPLERPSIEEIIDYVWFRGIFPSCTLSTVMSEDPNYEQIIS 370

Query: 314 APSSHLNL 321
           A  S++N 
Sbjct: 371 AEESYINF 378

>TDEL0C06780 Chr3 complement(1236767..1238173) [1407 bp, 468 aa]
           {ON} Anc_1.24 YDR523C
          Length = 468

 Score = 81.6 bits (200), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 71/233 (30%), Positives = 113/233 (48%), Gaps = 28/233 (12%)

Query: 66  LNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFMNTRL 125
           +N L  E+  +  LK+  Y+ +YI +             ++++MEYC  G   D +    
Sbjct: 57  INLLAQEIFFLAELKSP-YITNYITTMTEDV-------SMWIIMEYCGGGSCADLLRNIY 108

Query: 126 QNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGSVCGII 185
              L E +   I  +V +G+  +H  +   IHRDIK  N+L++   + KL DFG V G I
Sbjct: 109 NCGLPESKSAYITREVLKGLEYLHEQKK--IHRDIKAANILLTDEGKVKLGDFG-VSGQI 165

Query: 186 R--LPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLCYYT 243
           R  L R     ++V        T  + +PE++        DEK+DIW+LGI +Y+L   +
Sbjct: 166 RATLKRG----TFV-------GTPFWMAPEVVSK-DSDGYDEKADIWSLGITVYELLKGS 213

Query: 244 TPFEKGGEPAILSG--KFEFP-LYPNYSEQLKSLIRDILVQNPCHRPSVFQLL 293
            P  K     ++    K + P L+ +YS   K  +   LV+NP +RPS  +LL
Sbjct: 214 PPLYKCDPMKVMVNLPKRKPPVLHGHYSSAAKHFVASCLVKNPKNRPSAVELL 266

>ZYRO0D05500g Chr4 (473262..477050) [3789 bp, 1262 aa] {ON} weakly
            similar to uniprot|P31374 Saccharomyces cerevisiae
            YAL017W PSK1 One of two (see also PSK2) PAS domain
            containing S/T protein kinases coordinately regulates
            protein synthesis and carbohydrate metabolism and storage
            in response to a unknown metabolite that reflects
            nutritional status
          Length = 1262

 Score = 82.8 bits (203), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 57/176 (32%), Positives = 84/176 (47%), Gaps = 20/176 (11%)

Query: 116  GLIDFMN-TRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYK 174
            G ID  +   L+  + E+E   I  QV   +  +H+    ++HRDIK ENV++ +    K
Sbjct: 1094 GCIDLFDLIELKTNMTEYEAKLIFRQVVSAIRHLHS--QGIVHRDIKDENVVVDSKGFVK 1151

Query: 175  LCDFGSVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEK-SDIWALG 233
            L DFGS   +   P           D+   T   Y +PE   +  G P D K  DIWA+G
Sbjct: 1152 LIDFGSAAYVKSGPF----------DVFVGTI-DYAAPE---VLSGEPFDGKPQDIWAIG 1197

Query: 234  IFLYKLCYYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSV 289
            + LY + +   PF    E  IL    +F      SE+  +LI+ IL +NP  RP++
Sbjct: 1198 VLLYTIVFKENPFYNIDE--ILEVNLKFHGTKGVSEECINLIKMILNKNPSQRPTI 1251

>ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR001C (CDC5)
          Length = 708

 Score = 82.0 bits (201), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 75/302 (24%), Positives = 130/302 (43%), Gaps = 30/302 (9%)

Query: 27  YLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVV 86
           +L  GGFA+ + +            VA   ++ +  + +   L +E+   + +K+   +V
Sbjct: 78  FLGEGGFARCFQMKDDSGKVFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMKHPN-IV 133

Query: 87  SYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVA 146
            + D              V++L+E C  G L+D +  R Q  L E E+    +Q+   + 
Sbjct: 134 QFTDCFEDDT-------NVYILLEICPNGSLMDLLKQRKQ--LTEPEVRFFTTQIVGAIK 184

Query: 147 AMHALQPPLIHRDIKIENVLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTT 206
            MH+ +  +IHRD+K+ N+    +   K+ DFG    +     N +E  Y         T
Sbjct: 185 YMHSRR--IIHRDLKLGNIFFDKHFNLKIGDFGLAAVLA----NDRERKYTI-----CGT 233

Query: 207 AQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAILS----GKFEFP 262
             Y +PE++   +      + DIW++G+ +Y L     PF+      I        F FP
Sbjct: 234 PNYIAPEVL-TGKHTGHSFEVDIWSIGVMIYALLIGKPPFQAKEVNTIYERIKVCDFSFP 292

Query: 263 LYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQNVPCPIN-DIQTVQAPSSHLNL 321
                S + K LI+DIL  +P  RPS+ ++++ +      P  IN DI         L+L
Sbjct: 293 KDKPISSEAKVLIKDILSLDPLERPSLAEIMEYVWFRNVFPARINGDILNFVPEFHDLDL 352

Query: 322 TE 323
            E
Sbjct: 353 QE 354

>KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 697

 Score = 82.0 bits (201), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 76/314 (24%), Positives = 137/314 (43%), Gaps = 32/314 (10%)

Query: 27  YLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVV 86
           +L  GGFA+ + +            VA   ++ +  + +   L +E+   + +++   +V
Sbjct: 84  FLGEGGFARCFQIKDDSGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMRHFN-IV 139

Query: 87  SYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVA 146
            +ID              V++L+E C  G L+D +  R    L E E+    +Q+   V 
Sbjct: 140 QFIDCF-------EDDTNVYILLEICPNGSLMDLLKRR--KVLTEPEVRFFTTQIVGAVK 190

Query: 147 AMHALQPPLIHRDIKIENVLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTT 206
            MH+ +  +IHRD+K+ N+    +   K+ DFG    +     N +E  Y         T
Sbjct: 191 YMHSRR--VIHRDLKLGNIFFDKHYNLKIGDFGLAAVLA----NDRERKYTV-----CGT 239

Query: 207 AQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAIL-----SGKFEF 261
             Y +PE++   +      + DIW+ G+ +Y L     PF+   E  I+      G + F
Sbjct: 240 PNYIAPEVL-TGKHTGHSYEVDIWSCGVMIYALLIGKPPFQ-AKEVNIIYERIKCGDYVF 297

Query: 262 PLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQNVPCPINDIQTVQAPSSHLNL 321
           P     S++  +LIRDIL  +P  RPS+ +++  +      P P  D   + +  S+ NL
Sbjct: 298 PRDKCISQEALTLIRDILSIDPLERPSLDEIIDYVWFRGIFP-PRIDASVLSSAPSYENL 356

Query: 322 TELHQLSATQNIQS 335
                L+  +N  +
Sbjct: 357 DAAQSLANFKNCMA 370

>NDAI0F01600 Chr6 complement(392424..393662) [1239 bp, 412 aa] {ON} 
          Length = 412

 Score = 80.9 bits (198), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 62/204 (30%), Positives = 97/204 (47%), Gaps = 23/204 (11%)

Query: 104 EVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIE 163
            V+++MEY   G L   +  R     ++    + + Q+   +  +H  +  +IHRD+K E
Sbjct: 226 RVYLIMEYLVYGELYKLL--RSHGPFNDIIASRFVYQIADALNHLH--EKGIIHRDLKPE 281

Query: 164 NVLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPI 223
           N+LI  NN  KL DFG    II  P+  +  +          T  Y SPEMI   R    
Sbjct: 282 NILIGFNNVLKLTDFG--WSIIN-PKGVKRKTLC-------GTIDYLSPEMI---RSREY 328

Query: 224 DEKSDIWALGIFLYKLCYYTTPFEKGGE----PAILSGKFEFPLYPNYSEQLKSLIRDIL 279
           D+  D+WALG+  Y+L     PFE+  +      IL G+  FP     S+ ++ LI  +L
Sbjct: 329 DDTVDVWALGVLTYELVAGDPPFEEDSKELTYKRILKGEIRFP--GTVSQDVRDLISRLL 386

Query: 280 VQNPCHRPSVFQLLKRISIMQNVP 303
             +P  R  + +++    IM+N P
Sbjct: 387 KNDPKERILLKEVMVHPWIMRNKP 410

>NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {ON}
           Anc_6.31
          Length = 750

 Score = 82.0 bits (201), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 67/284 (23%), Positives = 126/284 (44%), Gaps = 29/284 (10%)

Query: 27  YLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVV 86
           +L  GGFA+ + +            VA   ++ +  + +   L +E+   + +K++  +V
Sbjct: 100 FLGEGGFARCFQIKDESGKIFAAKTVA---KISIKSEKTKRKLLSEIQIHKSMKHSN-IV 155

Query: 87  SYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVA 146
            +ID     A        V++L+E C  G L+D +  R    L E E+    +Q+   + 
Sbjct: 156 QFIDCFEDDA-------NVYILLEICPNGSLMDLLKKR--KSLTEPEVRFFTTQICGAIK 206

Query: 147 AMHALQPPLIHRDIKIENVLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTT 206
            +H+ +  +IHRD+K+ N+    +   K+ DFG    +  +  N +E  Y         T
Sbjct: 207 YLHSRR--IIHRDLKLGNIFFDKDYNLKVGDFG----LAAVLANDRERKYTVCG-----T 255

Query: 207 AQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAILS----GKFEFP 262
             Y +PE++ + +      + DIW++G+ +Y L     PF+      I       K+ +P
Sbjct: 256 PNYIAPEVL-MGKHSGHSFEVDIWSIGVMIYALLVGKPPFQAKDVNVIYERIKLCKYGYP 314

Query: 263 LYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQNVPCPI 306
                S++ + LI DIL  NP  RP++  ++  +      P  I
Sbjct: 315 KDKYVSKEAEILIHDILSLNPLQRPTIIDIIDDVWFRGVFPARI 358

>KAFR0D03200 Chr4 (628993..633339) [4347 bp, 1448 aa] {ON} Anc_2.479
           YKL101W
          Length = 1448

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 62/204 (30%), Positives = 100/204 (49%), Gaps = 28/204 (13%)

Query: 97  ILQNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLI 156
           + +N S E+F+++EY + G L D++ +R   +L E E +    Q+ +GV+  H+    + 
Sbjct: 187 VWENKS-ELFLVLEYVDGGELFDYLVSR--GKLSEREAVHYFKQIIEGVSYCHSFN--IC 241

Query: 157 HRDIKIENVLISTN-NEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMI 215
           HRD+K EN+L+    N  K+ DFG     + LP         +  +    +  Y SPE++
Sbjct: 242 HRDLKPENLLLDKKINTIKIADFG--MAALELPN--------KLLVTSCGSPHYASPEIV 291

Query: 216 --DIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAIL----SGKFEFPLYPNYSE 269
               + G P    SD+W+ GI L+ L     PF       +L    SGKF+ P   N S 
Sbjct: 292 MGKSYHGSP----SDVWSCGIILFALLTGHLPFNDDSIKKLLLKVQSGKFQMP--QNISL 345

Query: 270 QLKSLIRDILVQNPCHRPSVFQLL 293
           + + LI  ILV +P  R  +  +L
Sbjct: 346 EAEDLISRILVVDPEKRIQINDIL 369

>KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {ON}
           Anc_6.31 YMR001C
          Length = 713

 Score = 82.0 bits (201), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 72/294 (24%), Positives = 126/294 (42%), Gaps = 29/294 (9%)

Query: 27  YLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVV 86
           +L  GGFA+ + +            VA   ++ +  + +   L +E+   + +K+   +V
Sbjct: 100 FLGEGGFARCFQIRDDSGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMKHVN-IV 155

Query: 87  SYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVA 146
            +ID              V++L+E C  G L+D +  R    L E E+    +Q+   + 
Sbjct: 156 QFIDCFEDDT-------NVYILLEICPNGSLMDLLKKR--KSLTEPEVRFFTTQICGAIK 206

Query: 147 AMHALQPPLIHRDIKIENVLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTT 206
            MH+ +  +IHRD+K+ N+        K+ DFG    +     N +E  Y         T
Sbjct: 207 YMHSRK--VIHRDLKLGNIFFDRKYNLKIGDFGLAATLA----NDRERKYTV-----CGT 255

Query: 207 AQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAILSG----KFEFP 262
             Y +PE++ + +      + DIW++G+ +Y L     PF+      I        F FP
Sbjct: 256 PNYIAPEVL-MGKHSGHSYEVDIWSIGVMIYALIIGRPPFQSKDVNTIYERIKCRDFSFP 314

Query: 263 LYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQNVPCPINDIQTVQAPS 316
                S + K LI+DIL  +P  RPSV +++  I      P    +   V+ P+
Sbjct: 315 KDKLISSEAKILIQDILSLDPLERPSVNEIMDYIWFRGCFPPSTKESVMVEVPN 368

>YDR523C Chr4 complement(1485566..1487038) [1473 bp, 490 aa] {ON}
           SPS1Putative protein serine/threonine kinase expressed
           at the end of meiosis and localized to the prospore
           membrane, required for correct localization of enzymes
           involved in spore wall synthesis
          Length = 490

 Score = 81.3 bits (199), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 62/199 (31%), Positives = 96/199 (48%), Gaps = 30/199 (15%)

Query: 105 VFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIEN 164
           ++++MEYC  G   D +     N L E ++  II +VT G+  +H  +   IHRDIK  N
Sbjct: 89  MWIVMEYCGGGSCSDLLKRSYVNGLPEEKVSFIIHEVTLGLKYLHEQRK--IHRDIKAAN 146

Query: 165 VLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPID 224
           +L++     KL DFG V G IR        S +++D     T  + +PE++       +D
Sbjct: 147 ILLNEEGMVKLGDFG-VSGHIR--------STLKRDTFVG-TPYWMAPEVV----CCEVD 192

Query: 225 ---EKSDIWALGIFLYKLCYYTTPFEKGGEPAILSG-------KFEFPLYPNYSEQLKSL 274
              EK+DIW+LGI  Y+L     P  K     +++        K + P    +S+  K  
Sbjct: 193 GYNEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGP----FSDAAKDF 248

Query: 275 IRDILVQNPCHRPSVFQLL 293
           +   LV+ P  RPS + LL
Sbjct: 249 VAGCLVKTPADRPSAYNLL 267

>Skud_4.797 Chr4 complement(1405618..1407075) [1458 bp, 485 aa] {ON}
           YDR523C (REAL)
          Length = 485

 Score = 80.9 bits (198), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 63/195 (32%), Positives = 98/195 (50%), Gaps = 22/195 (11%)

Query: 105 VFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIEN 164
           ++++MEYC  G   D +     N L E ++  II QVT G+  +H  +   IHRDIK  N
Sbjct: 84  MWIVMEYCGGGSCSDLLKRNYVNGLPEEKVSFIIHQVTLGLKYLHEQRK--IHRDIKAAN 141

Query: 165 VLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPID 224
           +L++     KL DFG V G +R        S +++D     T  + +PE++       +D
Sbjct: 142 ILLNEEGMVKLGDFG-VSGHLR--------STMKRDTFVG-TPYWMAPEVV----CCEVD 187

Query: 225 ---EKSDIWALGIFLYKLCYYTTPFEKGGEPAILSG--KFEFP-LYPNYSEQLKSLIRDI 278
              EK+DIW+LGI  Y+L     P  K     +++   K + P L  ++S+  K  +   
Sbjct: 188 GYNEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGSFSDAAKEFVAGC 247

Query: 279 LVQNPCHRPSVFQLL 293
           LV+ P  RPS + LL
Sbjct: 248 LVKVPADRPSAYDLL 262

>KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {ON}
           Anc_3.92 YDR490C
          Length = 1095

 Score = 82.0 bits (201), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 66/270 (24%), Positives = 123/270 (45%), Gaps = 22/270 (8%)

Query: 28  LTSGGFAQVYSVLISPPDPHTNTNVACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVVS 87
           L  G ++ V  +L +  D      V  L +  +  +  +  +  E +A++ + N++ +V 
Sbjct: 185 LGDGAYSTV--MLATSIDSKKQYAVKVLNKEYLIKQKKVKYVNIEKNALQRINNSKMIVK 242

Query: 88  YIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAA 147
              +   ++ L       + L+EYC  G  +  M  +    L+E       +QV   +  
Sbjct: 243 LFFTFQDESSL-------YFLLEYCPNGDFLSLM--KKYGSLNETVACYYSAQVIDAIDY 293

Query: 148 MHALQPPLIHRDIKIENVLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTTA 207
           +H     +IHRDIK EN+L+    + KL DFG+   +     N  +L    +  +   TA
Sbjct: 294 LHT--NGIIHRDIKPENILLDKEFKIKLTDFGTAKILDSSTNNKFDLLTRSKSFV--GTA 349

Query: 208 QYRSPEMI-DIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAILSG--KFEFPLY 264
           +Y +PE++ D F    +D + D+WA G  LY++     PF+   E        K ++   
Sbjct: 350 EYVAPELLNDSF----VDYRCDVWAFGCILYQMIAGKPPFKATNEYLTFQKVMKVQYAFT 405

Query: 265 PNYSEQLKSLIRDILVQNPCHRPSVFQLLK 294
             +   ++ L++ ILV++   RPS+ Q+ K
Sbjct: 406 AGFPLIIRDLVKKILVKDLNQRPSISQIEK 435

>NDAI0H02470 Chr8 complement(597707..601942) [4236 bp, 1411 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1411

 Score = 82.0 bits (201), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 55/180 (30%), Positives = 84/180 (46%), Gaps = 20/180 (11%)

Query: 116  GLIDFMN-TRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYK 174
            G ID  +    +  + EFE   I  QV  G+  +H     ++HRDIK ENV++ +    K
Sbjct: 1243 GCIDLFDLIEFKTNMTEFEAKLIFKQVVSGIKHLH--HQGIVHRDIKDENVIVDSKGLVK 1300

Query: 175  LCDFGSVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEK-SDIWALG 233
            + DFGS   +   P           D+   T   Y +PE   +  G P + K  DIWALG
Sbjct: 1301 IIDFGSAAYVKSGPF----------DVFVGTI-DYAAPE---VLSGEPYEGKPQDIWALG 1346

Query: 234  IFLYKLCYYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLL 293
            I LY + +   PF    E  IL G  +F      +E    LI+ +L++   +RP++ ++ 
Sbjct: 1347 ILLYTIVFKENPFYNIDE--ILEGDLKFDSNTEVTEDCMELIKKVLIRQVRNRPAIDEIF 1404

>KLTH0F01672g Chr6 (127277..130771) [3495 bp, 1164 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1164

 Score = 82.0 bits (201), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 87/322 (27%), Positives = 148/322 (45%), Gaps = 48/322 (14%)

Query: 5   QIGTYNVGTRLTVGS-HQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIVPDK 63
           +IG + +G+ L  GS  +V + ++ ++G  A V  V  S     +N++      ++  + 
Sbjct: 22  KIGPWKLGSTLGAGSTGKVVMAQHESTGQQAAVKIVSKSIFGNQSNSST-----IVGSND 76

Query: 64  PSL--NTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFM 121
           P +    +  E+  M+LL N+  V+   D     + L       ++++EY E+G L + +
Sbjct: 77  PDVLPYGIEREIIIMKLL-NHPNVLRLYDVWETNSSL-------YMVLEYVEKGELFNLL 128

Query: 122 NTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGSV 181
             R    L E E ++   Q+  G++  HAL   ++HRD+K EN+L+      K+ DFG  
Sbjct: 129 VDR--GPLPENEAVRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKFNIKIADFGMA 184

Query: 182 CGIIRLPRNSQELSYVQQDILKNTTA---QYRSPEMIDIFRGLPIDE-KSDIWALGIFLY 237
                            +D L  T+     Y +PE++    GLP    +SD+W+ GI L+
Sbjct: 185 A-------------LESKDKLLETSCGSPHYAAPEIVS---GLPYHGFESDVWSCGIILF 228

Query: 238 KLCYYTTPF--EKGGEPAIL----SGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQ 291
            L     PF  E G    +L    SGKFE P     S + + LI  IL  +P  R     
Sbjct: 229 ALLTGRLPFDEEDGNIRNLLLKVQSGKFEMPDTNEISGEAQDLIAKILTVDPAARIKSRG 288

Query: 292 LLKRISIMQNVPCPINDIQTVQ 313
           +LK   ++Q  P  I D ++++
Sbjct: 289 ILKH-PLLQKYPS-IKDSKSIR 308

>YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein
           kinase of unknown cellular role; binds
           phosphatidylinositols and cardiolipin in a large-scale
           study
          Length = 901

 Score = 81.6 bits (200), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 77/292 (26%), Positives = 131/292 (44%), Gaps = 60/292 (20%)

Query: 17  VGSHQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIVPDKPSLNTLRAEVDAM 76
           VG+++  I+K +  G F +VY  L  P    T+  V CLK     DK   N +R      
Sbjct: 38  VGNYK--ILKQIGEGSFGKVYLALHRP----THRKV-CLK---TSDKNDPNIVR------ 81

Query: 77  RLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQ 136
            +  + ++   YI       + ++   +V++ +EYC    L D  +     R+   E  +
Sbjct: 82  EVFYHRQFDFPYITKLYEVIVTES---KVWMALEYCPGKELYD--HLLSLRRISLLECGE 136

Query: 137 IISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGSVCGIIRLPRNSQELSY 196
           + +Q++  V   H++    +HRD+K+EN+L+  N   KL DFG                +
Sbjct: 137 LFAQISGAVYYAHSMH--CVHRDLKLENILLDKNGNAKLTDFG----------------F 178

Query: 197 VQQDILKNT------TAQYRSPEMID--IFRGLPIDEKSDIWALGIFLYKLCYYTTPFEK 248
            ++ + K T      T  Y +PE+I+   + G  I    DIW+LG+ LY L     PF+ 
Sbjct: 179 TRECMTKTTLETVCGTTVYMAPELIERRTYDGFKI----DIWSLGVILYTLITGYLPFDD 234

Query: 249 GGEPAILSG------KFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLK 294
             E            K++  + P   +  + LI  +L +NP  RPS+ Q+L+
Sbjct: 235 DDEAKTKWKIVNEEPKYDAKVIP---DDARDLISRLLAKNPGERPSLSQVLR 283

>YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON}
           GIN4Protein kinase involved in bud growth and assembly
           of the septin ring, proposed to have kinase-dependent
           and kinase-independent activities; undergoes
           autophosphorylation; similar to Kcc4p and Hsl1p
          Length = 1142

 Score = 82.0 bits (201), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 89/333 (26%), Positives = 153/333 (45%), Gaps = 44/333 (13%)

Query: 6   IGTYNVGTRLTVGS-HQVEIIKYLTSGGFAQVYSVLISPPDPHT-NTNVACLKRVIVPDK 63
           IG + +G  L +GS  +V++ +  ++G  A V   +IS    +T N +   +     PD 
Sbjct: 16  IGPWKLGETLGLGSTGKVQLARNGSTGQEAAVK--VISKAVFNTGNVSGTSIVGSTTPDA 73

Query: 64  PSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFMNT 123
                 R E+  M+LL N+  V+   D       +   + ++++++EY E+G L + +  
Sbjct: 74  LPYGIER-EIIIMKLL-NHPNVLRLYD-------VWETNTDLYLVLEYAEKGELFNLLVE 124

Query: 124 RLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGSVCG 183
           R    L E E ++   Q+  GV+  HAL   ++HRD+K EN+L+      K+ DFG    
Sbjct: 125 R--GPLPEHEAIRFFRQIIIGVSYCHALG--IVHRDLKPENLLLDHKYNIKIADFGMAA- 179

Query: 184 IIRLPRNSQELSYVQQDILKNT--TAQYRSPEMIDIFRGLPIDE-KSDIWALGIFLYKLC 240
                         +  +L+ +  +  Y +PE++    G+P     SD+W+ G+ L+ L 
Sbjct: 180 -----------LETEGKLLETSCGSPHYAAPEIVS---GIPYQGFASDVWSCGVILFALL 225

Query: 241 YYTTPF--EKGGEPAIL----SGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLK 294
               PF  E G    +L     G+FE P     S + + LIR IL  +P  R     +LK
Sbjct: 226 TGRLPFDEEDGNIRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILK 285

Query: 295 RISIMQNVPCPINDIQTVQA-PSSHLNLTELHQ 326
              ++Q  P  I D ++++  P     LT L +
Sbjct: 286 H-PLLQKYPS-IRDSKSIRGLPREDTYLTPLSE 316

>KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa]
           {ON} weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 1016

 Score = 82.0 bits (201), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 76/287 (26%), Positives = 115/287 (40%), Gaps = 57/287 (19%)

Query: 31  GGFAQVYSVLISPPDPHTNTNVACLKRVIVPD--KPSLNTLRAEVDAMRLLKNNRYVVSY 88
           G F  VY         H  T      +V+  D  +  +  +R E+  +  LK    +  Y
Sbjct: 25  GKFGVVYKAF------HVKTQQVYAIKVLNLDNTEDEVEDIRKEIQFLSSLKQTPNITHY 78

Query: 89  IDSHAAKAILQNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAM 148
             S+     L       +V+MEYC  G L   +   +   + E  I  I+ ++   + ++
Sbjct: 79  YGSYLIDTKL-------WVIMEYCAGGSLRTLLRPGI---IEEKYIGVIMREILVALISI 128

Query: 149 HALQPPLIHRDIKIENVLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTTAQ 208
           H     +IHRDIK  N+LI+ N   KLCDFG    +              Q +LK  T  
Sbjct: 129 HRDN--VIHRDIKAANILIANNGSVKLCDFGVAAQL-------------SQSMLKRQTMA 173

Query: 209 ----YRSPEMIDIFRGLPIDEKSDIWALGIFLYKLCYYTTPF-----------EKGGEPA 253
               + +PE+  I  G+  D K DIW+LGI  Y++     P+               +P 
Sbjct: 174 GTPYWMAPEV--IMEGVYYDTKVDIWSLGITAYEIATGNPPYCHMEAIRAMQMITKSKPP 231

Query: 254 ILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQ 300
            L G+        YS+ LK  I   L ++P  RP   +L K   I Q
Sbjct: 232 RLEGR-------EYSQPLKEFIALCLDEDPKERPYAEELFKSKLIKQ 271

>KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1117

 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 85/320 (26%), Positives = 143/320 (44%), Gaps = 46/320 (14%)

Query: 5   QIGTYNVGTRLTVGS-HQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIVPDK 63
           Q+G + +G  L +GS  +V++    T+G  A +  +  S      N N A    +  PD 
Sbjct: 14  QLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSV----FNNNSAQSSSLTTPDA 69

Query: 64  PSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFMNT 123
                 R E+  M+LL N+  V+   D     + L       ++++EY E+G L + +  
Sbjct: 70  LPYGIER-EIIIMKLL-NHPNVLRLYDVWETNSNL-------YMVLEYAEKGELFNLLVE 120

Query: 124 RLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGSVCG 183
           +    L E E ++   Q+  G++  HAL   ++HRD+K EN+L+      K+ DFG    
Sbjct: 121 K--GPLQEQEAIRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKYNIKIADFGMAA- 175

Query: 184 IIRLPRNSQELSYVQQDILKNTTA---QYRSPEMIDIFRGLPIDE-KSDIWALGIFLYKL 239
                          +D L  T+     Y +PE++    G+P     SD+W+ G+ L+ L
Sbjct: 176 ------------LETEDKLLETSCGSPHYAAPEIVS---GIPYHGFASDVWSCGVILFAL 220

Query: 240 CYYTTPF--EKGGEPAIL----SGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLL 293
                PF  E G    +L    SG+FE P     S + + L+  IL  +P  R     +L
Sbjct: 221 LTGRLPFDEEDGNIRNLLLKVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDIL 280

Query: 294 KRISIMQNVPCPINDIQTVQ 313
           K   ++Q  P  I D ++++
Sbjct: 281 KH-PLLQKYPS-IKDSKSIR 298

>Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 81.3 bits (199), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 71/284 (25%), Positives = 124/284 (43%), Gaps = 29/284 (10%)

Query: 27  YLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVV 86
           +L  GGFA+ + +     +      VA   +  +  + +   L +E+   + + +   +V
Sbjct: 87  FLGEGGFARCFQIKDDSGEIFAAKTVA---KASIKSEKTRKKLLSEIQIHKSMSHPN-IV 142

Query: 87  SYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVA 146
            +ID     +        V++L+E C  G L++ +  R    L E E+    +Q+   + 
Sbjct: 143 QFIDCFEDDS-------NVYILLEICPNGSLMELLKRR--KVLTEPEVRFFTTQICGAIK 193

Query: 147 AMHALQPPLIHRDIKIENVLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTT 206
            MH+ +  +IHRD+K+ N+   +N   K+ DFG    +     N  E  Y         T
Sbjct: 194 YMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFGLAAVLA----NESERKYTI-----CGT 242

Query: 207 AQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAILSG----KFEFP 262
             Y +PE++ + +      + DIW+LG+ LY L     PF+      I        F FP
Sbjct: 243 PNYIAPEVL-MGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVNTIYERIKCRDFSFP 301

Query: 263 LYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQNVPCPI 306
                S++ K LIRDIL  +P  RPS+ +++  +      P  I
Sbjct: 302 KDKPISDEGKILIRDILSLDPIERPSLTEIMDYVWFRGTFPPSI 345

>CAGL0E05720g Chr5 (569265..570341) [1077 bp, 358 aa] {ON} similar
           to uniprot|P38991 Saccharomyces cerevisiae YPL209c IPL1
           ser/thr protein kinase
          Length = 358

 Score = 79.3 bits (194), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 81/289 (28%), Positives = 122/289 (42%), Gaps = 41/289 (14%)

Query: 23  EIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIVPDK----PSLNTLRAEVDAMRL 78
           E+ + L  G F +VY V       H  +   C  + I  ++      L  L+ EVD    
Sbjct: 101 EVGRKLGKGKFGKVYCV------RHKKSGFICALKAIEKNEILQFNLLKQLKREVDIQLG 154

Query: 79  LKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQII 138
           + +   +  Y   H  K         V++LME+   G L  + + +     ++      I
Sbjct: 155 MDHPNIIKLYAHFHDEK--------RVYLLMEHSINGEL--YKSLKNNGPFNDVLASHYI 204

Query: 139 SQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQ 198
            Q+   +  MH  +  +IHRD+K ENVLI  +N  KL DFG     I  P  S+  +   
Sbjct: 205 YQIADALHYMHKKR--IIHRDVKPENVLIGFDNVVKLADFGWS---ILNPEGSKRKTLC- 258

Query: 199 QDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGE----PAI 254
                  T  Y SPEMI        DE+ D+WALG+  Y+L     PFE+  +      I
Sbjct: 259 ------GTIDYLSPEMIT---PREYDEQVDVWALGVLAYELVVGVPPFEENSKELTYKRI 309

Query: 255 LSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQNVP 303
           L     FP   + S+  K LI  +LV +   R S+  +     I++N P
Sbjct: 310 LKCDLNFP--ESISKDAKDLISKLLVTDTTQRLSLTGVKTHPWILKNKP 356

>KLLA0B02332g Chr2 complement(206863..207948) [1086 bp, 361 aa] {ON}
           similar to uniprot|P38991 Saccharomyces cerevisiae
           YPL209C IPL1 Aurora kinase involved in regulating
           kinetochore-microtubule attachments associates with
           Sli5p which stimulates Ipl1p kinase activity and
           promotes its association with the mitotic spindle
           potential Cdc28p substrate
          Length = 361

 Score = 79.3 bits (194), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 81/277 (29%), Positives = 114/277 (41%), Gaps = 51/277 (18%)

Query: 23  EIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIVPDKPSLNTLRAEVDAMRLLKNN 82
           EI K L  G F +VY V       H  T + C  + +          + E+    + K  
Sbjct: 101 EIGKILGKGKFGKVYCV------KHRETGLICALKAME---------KKEIVQYTIQKQF 145

Query: 83  RYVVSYIDSHAAKAILQNGSY-----EVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQI 137
           R  V    S   K + Q   +      V++LMEY   G L  F+       L+E      
Sbjct: 146 RREVEIQGSFKHKNLTQLYGFFYDEKRVYLLMEYVYYGELYKFLKN--NGPLNETLASYF 203

Query: 138 ISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGSVCGIIRLPRNSQELSYV 197
           + Q+   +  MH+    ++HRDIK EN+LI  NN  KL DFG               S  
Sbjct: 204 VYQMANALDYMHS--KNILHRDIKPENILIGFNNTIKLTDFG--------------WSVY 247

Query: 198 QQDILKNT----TAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPA 253
            +D  K      T  Y SPE+I   +    + K D+WALG+  Y+L   + PFE+  +  
Sbjct: 248 NEDGQKRKTLCGTIDYLSPELI---KSREYNNKVDVWALGVLTYELLVGSPPFEEDTKEM 304

Query: 254 ----ILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHR 286
               IL    +FPL  N S Q + LI  +L   P  R
Sbjct: 305 TYRRILRCDLKFPL--NVSPQARDLIVRLLQFEPSKR 339

>Ecym_1030 Chr1 (56043..57365) [1323 bp, 440 aa] {ON} similar to
           Ashbya gossypii AFR724C
          Length = 440

 Score = 80.1 bits (196), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 76/277 (27%), Positives = 134/277 (48%), Gaps = 28/277 (10%)

Query: 21  QVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIVPDKPSLNTLRAEVDAMRLLK 80
           Q EI++ +  G F  VY       +      V  L+     D+P ++ L  E+  +  L+
Sbjct: 19  QYEILQCIGRGNFGDVYKARYLATNEIVAIKVVNLEDT---DEP-IDLLAQEIFFLSELR 74

Query: 81  NNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQ 140
           +  Y+ +Y       A L + S  ++++MEYC  G   + +    +++L E +   I+S+
Sbjct: 75  SP-YITNY-----KTAFLVDVS--MWIVMEYCGGGSCAELLKYTPEHKLTEDQCAFIVSE 126

Query: 141 VTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQD 200
           V  G+  +H+ +   IHRDIK  N+L++ N   KL DFG V G + + R        ++D
Sbjct: 127 VLVGLDYLHSQRK--IHRDIKSANILLTDNGHVKLGDFG-VSGQMMVTR--------KRD 175

Query: 201 ILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEK-GGEPAILSGKF 259
               T   + +PE+ID  +    +E +DIW+LGI + +L     P +K     A+++   
Sbjct: 176 TFVGTPF-WMAPEVIDRNKK-GYNEMADIWSLGITVIELLMGHPPLDKYDAMKALMAIPK 233

Query: 260 EFP--LYPNYSEQLKSLIRDILVQNPCHRPSVFQLLK 294
             P  L   +S   K  +   L+++P  RP+  +LLK
Sbjct: 234 RDPPKLDKRFSSHAKDFVAQCLIKDPSQRPTASELLK 270

>TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.668
           YPL150W
          Length = 871

 Score = 81.3 bits (199), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 57/213 (26%), Positives = 102/213 (47%), Gaps = 57/213 (26%)

Query: 104 EVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIE 163
           +V++ +EYC    L D++   +  R+   E  ++ +Q+   V   H+L    +HRD+K+E
Sbjct: 102 KVWMSLEYCPGKELYDYL--LVMRRIPLDECSRLFAQIVGAVYYAHSLN--CVHRDLKLE 157

Query: 164 NVLISTNNEYKLCDFG------------SVCGIIRLPRNSQELSYVQQDILKNTTAQYRS 211
           N+L+      KL DFG            ++CG                      T  Y +
Sbjct: 158 NILLDMQGNAKLADFGFTRECATKNQLETICG----------------------TTVYMA 195

Query: 212 PEMI--DIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAILSGKFEFPLY---PN 266
           PE++  D + G  I    DIW+LG+ LY L   + PF++  E      + E+ +    P+
Sbjct: 196 PELLRRDTYDGFKI----DIWSLGVILYTLINGSMPFDEEDET-----RTEWKIINEEPD 246

Query: 267 YSEQLKS-----LIRDILVQNPCHRPSVFQLLK 294
           Y+E++ +     LI+ +L+++P  RPS+ ++LK
Sbjct: 247 YNEKIFNANSIELIKSLLIKDPKKRPSMTEILK 279

>TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.31
           YMR001C
          Length = 722

 Score = 80.9 bits (198), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 70/300 (23%), Positives = 129/300 (43%), Gaps = 29/300 (9%)

Query: 27  YLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVV 86
           +L  GGFA+ + +            VA L    +  + +   L +E+   + +++   +V
Sbjct: 106 FLGEGGFARCFQIKDDSGKIFAAKTVAKLS---IKTEKTRKKLLSEIQIHKSMRHAN-IV 161

Query: 87  SYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVA 146
            +ID    +         V++L+E C  G L++ +  R    L E E+    +Q+  G+ 
Sbjct: 162 QFIDCFEDET-------NVYILLEICPNGSLMELLKKR--KTLTEPEVRFFTTQICGGIK 212

Query: 147 AMHALQPPLIHRDIKIENVLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTT 206
            MH+ +  +IHRD+K+ N+    N   K+ DF    G+  +  N +E  Y         T
Sbjct: 213 YMHSRR--VIHRDLKLGNIFFDKNYNLKIGDF----GLAAVLANDRERKYTV-----CGT 261

Query: 207 AQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAILS----GKFEFP 262
             Y +PE++ + +      + DIW++G+ +Y L     PF+      I        F FP
Sbjct: 262 PNYIAPEVL-MGKHSGHSYEVDIWSIGVMIYALLIGKPPFQAKDVNTIYERIKCCDFVFP 320

Query: 263 LYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQNVPCPINDIQTVQAPSSHLNLT 322
                S + + L++D+L  +P  RPS+ ++L  +      P  I      + P     +T
Sbjct: 321 KEKYISSEARILVQDLLSLDPLERPSIMEVLDYVWFRGIFPPYIQSDVMTEVPDYEKKIT 380

>Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W
           (REAL)
          Length = 1017

 Score = 81.3 bits (199), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 58/200 (29%), Positives = 99/200 (49%), Gaps = 32/200 (16%)

Query: 105 VFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIEN 164
           +++++EY E+G L + +  R    L E E ++   Q+   V+  HAL   ++HRD+K EN
Sbjct: 102 LYLILEYAEKGELFNLLVDR--GALPEREAMKCFRQIIIAVSYCHALG--IVHRDLKPEN 157

Query: 165 VLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQD--ILKNTTA--QYRSPEMIDIFRG 220
           +L+ ++   K+ DFG              ++ +Q D  +L+ +     Y +PE++    G
Sbjct: 158 LLLDSDYNIKVADFG--------------MAALQTDAALLETSCGSPHYAAPEIVS---G 200

Query: 221 LPIDE-KSDIWALGIFLYKLCYYTTPF--EKGGEPAIL----SGKFEFPLYPNYSEQLKS 273
           LP +   SD+W+ G+ L+ L     PF  E G    +L     G+FE P     S+  + 
Sbjct: 201 LPYEGFSSDVWSCGVILFALLTGRLPFDEENGNIRTLLLKVQRGQFEMPDDTEISKDAQD 260

Query: 274 LIRDILVQNPCHRPSVFQLL 293
           LI  ILV +P  R  +  +L
Sbjct: 261 LISKILVVDPAQRIKIRDIL 280

>Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON}
           similar to Ashbya gossypii ACL006W
          Length = 740

 Score = 80.9 bits (198), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 73/302 (24%), Positives = 131/302 (43%), Gaps = 30/302 (9%)

Query: 27  YLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVV 86
           +L  GGFA+ + +            VA   ++ +  + +   L +E+   + +++   +V
Sbjct: 78  FLGEGGFARCFQMKDDSGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMRHPN-IV 133

Query: 87  SYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVA 146
            + D              V++L+E C  G L+D +  R Q  L E E+    +Q+   + 
Sbjct: 134 QFTDCFEDDT-------NVYILLEICPNGSLMDLLKQRKQ--LTEPEVRFFTTQIVGAIK 184

Query: 147 AMHALQPPLIHRDIKIENVLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTT 206
            MH+ +  +IHRD+K+ N+    +   K+ DFG    +  +  N +E  Y         T
Sbjct: 185 YMHSRR--IIHRDLKLGNIFFDKHFNLKIGDFG----LAAVLANDRERKYTI-----CGT 233

Query: 207 AQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAILS----GKFEFP 262
             Y +PE++   +      + D+W++G+ +Y L     PF+      I        F FP
Sbjct: 234 PNYIAPEVL-TGKHTGHSFEVDVWSIGVMIYALLIGKPPFQAKEVNTIYERIKVCDFNFP 292

Query: 263 LYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQNVPCPINDIQTVQAPSSH-LNL 321
                S + K LI+DIL  +P  RPS+ ++++ +      P  IN       P  H L+L
Sbjct: 293 RDKPISSEAKVLIKDILSLDPLERPSLTEIMEYVWFRNVFPMRINGDVLNFVPEYHDLDL 352

Query: 322 TE 323
            E
Sbjct: 353 QE 354

>Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 80.9 bits (198), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 70/284 (24%), Positives = 124/284 (43%), Gaps = 29/284 (10%)

Query: 27  YLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVV 86
           +L  GGFA+ + +     +      VA   +  +  + +   L +E+   + + +   +V
Sbjct: 87  FLGEGGFARCFQIKDDSGEIFAAKTVA---KASIKSEKTRKKLLSEIQIHKSMAHPN-IV 142

Query: 87  SYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVA 146
            ++D     +        V++L+E C  G L++ +  R    L E E+    +Q+   + 
Sbjct: 143 QFVDCFEDDS-------NVYILLEICPNGSLMELLKRR--KVLTEPEVRFFTTQICGAIK 193

Query: 147 AMHALQPPLIHRDIKIENVLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTT 206
            MH+ +  +IHRD+K+ N+   +N   K+ DFG    +     N  E  Y         T
Sbjct: 194 YMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFGLAAVLA----NESERKYTI-----CGT 242

Query: 207 AQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAILSG----KFEFP 262
             Y +PE++ + +      + DIW+LG+ LY L     PF+      I        F FP
Sbjct: 243 PNYIAPEVL-MGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVNTIYERIKCRDFSFP 301

Query: 263 LYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQNVPCPI 306
                S++ K LIRDIL  +P  RPS+ +++  +      P  I
Sbjct: 302 KDKPISDEGKILIRDILSLDPIERPSLTEIMDYVWFRGTFPPSI 345

>ZYRO0E07018g Chr5 (531316..532419) [1104 bp, 367 aa] {ON} similar
           to uniprot|P38991 Saccharomyces cerevisiae YPL209C IPL1
           Aurora kinase involved in regulating
           kinetochore-microtubule attachments associates with
           Sli5p which stimulates Ipl1p kinase activity and
           promotes its association with the mitotic spindle
           potential Cdc28p substrate
          Length = 367

 Score = 79.0 bits (193), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 63/204 (30%), Positives = 97/204 (47%), Gaps = 23/204 (11%)

Query: 104 EVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIE 163
            V++LMEY   G L   +  R +  L +      + Q+   +  MH  Q  +IHRD+K E
Sbjct: 181 RVYLLMEYLVNGELYKLL--RAKGPLDDIFASHYVYQMADALDYMH--QRNIIHRDVKPE 236

Query: 164 NVLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPI 223
           N+LI  +N  KL DFG    II  PR ++  +          T  Y SPE+I        
Sbjct: 237 NILIGFDNTVKLTDFG--WSIIN-PRGTKRKTMC-------GTLDYLSPELI---ASKEY 283

Query: 224 DEKSDIWALGIFLYKLCYYTTPFEKGGE----PAILSGKFEFPLYPNYSEQLKSLIRDIL 279
           D+K D+WALG+  ++L   + PFE+  +      I+ G  +FP   + S   + LI  +L
Sbjct: 284 DDKVDVWALGVLTFELVVNSPPFEEDSKELTSKRIVRGDLKFP--NHISSDAQDLITKLL 341

Query: 280 VQNPCHRPSVFQLLKRISIMQNVP 303
             N   R S+ ++ +   I +N P
Sbjct: 342 RHNSKDRISLREVKQHPWITKNRP 365

>NDAI0D02750 Chr4 (639802..644349) [4548 bp, 1515 aa] {ON} Anc_2.479
           YKL101W
          Length = 1515

 Score = 81.3 bits (199), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 62/211 (29%), Positives = 104/211 (49%), Gaps = 28/211 (13%)

Query: 97  ILQNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLI 156
           + +N S E+++++EY + G L D++ +R   +L E E +    Q+ QGV+  H+    + 
Sbjct: 220 VWENKS-ELYLILEYVDGGELFDYLVSR--GKLPEAEAIHYFKQIIQGVSYCHSFN--IC 274

Query: 157 HRDIKIENVLISTNNEYKL-CDFGSVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMI 215
           HRD+K EN+LI    +     DFG     + LP+   + S          +  Y SPE++
Sbjct: 275 HRDLKPENLLIDKKKKSIKIADFG--MAALELPKKLLQTSC--------GSPHYASPEIV 324

Query: 216 --DIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAIL----SGKFEFPLYPNYSE 269
               + G P    SD+W+ GI L+ L     PF       +L    +GK++ P   N S+
Sbjct: 325 MGKSYHGGP----SDVWSCGIILFALLTGHLPFNDDNIKKLLLKVQAGKYQMP--KNLSD 378

Query: 270 QLKSLIRDILVQNPCHRPSVFQLLKRISIMQ 300
           + K LI  ILV +P  R +  ++L    I++
Sbjct: 379 EAKDLISRILVVSPSKRLTTVEILNHPLILK 409

>TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]
           {ON} Anc_3.92 YDR490C
          Length = 1347

 Score = 81.3 bits (199), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 55/196 (28%), Positives = 100/196 (51%), Gaps = 17/196 (8%)

Query: 105 VFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIEN 164
           ++ L+EY   G L+  +  +      E   +   +Q+   +  +H++   +IHRDIK EN
Sbjct: 334 LYFLLEYASNGDLLTLL--KKYGSFDETSTIYFTAQIIDSIHYIHSMG--IIHRDIKPEN 389

Query: 165 VLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNT-----TAQYRSPEMI-DIF 218
           +L++ + + KL DFG+   I+   + SQ  S    ++L+ +     TA+Y SPE++ D +
Sbjct: 390 ILLTKDFKIKLTDFGT-AKILDPSQPSQSQSQPHFNLLERSKSFVGTAEYVSPELLTDSY 448

Query: 219 RGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAILSG--KFEFPLYPNYSEQLKSLIR 276
                D + DIWA G  L++L     PF+   E        K ++     +   L+ LI+
Sbjct: 449 ----TDSRCDIWAFGCILFQLIAGKPPFKATNEYLTFQKIIKLQYAFTAGFPTILRDLIK 504

Query: 277 DILVQNPCHRPSVFQL 292
            IL++NP +R ++ Q+
Sbjct: 505 KILIKNPNNRLTIHQI 520

>CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa]
           {ON} highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001c CDC5 involved in regulation of DNA
           replication
          Length = 746

 Score = 80.5 bits (197), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 70/299 (23%), Positives = 131/299 (43%), Gaps = 30/299 (10%)

Query: 26  KYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYV 85
           ++L  GGFA+ + +            VA   ++ +  + +   L +E+   + + +   +
Sbjct: 85  QFLGEGGFARCFQIKDDSGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMSHTN-I 140

Query: 86  VSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGV 145
           V +ID           +  V++L+E C  G L++ +  R    + E E+   ++Q+  G+
Sbjct: 141 VQFIDCF-------EDNVNVYILLEICPNGSLMELIKKR--KTITEPEVRFFMTQICGGI 191

Query: 146 AAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNT 205
             MH+ +  +IHRD+K+ N+    +   K+ DFG    +     N +E  +         
Sbjct: 192 QYMHSNR--VIHRDLKLGNIFFDEHYNLKIGDFGLAAVLA----NDRERKFTI-----CG 240

Query: 206 TAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAILSG----KFEF 261
           T  Y +PE++ + +      + DIW++G+ LY L     PF+      I        F +
Sbjct: 241 TPNYIAPEVL-MGKHSGHSYEVDIWSIGVMLYALLIGKPPFQAKDVNTIYERIKQRNFAY 299

Query: 262 PLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQNV-PCPINDIQTVQAPSSHL 319
           P     S+  K LI DIL  NP  RPS+ +++  +       P  +N + T     SH+
Sbjct: 300 PKDKKISQDAKYLIDDILSLNPMERPSIQEIMDYVWFRGTFPPYTLNSVMTTVPDYSHI 358

>Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON}
           YPL150W (REAL)
          Length = 917

 Score = 80.9 bits (198), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 81/292 (27%), Positives = 133/292 (45%), Gaps = 60/292 (20%)

Query: 17  VGSHQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIVPDKPSLNTLRAEVDAM 76
           VG+++  I+K +  G F +VY  L  P    T+  V CLK     DK   N +R      
Sbjct: 38  VGNYK--ILKQIGEGSFGKVYLALHRP----THRKV-CLK---TSDKNDPNIVR------ 81

Query: 77  RLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQ 136
            +  + ++   YI       + ++   +V++ +EYC    L D  +     RL   E  +
Sbjct: 82  EVFYHRQFDFPYITKLYEVIVTES---KVWMALEYCPGKELYD--HLLSLRRLSLLECGE 136

Query: 137 IISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGSVCGIIRLPRNSQELSY 196
           + +Q++  V   H++    +HRD+K+EN+L+  N   KL DFG                +
Sbjct: 137 LFAQISGAVYYAHSMH--CVHRDLKLENILLDRNGNAKLTDFG----------------F 178

Query: 197 VQQDILKNT------TAQYRSPEMID--IFRGLPIDEKSDIWALGIFLYKLCYYTTPFEK 248
            ++ + K T      T  Y +PE+I+   + G  I    DIW+LG+ LY L     PF+ 
Sbjct: 179 TRECMTKTTLETVCGTTVYMAPELIERKTYDGFKI----DIWSLGVILYTLITGYLPFDD 234

Query: 249 GGEPAILSGKF----EFPLYPN--YSEQLKSLIRDILVQNPCHRPSVFQLLK 294
             E   +  K+    E P Y +    +  K LI  +L +NP  RPS+ Q+L+
Sbjct: 235 DDE---VKTKWKIVNEEPKYDSKFIPDDAKDLISRLLAKNPGERPSLPQVLR 283

>KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa]
           {ON} weakly similar to uniprot|P34244 Saccharomyces
           cerevisiae YKL101W HSL1 Nim1p-related protein kinase
           that regulates the morphogenesis and septin checkpoints
           associates with the assembled septin filament required
           along with Hsl7p for bud neck recruitment
           phosphorylation and degradation of Swe1p
          Length = 1267

 Score = 80.9 bits (198), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 62/208 (29%), Positives = 98/208 (47%), Gaps = 34/208 (16%)

Query: 97  ILQNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLI 156
           + +N S E+++++EY E G L D++ ++   +L E E +    Q+ Q VA  H     + 
Sbjct: 142 VWENKS-ELYLVLEYVEGGELFDYLVSK--GKLPESEAIHYFKQIVQAVAYCHGFN--IC 196

Query: 157 HRDIKIENVLISTNNE-YKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTTA---QYRSP 212
           HRD+K EN+L+       K+ DFG                    D L  T+     Y SP
Sbjct: 197 HRDLKPENLLLDKKKRSIKIADFGMAA-------------LETSDKLLETSCGSPHYASP 243

Query: 213 EMI--DIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAIL----SGKFEFPLYPN 266
           E++    + G P    SD+W+ GI L+ L     PF       +L    SGK++ P +  
Sbjct: 244 EIVLGRKYHGSP----SDVWSCGIILFALLTGHLPFNDDNVKKLLLKVQSGKYQMPQW-- 297

Query: 267 YSEQLKSLIRDILVQNPCHRPSVFQLLK 294
            S + K LI  ILV +P  R ++ Q+L+
Sbjct: 298 LSVEAKDLISRILVVDPNRRITIDQILQ 325

>AFL101C Chr6 complement(249144..250247) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL209C
           (IPL1)
          Length = 367

 Score = 78.6 bits (192), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 85/291 (29%), Positives = 125/291 (42%), Gaps = 45/291 (15%)

Query: 23  EIIKYLTSGGFAQVYSVLISPPDPHTNTNVAC-LKRVIVPDKPSLNT---LRAEVDAMRL 78
           EI K L  G F +VY V       H  +   C LK +   D    N     R EV+    
Sbjct: 110 EIGKVLGKGKFGRVYCVR------HIESGFVCALKAMEKKDIIQYNIEKQFRREVEIQSS 163

Query: 79  LKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQ-- 136
           L++      Y   H  K         V++LMEY   G L       L+ R H  +++   
Sbjct: 164 LRHPNLTQLYGYFHDEK--------RVYLLMEYLVNGELY----KHLKGRSHFNDVVASY 211

Query: 137 IISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGSVCGIIRLPRNSQELSY 196
            + Q+   +  MH     ++HRDIK EN++I  NN  KL DFG    +I  P+ S+  + 
Sbjct: 212 YVYQMADALDYMHERN--ILHRDIKPENIIIGFNNTIKLTDFG--WSVI-TPKGSKRKTL 266

Query: 197 VQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGE----P 252
                    T  Y SPE+I   R    +EK D+WALG+  Y+L   + PFE+  +     
Sbjct: 267 C-------GTVDYLSPELI---RSREYNEKVDVWALGVLTYELLVGSPPFEEESKELTYK 316

Query: 253 AILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQNVP 303
            IL     FP   +   + + LI  +L  +P  R  + ++ K   I +N P
Sbjct: 317 RILKRNLIFP--DHVDTEARHLISRLLEYDPGDRIPLKEVKKHPWIEKNKP 365

>KAFR0K00700 Chr11 complement(153981..158126) [4146 bp, 1381 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1381

 Score = 80.5 bits (197), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 60/192 (31%), Positives = 88/192 (45%), Gaps = 33/192 (17%)

Query: 99   QNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHR 158
            + GS ++F L+E+               + + EFEI  +  QV  GV  +H     ++HR
Sbjct: 1211 ETGSIDLFDLIEFT--------------SNMTEFEIKLLFKQVVSGVKHLH--DQGIVHR 1254

Query: 159  DIKIENVLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIF 218
            DIK EN+++      K+ DFGS   +   P           D+   T   Y +PE   + 
Sbjct: 1255 DIKDENIIVDNKGFIKIIDFGSAAYVKSGPF----------DVFVGTI-DYAAPE---VL 1300

Query: 219  RGLPIDEK-SDIWALGIFLYKLCYYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRD 277
             G P + K  DIWALGI LY + +   PF    E  IL G  +F    N S+    LI+ 
Sbjct: 1301 GGNPYEGKPQDIWALGILLYTIVFKENPFYNIDE--ILEGDLKFNDPENISQDCIELIKL 1358

Query: 278  ILVQNPCHRPSV 289
            IL +N   RP++
Sbjct: 1359 ILNRNVFKRPTI 1370

>TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1137

 Score = 80.5 bits (197), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 63/219 (28%), Positives = 106/219 (48%), Gaps = 32/219 (14%)

Query: 105 VFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIEN 164
           +++++EY E+G L + +  +    L E E ++   Q+  G++  HAL   ++HRD+K EN
Sbjct: 118 LYMVLEYAEKGELFNLLVEK--GPLAENEAVRFFRQIIIGMSYCHAL--GIVHRDLKPEN 173

Query: 165 VLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTTA---QYRSPEMIDIFRGL 221
           +L+   +  K+ DFG                   +D L  T+     Y +PE++    GL
Sbjct: 174 ILLDHKSNIKIADFGMAA-------------LETEDKLLETSCGSPHYAAPEIVS---GL 217

Query: 222 PIDE-KSDIWALGIFLYKLCYYTTPF--EKGGEPAIL----SGKFEFPLYPNYSEQLKSL 274
           P +  ++DIW+ G+ L+ L     PF  E G    +L     G+FE P     S + + L
Sbjct: 218 PYNGLETDIWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPGSDELSLEAQDL 277

Query: 275 IRDILVQNPCHRPSVFQLLKRISIMQNVPCPINDIQTVQ 313
           I  IL  NP  R    ++LK   ++Q  P  I D +T++
Sbjct: 278 IGKILTVNPKQRIKTREILKH-PLLQKYPN-IKDSKTIR 314

>TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON}
           Anc_6.31 YMR001C
          Length = 707

 Score = 80.1 bits (196), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 73/293 (24%), Positives = 125/293 (42%), Gaps = 41/293 (13%)

Query: 27  YLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVV 86
           +L  GGFA+ +              VA L    +  + +   L +E+   + +KN   +V
Sbjct: 88  FLGEGGFARCFQFNDDSGKIFAAKTVAKLS---IKSEKTRRKLLSEIQIHKSMKNVN-IV 143

Query: 87  SYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVA 146
            +ID              V++L+E C  G L+D +  R    L E E+    +Q+   + 
Sbjct: 144 QFIDCFEDDT-------NVYILLEICPNGSLMDLLKKR--KSLTEPEVRFFTTQICGAIK 194

Query: 147 AMHALQPPLIHRDIKIENVLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTT 206
            MH+ +  +IHRD+K+ N+    +   K+ DFG    +  +  N +E  Y         T
Sbjct: 195 YMHSRR--VIHRDLKLGNIFFDKDYNLKIGDFG----LAAVLANDRERKYTV-----CGT 243

Query: 207 AQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAILS----GKFEFP 262
             Y +PE++ + +      + DIW++G+ LY L     PF+      I        F FP
Sbjct: 244 PNYIAPEVL-MGKHTGHSYEVDIWSIGVMLYALLIGKPPFQSKDVNTIYERIKCCDFTFP 302

Query: 263 LYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRI------------SIMQNVP 303
                S + K LI+D+L  +P  RPSV +++  +             +M N+P
Sbjct: 303 KDKYISPEAKILIQDLLSLDPLERPSVDEIIDYVWFRGLFPPQIESDVMTNIP 355

>Kpol_2002.24 s2002 (48405..49868) [1464 bp, 487 aa] {ON}
           (48405..49868) [1464 nt, 488 aa]
          Length = 487

 Score = 79.3 bits (194), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 75/267 (28%), Positives = 128/267 (47%), Gaps = 30/267 (11%)

Query: 31  GGFAQVYSVLISPPDPHTNTNVACLKRV-IVPDKPSLNTLRAEVDAMRLLKNNRYVVSYI 89
           G F  VY          TN  +  +K V +   +  ++ L  E+  +  L++  Y+ +YI
Sbjct: 24  GNFGDVYKAF-----DKTNGAIVAVKVVNLEHTEEDIDLLAQEIFFLAELRS-PYITNYI 77

Query: 90  DSHAAKAILQNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMH 149
            +     ++++ S  ++++MEYC  G   D + T   N L E ++  I  +V +G+  +H
Sbjct: 78  TT-----MIEDVS--MWIVMEYCGGGACSDLIKTVYINGLPENKVGFITREVLKGLKYLH 130

Query: 150 ALQPPLIHRDIKIENVLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTTAQY 209
             +   IHRDIK  N+L++   + KL DFG V G IR     +  ++V        T  +
Sbjct: 131 DQKK--IHRDIKAANILLTDEGKVKLGDFG-VSGQIRA--TMKRGTFV-------GTPYW 178

Query: 210 RSPEMIDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAI---LSGKFEFPLYPN 266
            +PE+++       +EK+DIW+LGI +Y+L     P  K     +   L  +    L+  
Sbjct: 179 MAPEVVNK-ESNGYNEKADIWSLGITVYELLKGLPPLSKCDPMKVMVSLPRRKPPKLHGQ 237

Query: 267 YSEQLKSLIRDILVQNPCHRPSVFQLL 293
           YS+  K  +   LV++P  RPS   LL
Sbjct: 238 YSDVAKGFVAACLVKDPNLRPSAEMLL 264

>NCAS0F01580 Chr6 complement(313801..317949) [4149 bp, 1382 aa] {ON}
            Anc_7.86
          Length = 1382

 Score = 80.1 bits (196), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 55/180 (30%), Positives = 85/180 (47%), Gaps = 20/180 (11%)

Query: 116  GLIDFMN-TRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYK 174
            G ID  +    +  + EFE   I  Q+  G+  +H     ++HRDIK ENV++ +    K
Sbjct: 1214 GCIDLFDLIEFKTNMTEFEAKLIFKQIVSGIKHLH--DQGIVHRDIKDENVIVDSKGCVK 1271

Query: 175  LCDFGSVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEK-SDIWALG 233
            + DFGS   +   P           D+   T   Y +PE   +  G P + K  DIWA+G
Sbjct: 1272 IIDFGSAAYVKSGPF----------DVFVGTI-DYAAPE---VLSGEPYEGKPQDIWAIG 1317

Query: 234  IFLYKLCYYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLL 293
            I LY + +   PF    E  IL G+ +F    + SE    LI+ IL+++   RP + ++ 
Sbjct: 1318 ILLYTIVFKENPFYNIDE--ILEGELKFNNSNDISEDCIELIKKILIRSVPKRPLIEEIF 1375

>Smik_4.767 Chr4 complement(1353354..1355630) [2277 bp, 758 aa] {ON}
           YDR490C (REAL)
          Length = 758

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 53/195 (27%), Positives = 96/195 (49%), Gaps = 15/195 (7%)

Query: 105 VFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIEN 164
           ++ L+EY   G  +  +  +    L+E       SQ+   V ++H++   +IHRDIK EN
Sbjct: 199 LYFLLEYAPHGDFLGLI--KKYGSLNEICARYYASQIIDAVDSLHSIG--IIHRDIKPEN 254

Query: 165 VLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNT----TAQYRSPEMI-DIFR 219
           +L+  + + KL DFG+   +   P N+ +         K+     TA+Y SPE++ D + 
Sbjct: 255 ILLDKDMKVKLTDFGTAKILPEQPSNAADGKPCFDLYAKSKSFVGTAEYVSPELLNDSY- 313

Query: 220 GLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAILSG--KFEFPLYPNYSEQLKSLIRD 277
               D + DIWA G  LY++     PF+   E        K ++     + + +K L++ 
Sbjct: 314 ---TDSRCDIWAFGCILYQMLAGKPPFKAANEYLTFQKVMKIQYAFTAGFPQIVKDLVKK 370

Query: 278 ILVQNPCHRPSVFQL 292
           +LV++P  R ++ Q+
Sbjct: 371 LLVRDPNDRLAIEQI 385

>TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2.479
           YKL101W
          Length = 1534

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 61/219 (27%), Positives = 107/219 (48%), Gaps = 32/219 (14%)

Query: 85  VVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQG 144
           +VS+ +  A   + +N + E+++++EY + G L D++ ++   +L E E ++   Q+ +G
Sbjct: 216 LVSHPNVMALYEVWENKN-ELYLVLEYVDGGELFDYLVSK--GKLTELEAVRYFKQIIRG 272

Query: 145 VAAMHALQPPLIHRDIKIENVLISTNNEY-KLCDFGSVCGIIRLPRNSQELSYVQQDILK 203
           V   H+    + HRD+K EN+L+    +  K+ DFG                 V   +LK
Sbjct: 273 VQYCHSFN--ICHRDLKPENLLLDKKRKLIKIADFGMAA------------LQVSNTLLK 318

Query: 204 NTTA--QYRSPEMI--DIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAIL---- 255
            +     Y SPE++    + G P    SD+W+ GI L+ L     PF       +L    
Sbjct: 319 TSCGSPHYASPEIVMGKTYNGGP----SDVWSCGIILFALLTGHLPFNDDSIKKLLIKVQ 374

Query: 256 SGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLK 294
           +G+++ P Y   S+  K LI  IL+ NP  R +  Q+L+
Sbjct: 375 NGRYQMPNY--LSKDAKDLISRILLVNPKARLTTEQILE 411

>Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}
           complement(22310..26968) [4659 nt, 1553 aa]
          Length = 1552

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 57/199 (28%), Positives = 97/199 (48%), Gaps = 31/199 (15%)

Query: 104 EVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIE 163
           E+++++EY + G L D++ ++   +L E E +    Q+  G++  H+    + HRD+K E
Sbjct: 209 ELYLVLEYVDGGELFDYLVSK--GKLTESEAVHYFKQIINGISYCHSFN--ICHRDLKPE 264

Query: 164 NVLISTNNEY-KLCDFGSVCGIIRLPRNSQELSYVQQDILKNT--TAQYRSPEMI--DIF 218
           N+L+       K+ DFG                 V   +L+ +  +  Y SPE++    +
Sbjct: 265 NLLLDKKRRIIKIADFGMAAL------------QVSNRLLQTSCGSPHYASPEIVMGKCY 312

Query: 219 RGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAIL----SGKFEFPLYPNYSEQLKSL 274
            G P    SDIW+ GI L+ L     PF       +L    +G+++ P Y   S++ K+L
Sbjct: 313 NGAP----SDIWSCGIILFALLTGHLPFNDDNIKKLLIKVQNGRYQMPSY--ISQEAKNL 366

Query: 275 IRDILVQNPCHRPSVFQLL 293
           I  ILV +P  R S  Q+L
Sbjct: 367 ISRILVVDPSKRISTEQIL 385

>Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa]
           {ON} YDR507C (REAL)
          Length = 1135

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 87/332 (26%), Positives = 150/332 (45%), Gaps = 42/332 (12%)

Query: 6   IGTYNVGTRLTVGS-HQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIVPDKP 64
           IG + +G  L +GS  +V++ +  ++G  A V  V+        N +   +   I PD  
Sbjct: 16  IGPWKLGETLGLGSTGKVQLARNKSTGQEAAV-KVISKAVFNAGNMSGTSIVGSITPDAL 74

Query: 65  SLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFMNTR 124
                R E+  M+LL N+  V+   D       +   + ++++++EY E+G L + +  R
Sbjct: 75  PYGIER-EIIIMKLL-NHPNVLRLYD-------VWETNTDLYLVLEYAEKGELFNLLVER 125

Query: 125 LQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGSVCGI 184
               L E E ++   Q+  GV+  HAL   ++HRD+K EN+L+      K+ DFG     
Sbjct: 126 --GPLPENEAIRFFRQIIIGVSYCHALG--IVHRDLKPENLLLDHKYNIKIADFGMAA-- 179

Query: 185 IRLPRNSQELSYVQQDILKNT--TAQYRSPEMIDIFRGLPIDE-KSDIWALGIFLYKLCY 241
                        +  +L+ +  +  Y +PE++    G+P     SD+W+ G+ L+ L  
Sbjct: 180 ----------LETEGKLLETSCGSPHYAAPEIVS---GIPYQGFASDVWSCGVILFALLT 226

Query: 242 YTTPF--EKGGEPAIL----SGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKR 295
              PF  E G    +L     G+FE P     S + + LI  IL  +P  R     +LK 
Sbjct: 227 GRLPFDEEDGNIRTLLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKH 286

Query: 296 ISIMQNVPCPINDIQTVQA-PSSHLNLTELHQ 326
             ++Q  P  I D ++++  P     LT L +
Sbjct: 287 -PLLQKYPS-IRDSKSIRGLPREDTYLTPLSE 316

>KLLA0C12485g Chr3 (1060167..1062944) [2778 bp, 925 aa] {ON} similar
           to uniprot|Q12236 YOL100W Saccharomyces cerevisiae
           YOL100W PKH2 Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis
          Length = 925

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 60/223 (26%), Positives = 109/223 (48%), Gaps = 28/223 (12%)

Query: 72  EVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHE 131
           E + ++ LKN + ++S   +   ++ L       + L+EY   G L+  M  R    ++E
Sbjct: 203 EKNTLQRLKNTKGIISLYFTFQDESSL-------YFLLEYAPNGDLLSLM--RKHGSVNE 253

Query: 132 FEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGSVCGIIRLPRNS 191
                  +Q+   +  MH     +IHRD+K EN+L+  + + KL DFG+     RL  ++
Sbjct: 254 KCTQYYAAQIIDALGFMH--DKGVIHRDLKPENILLDVDMKVKLTDFGTA----RLLDST 307

Query: 192 QELSYVQQDILKNT-----TAQYRSPEMI-DIFRGLPIDEKSDIWALGIFLYKLCYYTTP 245
            E   ++ D+L  +     TA+Y SPE++ D +    +D + DIWA G  L+++     P
Sbjct: 308 SE-DDLKYDLLTRSNSFVGTAEYVSPELLNDNY----VDFRCDIWAFGCILFQMIAGKPP 362

Query: 246 FEKGGEPAILSG--KFEFPLYPNYSEQLKSLIRDILVQNPCHR 286
           F+   E        K +F     +   ++ L+++IL++NP  R
Sbjct: 363 FKANNEYLTFQKVMKVQFAFTAGFPMTVRDLVKNILIKNPERR 405

>NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31
          Length = 726

 Score = 79.3 bits (194), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 68/286 (23%), Positives = 128/286 (44%), Gaps = 29/286 (10%)

Query: 27  YLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVV 86
           +L  GGFA+ + +            VA   ++ +  + +   L +E+   + +K+   +V
Sbjct: 97  FLGEGGFARCFQIKDESGKIFAAKTVA---KISIKTEKTKKKLLSEIQIHKSMKHPN-IV 152

Query: 87  SYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVA 146
            ++D              V++L+E C  G L+D M  R    L E E+    +Q+   V 
Sbjct: 153 HFVDCFEDDT-------NVYILLEICSNGSLMDLMKKR--KTLTEPEVRFFTTQICGAVK 203

Query: 147 AMHALQPPLIHRDIKIENVLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTT 206
            MH+ +  +IHRD+K+ N+    +   K+ DFG    +  +  N++E  Y         T
Sbjct: 204 YMHSRR--VIHRDLKLGNIFFDKDYNLKVGDFG----LAAVLANNRERKYTVCG-----T 252

Query: 207 AQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAIL----SGKFEFP 262
             Y +PE++ + +      + DIW++G+ +Y L     PF+      I     + ++ +P
Sbjct: 253 PNYIAPEVL-MGKHAGHSFEVDIWSIGVMIYALLVGKPPFQAKDVNVIYDRIKACQYGYP 311

Query: 263 LYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQNVPCPIND 308
                S + K+LI DIL  +P  RPS+ +++  +      P  I +
Sbjct: 312 KDKYVSSEAKTLIADILCVDPVERPSIREIIDDVWFRGIFPPKITE 357

>Smik_3.54 Chr3 (80309..83407) [3099 bp, 1032 aa] {ON} YCL024W
           (REAL)
          Length = 1032

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 58/200 (29%), Positives = 98/200 (49%), Gaps = 32/200 (16%)

Query: 105 VFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIEN 164
           +++++EY E+G L + +  R    L E E ++   Q+   ++  HAL   ++HRD+K EN
Sbjct: 102 LYLILEYAEKGELFNLLVDR--GPLPEREAIKCFKQIIIAISYCHALG--IVHRDLKPEN 157

Query: 165 VLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQD--ILKNTTA--QYRSPEMIDIFRG 220
           +L+  +   K+ DFG              ++ +Q D  +L+ +     Y +PE++    G
Sbjct: 158 LLLDNSYNIKIADFG--------------MAALQTDAGMLETSCGSPHYAAPEIVS---G 200

Query: 221 LPIDE-KSDIWALGIFLYKLCYYTTPF--EKGGEPAIL----SGKFEFPLYPNYSEQLKS 273
           LP +   SD+W+ G+ L+ L     PF  E G    +L     G+FE P     S   + 
Sbjct: 201 LPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEISGDAQD 260

Query: 274 LIRDILVQNPCHRPSVFQLL 293
           LIR ILV +P  R  +  +L
Sbjct: 261 LIRRILVVDPTQRIKIRDIL 280

>AFR724C Chr6 complement(1770338..1771660) [1323 bp, 440 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR523C
           (SPS1)
          Length = 440

 Score = 78.2 bits (191), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 74/278 (26%), Positives = 135/278 (48%), Gaps = 30/278 (10%)

Query: 21  QVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIVPDKPS-LNTLRAEVDAMRLL 79
           Q EI++ +  G F  VY          T+  +  +K V + D    ++ L  E+  +  L
Sbjct: 19  QYEILQCIGRGNFGDVYKA-----RDLTSNEIVAIKVVNLEDTDEPIDLLAQEIFFLSEL 73

Query: 80  KNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIIS 139
           ++  Y+ +Y       A L + S  ++++MEYC  G   + +    ++++ E +   I+S
Sbjct: 74  RSP-YITNY-----KTAFLVDVS--MWIVMEYCGGGSCAELLKYTPEHKVTEEQCAFIVS 125

Query: 140 QVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQ 199
           +V  G+  +H+ +   IHRDIK  N+L++ N   KL DFG V G + + R        ++
Sbjct: 126 EVLIGLDYLHSQRK--IHRDIKSANILLTDNGHVKLGDFG-VSGQMMVTR--------KR 174

Query: 200 DILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEK-GGEPAILSGK 258
           D    T   + +PE+ID  +    +E +DIW+LGI + +L     P +K     A+++  
Sbjct: 175 DTFVGTPF-WMAPEVIDRNKQ-GYNEMADIWSLGITVIELLMGHPPLDKYDAMKALMAIP 232

Query: 259 FEFP--LYPNYSEQLKSLIRDILVQNPCHRPSVFQLLK 294
              P  L   +S   +  +   L+++P  RP+  +LLK
Sbjct: 233 KRDPPKLDKRFSSHARDFVAQCLIKDPSQRPTAAELLK 270

>ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W Hypothetical ORF
          Length = 938

 Score = 79.3 bits (194), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 57/200 (28%), Positives = 99/200 (49%), Gaps = 33/200 (16%)

Query: 104 EVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIE 163
           +V++ +EYC    L + +   + +R+   E  ++ +Q+   V   H+L    +HRD+K+E
Sbjct: 102 KVWMALEYCPGRELYEHL--LMLHRIPLDECAKLFAQIVSAVHYAHSLN--CVHRDLKLE 157

Query: 164 NVLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMI--DIFRGL 221
           N+L+  N   KL DFG     +         S    + +  TT  Y +PE+I    + G 
Sbjct: 158 NILLDKNGNAKLTDFGFTRECV---------SKSSLETICGTTV-YMAPELIQRQAYDGF 207

Query: 222 PIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAILSGKFEFPL---YPNY-----SEQLKS 273
            I    DIW+LG+ LY +   T PF++  E      K ++ +   +PN+     S + K 
Sbjct: 208 KI----DIWSLGVILYTMINGTMPFDEDDET-----KTKWKIVNDFPNFNDNFVSHEAKD 258

Query: 274 LIRDILVQNPCHRPSVFQLL 293
           LI+ +L + P  RP++ Q+L
Sbjct: 259 LIKRLLAKCPSERPTMEQIL 278

>Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa]
           {ON} YDR507C (REAL)
          Length = 1136

 Score = 79.3 bits (194), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 89/333 (26%), Positives = 151/333 (45%), Gaps = 44/333 (13%)

Query: 6   IGTYNVGTRLTVGS-HQVEIIKYLTSGGFAQVYSVLISPPDPHT-NTNVACLKRVIVPDK 63
           IG + +G  L +GS  +V++ +  ++G  A V   +IS    +T N +   +     PD 
Sbjct: 16  IGPWKLGETLGLGSTGKVQLARNKSTGQEAAVK--VISKTVFNTGNVSGTSIVGSTTPDA 73

Query: 64  PSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFMNT 123
                 R E+  M+LL N+  V+   D     A       ++++++EY E+G L + +  
Sbjct: 74  LPYGIER-EIIIMKLL-NHPNVLRLYDVWETNA-------DLYLVLEYAEKGELFNLLVE 124

Query: 124 RLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGSVCG 183
           R    L E E ++   Q+  GV+  HAL   ++HRD+K EN+L+      K+ DFG    
Sbjct: 125 R--GPLPENEAIRFFRQIIIGVSYCHALG--IVHRDLKPENLLLDHKYNIKIADFGMAA- 179

Query: 184 IIRLPRNSQELSYVQQDILKNT--TAQYRSPEMIDIFRGLPIDE-KSDIWALGIFLYKLC 240
                         +  +L+ +  +  Y +PE++    G+P     SD+W+ G+ L+ L 
Sbjct: 180 -----------LETEGKLLETSCGSPHYAAPEIVS---GIPYQGFASDVWSCGVILFALL 225

Query: 241 YYTTPF--EKGGEPAIL----SGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLK 294
               PF  E G    +L     G+FE P     S + + LI  IL  +P  R     +LK
Sbjct: 226 TGRLPFDEEDGNIRTLLLKVQKGEFELPSDDEISREAQDLISRILTVDPERRIKTRDILK 285

Query: 295 RISIMQNVPCPINDIQTVQA-PSSHLNLTELHQ 326
              ++Q  P  I D ++++  P     LT L +
Sbjct: 286 H-PLLQKYPS-IKDSKSIRGLPREDTYLTPLSE 316

>ZYRO0B01166g Chr2 complement(97168..100059) [2892 bp, 963 aa] {ON}
           weakly similar to uniprot|Q03497 Saccharomyces
           cerevisiae YHL007C STE20 Signal transducing kinase of
           the PAK (p21-activated kinase) family involved in
           pheromone response and pseudohyphal/invasive growth
           pathways activated by Cdc42p binds Ste4p at a GBB motif
           present in noncatalytic domains of PAK kinases
          Length = 963

 Score = 79.3 bits (194), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 80/287 (27%), Positives = 130/287 (45%), Gaps = 60/287 (20%)

Query: 30  SGGFAQVYSVLISPPDPHTNTNVACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVVSYI 89
           SGG    Y +        TN +VA +K++ +  +P    +  E+  M+  K+ R +V++I
Sbjct: 666 SGGVYTAYEL-------GTNASVA-IKQMNLEKQPKKELIINEIMVMKGSKH-RNIVNFI 716

Query: 90  DSHAAKAILQNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMH 149
           DS+  K        +++V+MEY E G L D +   +   L E +I  +  +   G+  +H
Sbjct: 717 DSYLLKG-------DLWVVMEYMEGGSLTDVVTHCI---LTEGQIGAVCRETLAGLQFLH 766

Query: 150 ALQPPLIHRDIKIENVLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTTAQY 209
           +    +IHRDIK +N+L+S   E KL DFG  C  I       E++  +  ++   T  +
Sbjct: 767 SKG--VIHRDIKSDNILLSMTGEIKLTDFG-FCAQI------NEINLKRTTMVG--TPYW 815

Query: 210 RSPEMIDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAILSGKFEFPLYP---- 265
            +PE++      P   K DIW+LGI + ++          GEP  L+   E PL      
Sbjct: 816 MAPEVVSRKEYGP---KVDIWSLGIMIIEMIE--------GEPPYLN---ETPLRALYLI 861

Query: 266 ------------NYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQ 300
                       N  E+L++ +   L   P  R S  QLLK   + Q
Sbjct: 862 ATNGTPKLKEPDNLGEELQNFLDWCLTVEPDQRASSSQLLKDPFVTQ 908

>CAGL0L11550g Chr12 (1232015..1235233) [3219 bp, 1072 aa] {ON}
           similar to uniprot|P38692 Saccharomyces cerevisiae
           YHR102w NRK1 ser/thr protein kinase
          Length = 1072

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 60/204 (29%), Positives = 95/204 (46%), Gaps = 28/204 (13%)

Query: 101 GSY----EVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLI 156
           GSY     ++++MEYC  G L   +      ++ E  I  I+ ++   +  +H  +  +I
Sbjct: 80  GSYLRGTSLWIIMEYCAGGSLRSLLRP---GKIDEKYIGVIMRELLVALKVIH--KDNVI 134

Query: 157 HRDIKIENVLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMID 216
           HRDIK  NVLI+   + KLCDFG    + +     Q ++          T  + +PE+  
Sbjct: 135 HRDIKAANVLITNEGQVKLCDFGVAAQLNQTSLRRQTMA---------GTPYWMAPEV-- 183

Query: 217 IFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAILSGKFEFPLYP------NYSEQ 270
           I  G+  D K DIW+LGI  Y++     P+      A+ + +      P      NY+ Q
Sbjct: 184 IMEGVYYDTKVDIWSLGITAYEIATGNPPY--CDVEALRAMQLIIKSKPPRLEERNYTPQ 241

Query: 271 LKSLIRDILVQNPCHRPSVFQLLK 294
           LK  I   L ++P  R S  +LLK
Sbjct: 242 LKEFIALCLDEDPQERLSAEELLK 265

>Ecym_3586 Chr3 complement(1112070..1115303) [3234 bp, 1077 aa] {ON}
           similar to Ashbya gossypii AFR335C
          Length = 1077

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 52/194 (26%), Positives = 95/194 (48%), Gaps = 10/194 (5%)

Query: 105 VFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIEN 164
           ++ L+EY   G  +  M  +    L+E       +Q+  G+  +H  +  +IHRDIK EN
Sbjct: 278 LYFLLEYAPNGDFLSIM--KKYGSLNEECARYYGAQILNGIYFLH--RHGIIHRDIKPEN 333

Query: 165 VLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPID 224
           +L+  + + KL DFG+   ++     ++E     +      TA+Y SPE+++      +D
Sbjct: 334 ILLDKSMKVKLTDFGT-AKLLNRKDGTEEYDLTTRSKSFVGTAEYVSPELLN---DSWVD 389

Query: 225 EKSDIWALGIFLYKLCYYTTPFEKGGEPAILSG--KFEFPLYPNYSEQLKSLIRDILVQN 282
            K DIWA G  L+++     PF+   E        K ++     +   ++ L++ ILV+ 
Sbjct: 390 HKCDIWAFGCILFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPMVVRDLVKQILVKK 449

Query: 283 PCHRPSVFQLLKRI 296
           P HR ++ Q+ K +
Sbjct: 450 PEHRLTIPQIEKHL 463

>Kwal_33.13112 s33 (76807..78324) [1518 bp, 505 aa] {ON} YDR523C
           (SPS1) - serine/threonine kinase homologous to Ste20p;
           expressed in middle/late meiosis [contig 123] FULL
          Length = 505

 Score = 78.2 bits (191), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 78/283 (27%), Positives = 126/283 (44%), Gaps = 39/283 (13%)

Query: 19  SHQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIVPDKPSLNTLRAEVDAMRL 78
           S   +I + +  G F  VY  +    D  T   VA     +   +  ++ L  E+  +  
Sbjct: 33  SQLYDIKECVGKGSFGDVYRAI----DKETGEMVAVKIINLEETQDDIDVLAQEIYFLSE 88

Query: 79  LKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQII 138
           L+   +V +Y  ++            ++++ME+C  G   D +    ++RL E ++  II
Sbjct: 89  LRAP-FVTTYYKTYVEDV-------SMWIVMEFCGGGSCADLLKHLPEHRLPENKVAYII 140

Query: 139 SQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGSVCGIIR--LPRNSQELSY 196
            +V  G+  +H+ +   IHRD+K  N+L++   E KL DFG V G I   L RN    ++
Sbjct: 141 REVLYGLEYLHSQRK--IHRDVKAANILLTDEGEVKLGDFG-VSGQIMATLKRN----TF 193

Query: 197 VQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAILS 256
           V        T  + +PE+I    G   DEK+DIW+LGI   +L     P+ K     +L 
Sbjct: 194 V-------GTPYWMAPEIIARDNGY--DEKADIWSLGITAMELLTGQPPYAKYDPMKVL- 243

Query: 257 GKFEFPLY--PNYSEQLKSLIRDI----LVQNPCHRPSVFQLL 293
                PL   P    +  S  RD     L ++P  RP+   LL
Sbjct: 244 --MNIPLRKPPRLQGRFTSSARDFIALCLTKDPALRPTASDLL 284

>NDAI0E01290 Chr5 complement(255593..257782) [2190 bp, 729 aa] {ON}
           Anc_8.654
          Length = 729

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 62/239 (25%), Positives = 107/239 (44%), Gaps = 45/239 (18%)

Query: 72  EVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHE 131
           E++A++LL +   V         + +LQN  Y + +++E+   G    ++  + + RL E
Sbjct: 103 EINALKLLTHPNIV-------RLEEVLQNSKY-IGIVLEFASGGEFYKYL--QRKRRLKE 152

Query: 132 FEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGSVCGIIRLPRNS 191
               Q+ +Q+  GV  MH+    L+HRD+K+EN+L+  N    + DFG V          
Sbjct: 153 PHACQLFAQLISGVTYMHSKG--LVHRDLKLENLLLDKNENLIITDFGFVNEF------- 203

Query: 192 QELSYVQQDILKNTTAQ--YRSPEMI---DIFRGLPIDEKSDIWALGIFLYKLCYYTTPF 246
               +   +++K +     Y +PE++   + +R      K DIW+ GI LY +     P+
Sbjct: 204 ----FGSNELMKRSCGSPCYAAPELVLSTEPYRA----RKVDIWSCGIILYAMLAGYLPW 255

Query: 247 EKGGE-----------PAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLK 294
           +   +             I     +FP Y   S   + LIR IL  NP  R S+  + K
Sbjct: 256 DDDSQNPNGDDIGKLYQYITKTALKFPAY--ISPLARDLIRKILTANPSRRISISYICK 312

>TBLA0A03570 Chr1 (892930..895857) [2928 bp, 975 aa] {ON} Anc_5.406
           YHR102W
          Length = 975

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 60/229 (26%), Positives = 101/229 (44%), Gaps = 45/229 (19%)

Query: 83  RYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVT 142
           RY  SY+   +           ++++MEYC  G +   +      ++ E  I  I+ ++ 
Sbjct: 103 RYYASYLKDTS-----------LWIIMEYCAGGSVRTLLR---PGKIDEKYIAVIMRELL 148

Query: 143 QGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDIL 202
             +  +H  +  +IHRDIK  N+LI+     KLCDFG    + +     Q ++       
Sbjct: 149 VALHYIH--KDNVIHRDIKAANLLITNEGNVKLCDFGVAAQLNQNTMRRQTMA------- 199

Query: 203 KNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEK-----------GGE 251
              T  + +PE+  I  G+  D K+DIW++GI  Y++     PF +             +
Sbjct: 200 --GTPYWMAPEV--IMEGISYDTKADIWSVGITAYEIATGNPPFCEMEALRAMQVISKSK 255

Query: 252 PAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQ 300
           PA L GK   PL       LK  I   L ++P  RP+  +LL   + ++
Sbjct: 256 PARLEGKNHDPL-------LKEFIAMCLDEDPQERPTADKLLHESAFIK 297

>YDR490C Chr4 complement(1431968..1434268) [2301 bp, 766 aa] {ON}
           PKH1Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis; activates Ypk1p and Ykr2p, components of
           signaling cascade required for maintenance of cell wall
           integrity; redundant with Pkh2p
          Length = 766

 Score = 78.6 bits (192), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 54/196 (27%), Positives = 95/196 (48%), Gaps = 17/196 (8%)

Query: 105 VFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIEN 164
           ++ L+EY   G  +  +  +    L+E       SQ+   V ++H +   +IHRDIK EN
Sbjct: 199 LYFLLEYAPHGDFLGLI--KKYGSLNETCARYYASQIIDAVDSLHNIG--IIHRDIKPEN 254

Query: 165 VLISTNNEYKLCDFGSVCGIIRLPRNSQELS-----YVQQDILKNTTAQYRSPEMI-DIF 218
           +L+  N + KL DFG+   +   P N+ +       Y +       TA+Y SPE++ D +
Sbjct: 255 ILLDKNMKVKLTDFGTAKILPEEPSNTADGKPYFDLYAKSKSFVG-TAEYVSPELLNDNY 313

Query: 219 RGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAILSG--KFEFPLYPNYSEQLKSLIR 276
                D + DIWA G  LY++     PF+   E        K ++     + + +K L++
Sbjct: 314 ----TDSRCDIWAFGCILYQMLAGKPPFKAANEYLTFQKVMKIQYAFTAGFPQIVKDLVK 369

Query: 277 DILVQNPCHRPSVFQL 292
            +LV++P  R ++ Q+
Sbjct: 370 KLLVRDPNDRLTIKQI 385

>CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150w
          Length = 893

 Score = 78.6 bits (192), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 60/208 (28%), Positives = 96/208 (46%), Gaps = 49/208 (23%)

Query: 104 EVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIE 163
           +V++ +EYC    L D + ++  +RL   E  ++ +Q+T  V   H L    +HRD+K+E
Sbjct: 107 KVWMALEYCPGKELYDHLLSK--SRLPTLECAELFAQITGAVHYAHTLN--CVHRDLKLE 162

Query: 164 NVLISTNNEYKLCDFG------------SVCGIIRLPRNSQELSYVQQDILKNTTAQYRS 211
           NVL+  N   KL DFG            +VCG                      T  Y +
Sbjct: 163 NVLLDKNGNAKLTDFGFTRESMTKAVLETVCG----------------------TTVYMA 200

Query: 212 PEMIDIFRGLPIDE-KSDIWALGIFLYKLCYYTTPFEKGGEPAILSGKFEFPLYPNYSEQ 270
           PEMI   +  P D  K DIW+LG+ LY L     PF++  +  +L+ +      P   E+
Sbjct: 201 PEMI---QHKPYDGFKVDIWSLGVILYTLLCGCLPFDEDDD--LLTKQKIINDTPVIDER 255

Query: 271 L-----KSLIRDILVQNPCHRPSVFQLL 293
           +     ++LI  +L ++P  RP+   +L
Sbjct: 256 ITIPEAQNLIEQLLSKDPTERPNTSAIL 283

>NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON}
           Anc_5.591 YDR466W
          Length = 1117

 Score = 78.6 bits (192), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 85/323 (26%), Positives = 146/323 (45%), Gaps = 51/323 (15%)

Query: 6   IGTYNVGTRLTVGS-HQVEIIKYLTSGGFAQVY----SVLISPPDPHTNTNVACLKRVIV 60
           IG + +G  L +GS  +V++    T+   A +     S+  + P+ +  + VA       
Sbjct: 19  IGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVAN-----T 73

Query: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDF 120
           PD       R E+  M+LL++   V+S  D     + L       ++++EY E+G L + 
Sbjct: 74  PDSLPYGIER-EIIIMKLLRHAN-VLSLYDVWETNSNL-------YMILEYAEKGELFNL 124

Query: 121 MNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGS 180
           +  +    L E E ++   Q+  G++  HAL   ++HRD+K EN+L+      K+ DFG 
Sbjct: 125 LVEK--GPLPEKEAVRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKFNIKIADFGM 180

Query: 181 VCGIIRLPRNSQELSYVQQDILKNTTA---QYRSPEMIDIFRGLPIDE-KSDIWALGIFL 236
                             +D L  T+     Y +PE++    G+P    +SD+W+ G+ L
Sbjct: 181 AA-------------LETEDKLLETSCGSPHYAAPEIVS---GIPYHGFESDVWSCGVIL 224

Query: 237 YKLCYYTTPF--EKGGEPAIL----SGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVF 290
           + L     PF  E G    +L    SG+FE P     S   + LI  IL  +P  R    
Sbjct: 225 FALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTR 284

Query: 291 QLLKRISIMQNVPCPINDIQTVQ 313
           ++LK   ++Q  P  I D ++++
Sbjct: 285 EILKH-PLLQKYPS-IKDSKSIK 305

>NCAS0I00470 Chr9 (74336..77584) [3249 bp, 1082 aa] {ON} Anc_7.86
          Length = 1082

 Score = 78.6 bits (192), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 65/228 (28%), Positives = 102/228 (44%), Gaps = 29/228 (12%)

Query: 66   LNTLRAEVDAMRLL--KNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFMNT 123
            L T+ +E+  M  L  K ++ +V+ +D        ++  Y       + E G +  F   
Sbjct: 869  LGTIPSEIQIMATLNKKPHKNIVALLD------FFEDEEYYYMETPAHGETGSIDLFDLI 922

Query: 124  RLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGSVCG 183
             L+  + E+E   I  QV  G+  +H     ++HRDIK ENV++ +    KL D+GS   
Sbjct: 923  ELKKNMTEYEEKLIFKQVVSGLKHLH--DQGIVHRDIKDENVIVDSKGHVKLIDYGSAAY 980

Query: 184  IIRLPRNSQELSYVQQDILKNTTAQYRSPEMI--DIFRGLPIDEKSDIWALGIFLYKLCY 241
                P           D+   T   Y +PE++   ++ G P     DIWA+GI LY + +
Sbjct: 981  TKSGPF----------DVFVGTI-DYAAPEVLGGSVYDGKP----QDIWAIGILLYTIIF 1025

Query: 242  YTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSV 289
               PF    E  I+ G+  F    N SE    LI+ IL ++   RP V
Sbjct: 1026 KENPFYNIDE--IMDGELRFNDAGNTSEACIKLIKKILNRSIVDRPCV 1071

>Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074
           aa] {ON} YHR102W (REAL)
          Length = 1074

 Score = 78.6 bits (192), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 61/209 (29%), Positives = 92/209 (44%), Gaps = 38/209 (18%)

Query: 101 GSY----EVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLI 156
           GSY     ++++MEYC  G L   +      ++ E  I  I+ +V   +  +H     +I
Sbjct: 87  GSYLKDTSLWIIMEYCAGGSLRSLLR---PGKIDEKYIGVIMREVLVALKCIHKDN--VI 141

Query: 157 HRDIKIENVLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMID 216
           HRDIK  NVLI+     KLCDFG    + +     Q ++          T  + +PE+  
Sbjct: 142 HRDIKAANVLITNEGNVKLCDFGVAAQVNQTSLRRQTMA---------GTPYWMAPEV-- 190

Query: 217 IFRGLPIDEKSDIWALGIFLYKLCYYTTPFEK-----------GGEPAILSGKFEFPLYP 265
           I  G+  D K DIW+LGI  Y++     P+ +             +P  L G+       
Sbjct: 191 IMEGVYYDTKVDIWSLGITTYEIATGNPPYCEVEALRAMQLIIKSKPPRLEGR------- 243

Query: 266 NYSEQLKSLIRDILVQNPCHRPSVFQLLK 294
           +YS  LK  I   L ++P  R S   LLK
Sbjct: 244 SYSPSLKEFIALCLDEDPKERLSADDLLK 272

>Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa]
           {ON} YCL024W (REAL)
          Length = 1128

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 61/219 (27%), Positives = 105/219 (47%), Gaps = 30/219 (13%)

Query: 104 EVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIE 163
           ++++++EY E+G L + +  R    L E E ++   Q+  GV+  HAL   ++HRD+K E
Sbjct: 105 DLYLVLEYAEKGELFNLLVER--GPLPENEAIRFFRQIIIGVSYCHALG--IVHRDLKPE 160

Query: 164 NVLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNT--TAQYRSPEMIDIFRGL 221
           N+L+      K+ DFG                  +  +L+ +  +  Y +PE++    G+
Sbjct: 161 NLLLDHKYNIKIADFGMAA------------LETEGKLLETSCGSPHYAAPEIVS---GI 205

Query: 222 PIDE-KSDIWALGIFLYKLCYYTTPF--EKGGEPAIL----SGKFEFPLYPNYSEQLKSL 274
           P     SD+W+ G+ L+ L     PF  E G   A+L     G+FE P     S + + L
Sbjct: 206 PYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRALLLKVQKGEFELPSDDEISREAQDL 265

Query: 275 IRDILVQNPCHRPSVFQLLKRISIMQNVPCPINDIQTVQ 313
           I  IL  +P  R     +LK   ++Q  P  I D ++++
Sbjct: 266 ISKILTVDPERRIKARDILKH-PLLQKYPS-IRDSKSIR 302

>KLLA0F07623g Chr6 (720246..723935) [3690 bp, 1229 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017W PSK1 One
            of two (see also PSK2) PAS domain containing S/T protein
            kinases coordinately regulates protein synthesis and
            carbohydrate metabolism and storage in response to a
            unknown metabolite that reflects nutritional status
          Length = 1229

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 65/233 (27%), Positives = 100/233 (42%), Gaps = 42/233 (18%)

Query: 63   KPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFMN 122
            KP  N LR     +   +++ Y     + H      + GS ++F L+E            
Sbjct: 1032 KPHENILRI----LDFFEDDDYYYLETEMHG-----ETGSIDLFDLIE------------ 1070

Query: 123  TRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGSVC 182
              L+  + EFE   +  QV  G+  +H     ++HRDIK ENV++      KL DFGS  
Sbjct: 1071 --LKTNMTEFEAKLLFKQVASGIKHLH--DNGIVHRDIKDENVIVDNKGFVKLIDFGSAA 1126

Query: 183  GIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEK-SDIWALGIFLYKLCY 241
             +   P           D+   T   Y +PE   +  G P + K  DIWA+G+ LY + Y
Sbjct: 1127 YVKSGPF----------DVFVGTI-DYAAPE---VLGGEPYEGKPQDIWAIGVLLYTIIY 1172

Query: 242  YTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLK 294
               PF    E  IL G          S +  +LIR IL ++   RP++  +++
Sbjct: 1173 KENPFYNIDE--ILDGDLRIQSTHEVSAECVALIRKILNRSVSKRPTIDDIME 1223

>ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 774

 Score = 78.2 bits (191), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 65/271 (23%), Positives = 121/271 (44%), Gaps = 29/271 (10%)

Query: 27  YLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVV 86
           +L  GGFA+ + +            VA L    +  + +   L +E+   + +K+   +V
Sbjct: 150 FLGEGGFARCFQIRDDSGKLFAAKTVAKLS---IKTEKTRKKLLSEIQIHKSMKHQN-IV 205

Query: 87  SYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVA 146
            +ID              V++L+E C  G L++ +  R Q  L E E+    +Q+   + 
Sbjct: 206 QFIDCFEDDT-------NVYILLEICPNGSLMELLKKRKQ--LTEPEVRFFTTQICGAIK 256

Query: 147 AMHALQPPLIHRDIKIENVLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTT 206
            MH+ +  +IHRD+K+ N+    N   K+ DF    G+  +  N +E  +         T
Sbjct: 257 YMHSRR--VIHRDLKLGNIFFDRNYNLKIGDF----GLAAVLANDRERKFTVCG-----T 305

Query: 207 AQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAILS----GKFEFP 262
             Y +PE++ + +      + D+W++G+ +Y L     PF+      I        F FP
Sbjct: 306 PNYIAPEVL-MGKHSGHSYEVDVWSIGVMVYALLVGKPPFQAKDVNTIYERIKCCDFIFP 364

Query: 263 LYPNYSEQLKSLIRDILVQNPCHRPSVFQLL 293
                S + K L++D+L  +P  RPS+ +++
Sbjct: 365 KEKPISHEAKVLVQDLLSLDPLERPSISEIM 395

>Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101W
           (HSL1) - Putative protein kinase homologous to S. pombe
           cdr1/nim1 [contig 55] FULL
          Length = 1267

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 78/304 (25%), Positives = 130/304 (42%), Gaps = 67/304 (22%)

Query: 6   IGTYNVGTRLTVGSH-QVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIVPDKP 64
           IG + +G  L  GS  +V + K + +G  A +                      IVP   
Sbjct: 55  IGPWKLGKTLGKGSSGRVRLAKNMETGKLAAIK---------------------IVPKTK 93

Query: 65  SLNT------LRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLI 118
           S  T      +  E+  M+L+ +   +  Y        + +N   E+F+++EY + G L 
Sbjct: 94  SSRTGSLPYGIEREIIIMKLISHPNVMGLY-------EVWEN-KLELFLVLEYVDGGELF 145

Query: 119 DFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEY-KLCD 177
           D++ +R   RL E E +    Q+ +G A  H     + HRD+K EN+L+   N+  K+ D
Sbjct: 146 DYLVSR--GRLPEKEAIHYFRQIIEGTAYCHGFN--ICHRDLKPENLLLDKKNKRIKIAD 201

Query: 178 FGSVCGIIRLPRNSQELSYVQQDILKNT--TAQYRSPEMI--DIFRGLPIDEKSDIWALG 233
           FG                     +L+ +  +  Y SPE++    + G P    SD+W+ G
Sbjct: 202 FGMAA------------LQTSNKLLETSCGSPHYASPEIVMGKNYNGGP----SDVWSCG 245

Query: 234 IFLYKLCYYTTPFEKGGEPAIL----SGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSV 289
           I L+ L     PF       +L    +GK++ P   + S   + LI  ILV +P  R S+
Sbjct: 246 IILFALLTGHLPFNDDNIKRLLLKVQAGKYQMPQ--SVSSGAQDLISRILVVDPDKRISI 303

Query: 290 FQLL 293
            ++L
Sbjct: 304 NEIL 307

>KNAG0A03040 Chr1 complement(372150..374084) [1935 bp, 644 aa] {ON}
           Anc_8.654 YPL141C
          Length = 644

 Score = 77.8 bits (190), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 58/204 (28%), Positives = 98/204 (48%), Gaps = 34/204 (16%)

Query: 97  ILQNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLI 156
           ILQN  Y + +++EY   G    ++  + + RL E    ++ SQ+  GV  MH+    L+
Sbjct: 128 ILQNSKY-IGIVLEYASGGEFYKYI--QRKRRLKEVNASRLFSQLVSGVHYMHSKG--LV 182

Query: 157 HRDIKIENVLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTTAQ---YRSPE 213
           HRD+K+EN+L+  N    + DFG V              +  +++L  T+     Y +PE
Sbjct: 183 HRDLKLENLLLDKNENLMITDFGFVN------------EFSNENVLMKTSCGSPCYAAPE 230

Query: 214 MIDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAILSGKFEFPLY--------- 264
           ++ + R   +  K DIW+ G+ LY +     P++   +P+  +G     LY         
Sbjct: 231 LV-VSREAYVGVKVDIWSCGVILYAMLAGYLPWDD--DPSNPNGDDISKLYSYITATPLK 287

Query: 265 -PNYSEQL-KSLIRDILVQNPCHR 286
            P+Y   L + L+R ILV +P  R
Sbjct: 288 FPDYVNPLPRDLLRRILVADPRRR 311

>NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa]
           {ON} Anc_1.24
          Length = 489

 Score = 77.4 bits (189), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 61/215 (28%), Positives = 108/215 (50%), Gaps = 23/215 (10%)

Query: 84  YVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQ 143
           Y+ +YI +     +L++ S  ++++MEYC  G   D +       LHE ++  I   V +
Sbjct: 78  YITNYITT-----MLEDVS--MWIVMEYCGGGSCSDLIRYHYNEGLHEDKVAFITKNVLR 130

Query: 144 GVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILK 203
           G+  +H  +   IHRD+K  NVL++ +   KL DFG V G +R    ++  ++V      
Sbjct: 131 GLQYLHEQRK--IHRDVKAANVLLTDDGLVKLADFG-VSGQLR--STAKRNTFV------ 179

Query: 204 NTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAILSG---KFE 260
             T  + +PE+I        +EK+DIW+LGI +Y+L     P+ K     ++     K  
Sbjct: 180 -GTPYWMAPEIIS-NSSHGYNEKADIWSLGITVYELLKGCPPYAKYDAGKVMRNIPKKNL 237

Query: 261 FPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKR 295
                ++S+  K  I   L+++P  RP+  +LL++
Sbjct: 238 QDCMVSFSDAAKLFISACLIKDPDERPTATELLQQ 272

>Kwal_26.7861 s26 complement(544126..546993) [2868 bp, 955 aa] {ON}
           YHL007C (STE20) - serine/threonine protein kinase
           [contig 55] FULL
          Length = 955

 Score = 78.2 bits (191), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 78/277 (28%), Positives = 128/277 (46%), Gaps = 54/277 (19%)

Query: 30  SGGFAQVYSVLISPPDPHTNTNVACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVVSYI 89
           SGG    Y V        TN +VA +K++ +  +P    +  E+  M+  K+   +V++I
Sbjct: 678 SGGVYTAYEV-------GTNASVA-IKQMNLEKQPKKELIINEILVMKASKHAN-IVNFI 728

Query: 90  DSHAAKAILQNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMH 149
           DS+  +        +++V+MEY E G L D +   +   L E +I  +  +  +G+  +H
Sbjct: 729 DSYLLRG-------DLWVVMEYMEGGSLTDVVTHCI---LTEGQIGAVSRETLKGLQFLH 778

Query: 150 ALQPPLIHRDIKIENVLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTTAQY 209
           +    +IHRDIK +NVL+S + E KL DFG  C  I       E++  +  ++   T  +
Sbjct: 779 SKG--VIHRDIKSDNVLLSMSGEIKLTDFG-FCAQI------NEINLKRTTMV--GTPYW 827

Query: 210 RSPEMIDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAIL-------------S 256
            +PE++      P   K DIW+LGI + ++          GEP  L             +
Sbjct: 828 MAPEVVSRKEYGP---KVDIWSLGIMIIEMIE--------GEPPYLNETPLRALYLIATN 876

Query: 257 GKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLL 293
           G  E     + S+ LKS +   L  NP  R +  QLL
Sbjct: 877 GTPELKDADSLSDDLKSFLGWCLHVNPDERATASQLL 913

>Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {ON}
           YMR001C (CDC5) - protein kinase which functions at the
           G(sub)2/M boundary [contig 185] FULL
          Length = 697

 Score = 77.8 bits (190), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 71/294 (24%), Positives = 126/294 (42%), Gaps = 31/294 (10%)

Query: 27  YLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVV 86
           +L  GGFA+ + +            VA   ++ +  + +   L +E+   + +++   +V
Sbjct: 84  FLGEGGFARCFQIKDDGGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMRHTN-IV 139

Query: 87  SYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVA 146
            ++D              V++L+E C  G L+D +  R    L E E+    +Q+   V 
Sbjct: 140 QFVDCF-------EDDTNVYILLEICPNGSLMDLLKRR--KMLTEPEVRFFTTQIVGAVK 190

Query: 147 AMHALQPPLIHRDIKIENVLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTT 206
            MH+ +  +IHRD+K+ N+    +   K+ DFG    +     N +E  Y         T
Sbjct: 191 YMHSRR--VIHRDLKLGNIFFDKHYNLKVGDFGLAAVLA----NDRERKYTV-----CGT 239

Query: 207 AQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAIL-----SGKFEF 261
             Y +PE++   +      + DIW+ G+ +Y L     PF+   E  I+      G F F
Sbjct: 240 PNYIAPEVL-TGKHTGHSYEVDIWSCGVMIYALLIGKPPFQ-AKEVNIIYERIKCGDFVF 297

Query: 262 PLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQNVPCPINDIQTVQAP 315
           P     S +   LI+DIL  +P  RPS+ +++  +      P  I+      AP
Sbjct: 298 PKDKFISPEALVLIKDILSIDPLERPSLDEIIDYVWFRGLFPSRIDASVLTSAP 351

>Kwal_26.8709 s26 (907885..910374) [2490 bp, 829 aa] {ON} YPL141C -
           Hypothetical ORF [contig 67] FULL
          Length = 829

 Score = 77.8 bits (190), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 60/219 (27%), Positives = 108/219 (49%), Gaps = 30/219 (13%)

Query: 97  ILQNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLI 156
           +LQN  Y + +++EY   G    ++  +   RL E    ++ +Q+  GV  MH+    L+
Sbjct: 113 VLQNSKY-IGIVLEYASGGEFYKYIQKK--RRLKEGPACRLFAQLISGVYYMHSKG--LV 167

Query: 157 HRDIKIENVLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTTAQ--YRSPEM 214
           HRD+K+EN+L+  N    + DFG V     LP N         +++K +     Y +PE+
Sbjct: 168 HRDLKLENLLLDKNENLLITDFGFVNEF--LPEN---------ELMKTSCGSPCYAAPEL 216

Query: 215 IDIFRGLPID-EKSDIWALGIFLYKLCYYTTPFEKGGEPAILS--GKF-----EFPL-YP 265
           +   R  P +  K+D+W+ G+ LY +     P++   E       GK        PL +P
Sbjct: 217 VVTAR--PYEARKADVWSCGVILYAMLAGYLPWDDDPENPDGDDIGKLYRYITRTPLKFP 274

Query: 266 NYSEQL-KSLIRDILVQNPCHRPSVFQLLKRISIMQNVP 303
           +Y   + + L+R+IL+ +P  R ++ + LK   +  ++P
Sbjct: 275 DYIAPVPRDLLREILIPDPKRRITISKTLKHQWLQPHMP 313

>TPHA0E03850 Chr5 complement(810694..812142) [1449 bp, 482 aa] {ON}
           Anc_1.24 YDR523C
          Length = 482

 Score = 77.0 bits (188), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 60/201 (29%), Positives = 102/201 (50%), Gaps = 18/201 (8%)

Query: 105 VFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIEN 164
           ++++MEYC  G   D +       + E ++  I+    +G+  +H  +   IHRDIK  N
Sbjct: 86  MWIVMEYCGGGSCADLIKMVYSKGIPESKVSYILRDTVKGLKYLHDQKK--IHRDIKAAN 143

Query: 165 VLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDI-FRGLPI 223
           +L++   + KL DFG V G IR     +  ++V        T  + +PE+I+   +G   
Sbjct: 144 ILLTDCGKVKLGDFG-VSGQIR--ATMKRGTFV-------GTPYWMAPEVINKQCKGY-- 191

Query: 224 DEKSDIWALGIFLYKLCYYTTPFEKGGEPAILSG--KFEFP-LYPNYSEQLKSLIRDILV 280
           +EK+DIW+LGI  Y+L     P  K     ++    K + P L+  YSE+ K  +   L+
Sbjct: 192 NEKADIWSLGITAYELLKGVPPLSKYDPFKVMLNIPKRKPPKLHGQYSEKAKYFVSLCLI 251

Query: 281 QNPCHRPSVFQLLKRISIMQN 301
           ++P  RPS+  LL+   ++ N
Sbjct: 252 KDPKQRPSIEALLETDFLLPN 272

>KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakly
           similar to uniprot|P34244 Saccharomyces cerevisiae
           YKL101W HSL1 Nim1p-related protein kinase that regulates
           the morphogenesis and septin checkpoints associates with
           the assembled septin filament required along with Hsl7p
           for bud neck recruitment phosphorylation and degradation
           of Swe1p
          Length = 1128

 Score = 77.8 bits (190), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 76/298 (25%), Positives = 130/298 (43%), Gaps = 55/298 (18%)

Query: 6   IGTYNVGTRLTVGSH-QVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIVPDKP 64
           IG + +G  L  GS  +V + K + +G  A   +V I P    +  N             
Sbjct: 55  IGPWKLGKTLGKGSSGRVRLAKNMETGKLA---AVKIVPKTKSSRPNALPY--------- 102

Query: 65  SLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFMNTR 124
               +  E+  M+L+ +   +  Y        + +N   E+F+++EY + G L D++ +R
Sbjct: 103 ---GIEREIIIMKLISHPNVMGLY-------EVWEN-KLELFLVLEYVDGGELFDYLVSR 151

Query: 125 LQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNE-YKLCDFGSVCG 183
              RL E E +    Q+ +G A  H+    + HRD+K EN+L+   N+  K+ DFG    
Sbjct: 152 --GRLSEKEAIHYFRQIIEGTAYCHSFN--ICHRDLKPENLLLDKKNKRIKIADFGMAA- 206

Query: 184 IIRLPRNSQELSYVQQDILKNT--TAQYRSPEMI--DIFRGLPIDEKSDIWALGIFLYKL 239
                            +L+ +  +  Y SPE++    + G P    SD+W+ GI L+ L
Sbjct: 207 -----------LQTSNKLLETSCGSPHYASPEIVMGKTYNGGP----SDVWSCGIILFAL 251

Query: 240 CYYTTPFEKGGEPAIL----SGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLL 293
                PF       +L    +GK++ P     S + + LI  ILV +P  R ++  +L
Sbjct: 252 LTGHLPFNDDNIKRLLLKVQAGKYQMPQA--ISLEAQDLISRILVVDPNKRITINDIL 307

>CAGL0H06259g Chr8 (615045..619055) [4011 bp, 1336 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017w FUN31
          Length = 1336

 Score = 77.8 bits (190), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 58/192 (30%), Positives = 88/192 (45%), Gaps = 33/192 (17%)

Query: 99   QNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHR 158
            + GS ++F L+E+              +  + E E   +  QV  GV  +H     ++HR
Sbjct: 1166 ETGSIDLFDLIEF--------------KTNMTEIEAKLLFKQVVSGVKHLH--DQGIVHR 1209

Query: 159  DIKIENVLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIF 218
            DIK EN+++ +    K+ DFGS   +   P           D+   T   Y +PE   + 
Sbjct: 1210 DIKDENIIVDSQGFVKIIDFGSAAYVKSGPF----------DVFVGTI-DYAAPE---VL 1255

Query: 219  RGLPIDEK-SDIWALGIFLYKLCYYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRD 277
             G P + K  DIWA+GI LY + +   PF    E  IL G+ +F      SEQ  +LI  
Sbjct: 1256 GGSPYEGKPQDIWAIGILLYTIVFKENPFYNIDE--ILEGELKFNSSELVSEQCTTLIAK 1313

Query: 278  ILVQNPCHRPSV 289
            IL +N   RP++
Sbjct: 1314 ILNRNVQKRPTI 1325

>KLTH0D10714g Chr4 (880389..883007) [2619 bp, 872 aa] {ON} similar
           to uniprot|Q03002 Saccharomyces cerevisiae YPL141C
           Hypothetical ORF
          Length = 872

 Score = 77.8 bits (190), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 61/219 (27%), Positives = 106/219 (48%), Gaps = 30/219 (13%)

Query: 97  ILQNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLI 156
           +LQN  Y + +++EY   G    ++  +   RL E    ++ +Q+  GV  MH+    L+
Sbjct: 113 VLQNSKY-IGIVLEYASGGEFYKYIQKK--RRLKESAACRLFAQLISGVYYMHSKG--LV 167

Query: 157 HRDIKIENVLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTTAQ--YRSPEM 214
           HRD+K+EN+L+  N    + DFG V     LP N         +++K +     Y +PE+
Sbjct: 168 HRDLKLENLLLDKNENLLITDFGFVNEF--LPEN---------ELMKTSCGSPCYAAPEL 216

Query: 215 IDIFRGLPID-EKSDIWALGIFLYKLCYYTTPFEKGGEPAILS--GKF-----EFPL-YP 265
           +   R  P +  K+DIW+ G+ +Y +     P++   E       GK        PL +P
Sbjct: 217 VVTAR--PYEARKADIWSCGVIMYAMLAGYLPWDDDPENPDGDDIGKLYRYITRTPLKFP 274

Query: 266 NYSEQL-KSLIRDILVQNPCHRPSVFQLLKRISIMQNVP 303
           +Y   + + L+R ILV +P  R ++ Q L    +  ++P
Sbjct: 275 DYIAPVPRDLLRAILVADPKKRITIAQTLHHQWLQPHLP 313

>KNAG0F02900 Chr6 (549477..551426) [1950 bp, 649 aa] {ON} 
          Length = 649

 Score = 77.4 bits (189), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 78/322 (24%), Positives = 129/322 (40%), Gaps = 64/322 (19%)

Query: 8   TYNVGTRLTVGSHQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIVPDKPSLN 67
            Y  G+ +  GSH V             VY V  S         V C      P+K +  
Sbjct: 41  VYYRGSEINRGSHSV-------------VYKVFDSEDRIFAGKKVHC------PNKENKR 81

Query: 68  TLRAEVDAMRLL--KNNRYVVSYIDSHAAKAILQNGSYE-VFVLMEYCERGGLIDFMNTR 124
            +  E++  +++   ++ ++V+  D+       Q G    ++++++YC    L   +  R
Sbjct: 82  KIIKELEIYKVICRSHHNHIVALRDA------FQWGKESCIYMILDYCSNNSLQSILQYR 135

Query: 125 LQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGSVCGI 184
               L+E E  +++ Q+  G+  +H     +IH D+K+ N+L     + K+CDFGS    
Sbjct: 136 --GSLNEVECKELMIQLCGGIYWLHL--NNVIHGDLKLSNILFDEGQQLKICDFGSSFIA 191

Query: 185 IRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRG--------LPIDEKSDIWALGIFL 236
              PR   E+           T  Y +PE +   +         L I    DIW++GI L
Sbjct: 192 TSSPRGPGEIM---------GTPYYLAPETVYTHKNINKSGMAILLISFPIDIWSMGIVL 242

Query: 237 YKLCYYTTPFEKGGEPA-----------ILSGKFEFPLYPNYSEQLKSLIRDILVQNPCH 285
           Y L Y   PF K  +             I SG  EFP         + LI  +L QNP  
Sbjct: 243 YSLLYGINPFIKSVDELHNVSLDELMQRITSGVIEFPTNKAVGAGAQQLILKMLSQNPLE 302

Query: 286 RPSVFQLLK----RISIMQNVP 303
           R ++ +++     R +   N P
Sbjct: 303 RITLVEIVCDPWIRFAFTNNAP 324

>CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa]
           {ON} similar to uniprot|Q12263 Saccharomyces cerevisiae
           YDR507c GIN4
          Length = 1103

 Score = 77.8 bits (190), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 59/220 (26%), Positives = 108/220 (49%), Gaps = 32/220 (14%)

Query: 104 EVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIE 163
           ++++++EY E+G L + +  R    L E E ++   Q+  G++  H+L   ++HRD+K E
Sbjct: 103 DLYLVLEYAEKGELFNMLVER--GPLPENEAVRAFRQIIIGISYCHSLG--VVHRDLKPE 158

Query: 164 NVLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTTA---QYRSPEMIDIFRG 220
           N+L+      K+ DFG                   +D L  T+     Y +PE+I    G
Sbjct: 159 NLLLDNKLNIKIADFGMAA-------------LESEDKLLETSCGSPHYAAPEIIS---G 202

Query: 221 LPIDE-KSDIWALGIFLYKLCYYTTPF--EKGGEPAIL----SGKFEFPLYPNYSEQLKS 273
           LP +   SD+W+ G+ L+ L     PF  E G    +L     G+FE P     +++ + 
Sbjct: 203 LPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPDDDEITKEAQD 262

Query: 274 LIRDILVQNPCHRPSVFQLLKRISIMQNVPCPINDIQTVQ 313
           L+  +L  +P  R ++ ++LK   ++Q  P  I D ++++
Sbjct: 263 LLARLLTVDPSKRITIREILKH-PLLQKYPS-IKDSRSIR 300

>NDAI0C01700 Chr3 complement(367077..370139) [3063 bp, 1020 aa] {ON}
           Anc_5.406
          Length = 1020

 Score = 77.4 bits (189), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 62/221 (28%), Positives = 97/221 (43%), Gaps = 38/221 (17%)

Query: 101 GSY----EVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLI 156
           GSY     ++++MEYC  G L   +      ++ E  I  I  ++   +  +H  +  +I
Sbjct: 106 GSYLKDTSLWIIMEYCAGGSLRTLLR---PGKIDEKYIGVITREILIALKYIH--KDNII 160

Query: 157 HRDIKIENVLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMID 216
           HRDIK  NVLI+     KLCDFG    + +  +  Q ++          T  + +PE+  
Sbjct: 161 HRDIKAANVLITNEGSIKLCDFGVAAQLNQSTKRRQTMA---------GTPYWMAPEV-- 209

Query: 217 IFRGLPIDEKSDIWALGIFLYKLCYYTTPFEK-----------GGEPAILSGKFEFPLYP 265
           I  G+  D K DIW+LGI  Y++     P+ +             +P  L G+       
Sbjct: 210 IMEGVYYDTKVDIWSLGITTYEIATGNPPYCEIEALRAMQLITKSKPPRLEGR------- 262

Query: 266 NYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQNVPCPI 306
           NYS  LK  +   L ++P  R S   LLK   I  +   P+
Sbjct: 263 NYSPLLKEFVALCLDEDPKERMSAEDLLKTKFIKAHKLTPV 303

>Kpol_1031.10 s1031 (25064..28447) [3384 bp, 1127 aa] {ON}
           (25064..28447) [3384 nt, 1128 aa]
          Length = 1127

 Score = 77.4 bits (189), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 60/209 (28%), Positives = 94/209 (44%), Gaps = 38/209 (18%)

Query: 101 GSY----EVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLI 156
           GSY     ++++MEYC  G L   +   +   + E  I  I+ ++   +  +H  +  +I
Sbjct: 108 GSYLQDTNLWIIMEYCAGGSLRTLLRPGM---IDEKYIGVIMRELLTALQCIH--KDNVI 162

Query: 157 HRDIKIENVLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMID 216
           HRDIK  NVLI+   + KLCDFG    + +     Q ++          T  + +PE+  
Sbjct: 163 HRDIKAANVLITNEGKVKLCDFGVAAQLNQTSLRRQTMA---------GTPYWMAPEV-- 211

Query: 217 IFRGLPIDEKSDIWALGIFLYKLCYYTTPFEK-----------GGEPAILSGKFEFPLYP 265
           I  G+  D K DIW+LGI  Y++     P+ +             +PA L G+       
Sbjct: 212 IMEGVYYDTKVDIWSLGITAYEIATGNPPYCEIEALRAMQLITKSKPARLEGR------- 264

Query: 266 NYSEQLKSLIRDILVQNPCHRPSVFQLLK 294
            YS  LK  I   L ++P  R S  +L K
Sbjct: 265 QYSSGLKEFIALCLDEDPKERLSAEELQK 293

>ACL104C Chr3 complement(157357..160200) [2844 bp, 947 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR102W
           (KIC1)
          Length = 947

 Score = 77.4 bits (189), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 59/208 (28%), Positives = 92/208 (44%), Gaps = 38/208 (18%)

Query: 101 GSY----EVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLI 156
           GSY    +++V+MEYC  G L   +      ++ E  +  I+ ++   +  +H     +I
Sbjct: 89  GSYLYDTKLWVIMEYCAGGSLRTLLRP---GKIDEKYLGVIVRKLLIALVYIHKDN--VI 143

Query: 157 HRDIKIENVLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMID 216
           HRDIK  NVLI+     KLCDFG    +       Q ++          T  + +PE+  
Sbjct: 144 HRDIKAANVLITNEGHVKLCDFGVAAQLTAANHKRQTMA---------GTPYWMAPEV-- 192

Query: 217 IFRGLPIDEKSDIWALGIFLYKLCYYTTPFEK-----------GGEPAILSGKFEFPLYP 265
           I  G+  + K+DIW+LGI  Y++     P+               +P  L G+       
Sbjct: 193 IMEGVYYNTKADIWSLGITAYEIATGNPPYCDVEALRAMQLITKSKPPRLEGR------- 245

Query: 266 NYSEQLKSLIRDILVQNPCHRPSVFQLL 293
           NYS  LK  I   L ++P  RP+   LL
Sbjct: 246 NYSPLLKEFIALCLDEDPEERPTAEDLL 273

>Ecym_2640 Chr2 complement(1232617..1236594) [3978 bp, 1325 aa] {ON}
            similar to Ashbya gossypii ACR281C
          Length = 1325

 Score = 77.4 bits (189), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 57/181 (31%), Positives = 84/181 (46%), Gaps = 21/181 (11%)

Query: 111  YCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTN 170
            + E G +  F    L+  + E+E   +  Q+T GV  +H     ++HRDIK ENV++   
Sbjct: 1153 HGETGSIDLFDLIELKTNMTEYEAKLLFKQITSGVKHLH--DNGIVHRDIKDENVIVDNK 1210

Query: 171  NEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMI--DIFRGLPIDEKSD 228
               KL DFGS   + R P           D+   T   Y +PE++  D + G P     D
Sbjct: 1211 GCVKLIDFGSAAYVKRGPF----------DVFVGTI-DYAAPEVLEGDPYEGKP----QD 1255

Query: 229  IWALGIFLYKLCYYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPS 288
            IWA+G+ LY + Y   PF    E  IL G          SE+  +LI  +L ++   RP+
Sbjct: 1256 IWAIGVLLYTIIYKENPFYNVDE--ILDGDLRINPSVIVSEECVALITMVLDRSLSKRPT 1313

Query: 289  V 289
            V
Sbjct: 1314 V 1314

>Ecym_5505 Chr5 (1027605..1030616) [3012 bp, 1003 aa] {ON} similar
           to Ashbya gossypii ACL104C
          Length = 1003

 Score = 77.0 bits (188), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 57/201 (28%), Positives = 91/201 (45%), Gaps = 34/201 (16%)

Query: 104 EVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIE 163
           +++V+MEYC  G L   +      ++ E  +  I+  +   VA ++  +  +IHRDIK  
Sbjct: 94  KLWVIMEYCAGGSLRTLLR---PGKIDEKYLGVIVRNLL--VALLYIHKDNVIHRDIKAA 148

Query: 164 NVLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPI 223
           NVLI+     KLCDFG    +       Q ++          T  + +PE+  I  G+  
Sbjct: 149 NVLITNGGHVKLCDFGVAAQLTTANHKRQTMA---------GTPYWMAPEV--IMEGVYY 197

Query: 224 DEKSDIWALGIFLYKLCYYTTPFEK-----------GGEPAILSGKFEFPLYPNYSEQLK 272
           + K+DIW+LGI  Y++     P+               +P  L G+       NYS  LK
Sbjct: 198 NTKADIWSLGITTYEIATGNPPYCDVEALRAMQLITKSKPPRLEGR-------NYSPLLK 250

Query: 273 SLIRDILVQNPCHRPSVFQLL 293
             I   L ++P  RP+  +LL
Sbjct: 251 EFIALCLDEDPEARPTAEELL 271

>TPHA0G03290 Chr7 (702953..705874) [2922 bp, 973 aa] {ON} Anc_2.496
           YHL007C
          Length = 973

 Score = 77.0 bits (188), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 66/236 (27%), Positives = 110/236 (46%), Gaps = 47/236 (19%)

Query: 73  VDAMRLLKNNRY--VVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFMNTRLQNRLH 130
           ++ + ++K +R+  +V++IDS+  K        +++V+MEY E G L D +   +   L 
Sbjct: 721 INEIIVMKGSRHENIVNFIDSYLMKG-------DLWVVMEYMEGGSLTDVVTHCI---LT 770

Query: 131 EFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGSVCGIIRLPRN 190
           E +I  +  +   G+A +H+    +IHRDIK +N+L+S N + KL DFG  C  I     
Sbjct: 771 EGQIGTVCKETLGGLAFLHSKG--VIHRDIKSDNILLSMNGDIKLTDFG-FCAQI----- 822

Query: 191 SQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGG 250
             E+   +  ++   T  + +PE++      P   K DIW+LGI + ++          G
Sbjct: 823 -NEVHLKRTTMV--GTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIE--------G 868

Query: 251 EPAILSGKFEFPLY-------------PNYSEQLKSLIRDILVQNPCHRPSVFQLL 293
           EP  L+      LY              N  E LK  +   L  NP  R +  +LL
Sbjct: 869 EPPYLNETPLRALYLIATNGTPQLKDPENLGEILKKFLDWCLTVNPEERATALELL 924

>TBLA0A07460 Chr1 (1848207..1849757) [1551 bp, 516 aa] {ON} Anc_1.24
           YDR523C
          Length = 516

 Score = 76.3 bits (186), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 64/214 (29%), Positives = 107/214 (50%), Gaps = 23/214 (10%)

Query: 84  YVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQ 143
           YV  Y+ +     +L++ S  ++++MEYC  G   D +    +  L E +   I  +V +
Sbjct: 72  YVTKYLTT-----LLEDVS--IWIVMEYCGGGSCADLIKYAYKRGLPENKASFITKEVLK 124

Query: 144 GVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILK 203
           G+  +H  +   IHRDIK  N+L++ +   KL DFG V G I+        + +++D   
Sbjct: 125 GLRYLHEQKK--IHRDIKAANILLTDDGMVKLGDFG-VSGQIK--------ATLKKDTFV 173

Query: 204 NTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAILSG--KFEF 261
             T  + +PE++        +EK+DIW+LGI +Y+L     P  K     ++    K   
Sbjct: 174 G-TPYWMAPEVVKKDES-GYNEKADIWSLGITVYELLKGCPPLAKYDPMKVMISVPKRRA 231

Query: 262 P-LYPNYSEQLKSLIRDILVQNPCHRPSVFQLLK 294
           P L+ +YSE  KS I   L+++P  RP+   L K
Sbjct: 232 PKLHGHYSEDAKSFISHCLIKDPNARPNAKTLSK 265

>KAFR0K00280 Chr11 complement(64906..65988) [1083 bp, 360 aa] {ON}
           Anc_6.222 YPL209C
          Length = 360

 Score = 75.1 bits (183), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 62/204 (30%), Positives = 99/204 (48%), Gaps = 25/204 (12%)

Query: 105 VFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIEN 164
           ++++MEY  +G L   + +      ++      + Q+   +  +H  Q  +IHRDIK EN
Sbjct: 175 IYIVMEYLIQGELYKLLQS--HGPFNDVLASNYVYQIADALDYLH--QKHIIHRDIKPEN 230

Query: 165 VLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPID 224
           +LI  NN  KL DFG    II  P+  +  +          T  Y SPE+I        D
Sbjct: 231 ILIGFNNTVKLTDFG--WSIIN-PKGIRRKTLC-------GTIDYLSPEIIT---SKEYD 277

Query: 225 EKSDIWALGIFLYKLCYYTTPFEKGGEPA----ILSGKFEFPLY-PNYSEQLKSLIRDIL 279
              DIWALG+  Y+L   +  FE+  +      I+ G+ +FP + PN    ++ LI+ IL
Sbjct: 278 HTVDIWALGVLAYELVVGSPAFEEETKEMTYKRIVKGELKFPEHLPNI---VRDLIQRIL 334

Query: 280 VQNPCHRPSVFQLLKRISIMQNVP 303
           V  P  R S+ ++ +   I++N P
Sbjct: 335 VIEPSKRMSLKEIKRHPWILKNKP 358

>Kpol_2002.46 s2002 (95107..98478) [3372 bp, 1123 aa] {ON}
           (95107..98478) [3372 nt, 1124 aa]
          Length = 1123

 Score = 77.0 bits (188), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 61/219 (27%), Positives = 106/219 (48%), Gaps = 32/219 (14%)

Query: 105 VFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIEN 164
           +++++EY E+G L + +  +    L E E ++   Q+  G++  HAL   ++HRD+K EN
Sbjct: 104 LYMVLEYAEKGELFNLLVEK--GPLPENEAIRFFRQIIIGMSYCHALG--IVHRDLKPEN 159

Query: 165 VLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTTA---QYRSPEMIDIFRGL 221
           +L+      K+ DFG                   +D L  T+     Y +PE++    GL
Sbjct: 160 ILLDHKLNIKIADFGMAA-------------LETEDKLLETSCGSPHYAAPEIVS---GL 203

Query: 222 PIDE-KSDIWALGIFLYKLCYYTTPF--EKGGEPAIL----SGKFEFPLYPNYSEQLKSL 274
           P    ++D+W+ G+ L+ L     PF  E G    +L     G+FE P     S++ + L
Sbjct: 204 PYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPGDDEISKEAQDL 263

Query: 275 IRDILVQNPCHRPSVFQLLKRISIMQNVPCPINDIQTVQ 313
           +  ILV +P  R    ++LK   ++Q  P  I D +T++
Sbjct: 264 LYKILVVDPEKRIKSREILKH-PLLQKYPS-IKDSKTIR 300

>Kwal_47.18307 s47 complement(776521..778386) [1866 bp, 621 aa] {ON}
           YDR466W - Hypothetical ORF [contig 196] FULL
          Length = 621

 Score = 76.3 bits (186), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 63/194 (32%), Positives = 97/194 (50%), Gaps = 22/194 (11%)

Query: 105 VFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIEN 164
           ++ ++EY   G L+  +  RL  RL E     I +Q+   V  MH+    +IHRD+K EN
Sbjct: 87  LYFVLEYVSGGELLALIQ-RL-GRLTEDLSRHITAQLVDTVDYMHSKG--VIHRDLKPEN 142

Query: 165 VLISTNNEYKLCDFGSVCGII--RLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLP 222
           VL+S      + DFG+ C     +     +  S+V        TA+Y SPE++   +   
Sbjct: 143 VLLSQEGRVVITDFGAACTAADRKFENTKRTASFV-------GTAEYVSPELLLHSQ--- 192

Query: 223 IDEKSDIWALGIFLYKLCYYTTPFEKGGE----PAILSGKFEFPLYPNYSEQLKSLIRDI 278
               SDIWALG  +Y+L     PF    E      I++  +++ L+ N S Q+ S+++ I
Sbjct: 193 CGFSSDIWALGCIIYQLNQGKPPFRGENELQTFEKIVALDYKW-LFSN-SPQVVSIVQSI 250

Query: 279 LVQNPCHRPSVFQL 292
           LV +P  RPS  QL
Sbjct: 251 LVTDPLKRPSAAQL 264

>CAGL0G04609g Chr7 complement(437162..440059) [2898 bp, 965 aa] {ON}
           similar to uniprot|Q12236 Saccharomyces cerevisiae
           YOL100w PKH2
          Length = 965

 Score = 76.6 bits (187), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 73/296 (24%), Positives = 134/296 (45%), Gaps = 28/296 (9%)

Query: 28  LTSGGFAQVYSVLISPPDPHTNTNVACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVVS 87
           L  G ++QV+ +  S  D      V  L +  +  +  +  +  E  A++ LK+   V++
Sbjct: 124 LGDGSYSQVF-LATSKTDSSKTYAVKVLNKEYLIKQKKVKYVNIEKTALQNLKSVTGVIN 182

Query: 88  YIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAA 147
              +   +A L       + L+EY   G  +  +  +    L+E   +   +Q+   + +
Sbjct: 183 LSFTFQDEANL-------YFLLEYAPNGDFLSLI--KKFGTLNEECTIYYSAQIIDAIGS 233

Query: 148 MHALQPPLIHRDIKIENVLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNT-- 205
           MH+    +IHRDIK EN+L+  N + KL DFG+      L + S +      ++L  +  
Sbjct: 234 MHSHG--IIHRDIKPENILLDGNMKIKLTDFGTAK---LLQKKSDKNGKPHYNLLTRSSS 288

Query: 206 ---TAQYRSPEMI-DIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAILSG--KF 259
              TA+Y SPE++ D +     D K DIWA G  +Y++     PF+   E        K 
Sbjct: 289 FVGTAEYVSPELLSDNY----TDYKCDIWAFGCLVYQMIAGKPPFKATNEYLTFQKVMKV 344

Query: 260 EFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQNVPCPINDIQTVQAP 315
           +F     +   ++ L+++ILV+ P  R ++ Q +K   + +N+    N +     P
Sbjct: 345 QFAFTAGFPTIIRDLVKNILVKQPEKRLTIPQ-IKEHCLFENINFSDNSVWNRDPP 399

>Kpol_1040.20 s1040 (57057..60950) [3894 bp, 1297 aa] {ON}
            (57057..60950) [3894 nt, 1298 aa]
          Length = 1297

 Score = 77.0 bits (188), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 54/176 (30%), Positives = 79/176 (44%), Gaps = 20/176 (11%)

Query: 116  GLIDFMN-TRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYK 174
            G ID  +    +  + E E   I  QV   +  +H     ++HRDIK ENV++ +    K
Sbjct: 1129 GCIDLFDLIEFKTNMSEVETKLIFMQVVSSIKFLH--DQGIVHRDIKDENVIVDSQGFIK 1186

Query: 175  LCDFGSVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLP-IDEKSDIWALG 233
            L DFGS   +   P           D+   T   Y +PE   +  G P + +  DIWA+G
Sbjct: 1187 LIDFGSAAYVKSGPF----------DVFVGTI-DYAAPE---VLGGEPYVGKPQDIWAIG 1232

Query: 234  IFLYKLCYYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSV 289
            I LY + +   PF    E  IL  + +F       E    LI+ IL +NP  RP++
Sbjct: 1233 ILLYTIIFKENPFYNIDE--ILEAELKFNTSTGACEDCVDLIKRILTRNPTKRPTI 1286

>Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {ON}
           YPL150W - Hypothetical ORF [contig 67] FULL
          Length = 848

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 58/203 (28%), Positives = 98/203 (48%), Gaps = 39/203 (19%)

Query: 105 VFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIEN 164
           V++ +EYC    L +++  +    L E    ++ SQ+   V   H+++   +HRD+K+EN
Sbjct: 103 VWMALEYCPGKELYEYLLAKKHIPLEECS--ELFSQIVGAVYYAHSMK--CVHRDLKLEN 158

Query: 165 VLISTNNEYKLCDFG-----SVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDI-- 217
           +L+      KL DFG     +  GI+              + +  TT  Y +PE+I+   
Sbjct: 159 ILLDKKGHAKLTDFGFTRECATKGIL--------------ETICGTTV-YMAPELIERKP 203

Query: 218 FRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAILSGKFEFPLY-PNYSEQL----- 271
           + G  I    D W+LGI LY + + T PF++  E   +  K++   Y P Y         
Sbjct: 204 YEGYKI----DTWSLGIILYTMIHGTMPFDEVDE---VKTKYKIVHYNPTYDNDYIDSNG 256

Query: 272 KSLIRDILVQNPCHRPSVFQLLK 294
           K LI  +L ++P  RPS+ Q+L+
Sbjct: 257 KELISQLLEKDPNQRPSLTQVLQ 279

>TDEL0C06490 Chr3 complement(1191461..1194922) [3462 bp, 1153 aa]
           {ON} Anc_1.52 YDR507C
          Length = 1153

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 61/219 (27%), Positives = 103/219 (47%), Gaps = 32/219 (14%)

Query: 105 VFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIEN 164
           +++++EY ++G L + +  R    L E E ++   Q+  G++  HAL   ++HRD+K EN
Sbjct: 107 LYMVLEYAQKGELFNLLVER--GPLPEKEAIRFFRQIVIGISYCHALG--IVHRDLKPEN 162

Query: 165 VLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTTA---QYRSPEMIDIFRGL 221
           +L+      K+ DFG                   +D L  T+     Y +PE++    G+
Sbjct: 163 LLLDHKFNIKIADFGMAA-------------LETEDKLLETSCGSPHYAAPEIVS---GI 206

Query: 222 PIDE-KSDIWALGIFLYKLCYYTTPF--EKGGEPAIL----SGKFEFPLYPNYSEQLKSL 274
           P     SD+W+ G+ L+ L     PF  E G    +L    SG++E P     S   + L
Sbjct: 207 PYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEMPGDDEISPDAQDL 266

Query: 275 IRDILVQNPCHRPSVFQLLKRISIMQNVPCPINDIQTVQ 313
           I  IL  +P  R     +LK   ++Q  P  IND ++++
Sbjct: 267 IARILTVDPEQRIKARDILKH-PLLQKYPS-INDSKSIR 303

>NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {ON}
           Anc_8.668
          Length = 883

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 56/195 (28%), Positives = 97/195 (49%), Gaps = 23/195 (11%)

Query: 104 EVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIE 163
           +V++  EYC    L D +   LQ R+     +++ +Q+   V   H+L    +HRD+K+E
Sbjct: 103 KVWMAQEYCPGKDLYDHV-LSLQ-RVPSSACIELFTQIVGAVYYAHSLN--CVHRDLKLE 158

Query: 164 NVLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMI--DIFRGL 221
           N+L+  N   KL DFG            + ++    + +  TT  Y +PE+I  + + G 
Sbjct: 159 NILLDKNGNAKLTDFGFT---------RECMTKTSLETICGTTV-YMAPELIKRESYDGF 208

Query: 222 PIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAILSGKF-EFPLYPN--YSEQLKSLIRDI 278
            I    DIW+LG+ LY +   + PF++  E         E P++ +   SE  K L+  +
Sbjct: 209 KI----DIWSLGVILYTMLNGSMPFDEDDETKTEWKIMNEMPVFNDTILSEDAKDLLIKL 264

Query: 279 LVQNPCHRPSVFQLL 293
           L ++P  RPS+ ++L
Sbjct: 265 LSKDPNERPSMQEIL 279

>TBLA0B02310 Chr2 (539362..541821) [2460 bp, 819 aa] {ON} Anc_3.92
           YDR490C
          Length = 819

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 50/188 (26%), Positives = 88/188 (46%), Gaps = 18/188 (9%)

Query: 105 VFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIEN 164
           ++ ++EY   G L+  +  R    L         +Q+   + A+H++   +IHRDIK EN
Sbjct: 219 LYFVLEYAPHGDLLALL--RRHGSLSRAVTCHYAAQLLSAIGALHSVG--VIHRDIKPEN 274

Query: 165 VLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKN--TTAQYRSPEMIDIFRGLP 222
           VL+ ++   KL DFG+      LP+    L  V + +  +   TA+Y  PE++       
Sbjct: 275 VLLDSHYRAKLTDFGTAA---LLPQTHSNLEQVSRHVTTSFVGTAEYVPPELLAAGHA-- 329

Query: 223 IDEKSDIWALGIFLYKLCYYTTPFEKGGE----PAILSGKFEFPLYPNYSEQLKSLIRDI 278
            D   D+WA    +++L     PF+   E      +++ ++ +P  P +   LK L+R +
Sbjct: 330 -DGTCDLWAWACVVFQLIAGRPPFQARNEFLTFQNVMAVRYTYP--PGFPSDLKDLLRRV 386

Query: 279 LVQNPCHR 286
           L   P  R
Sbjct: 387 LRHEPRQR 394

>NDAI0A03870 Chr1 (867910..870597) [2688 bp, 895 aa] {ON} Anc_2.496
          Length = 895

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 63/218 (28%), Positives = 112/218 (51%), Gaps = 34/218 (15%)

Query: 31  GGFAQVYSVLISPPDPHTNTNVACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVVSYID 90
           GG A VY+      +  TN +VA +K++ +  +P    +  E+  M+  ++   +V++ID
Sbjct: 622 GGSALVYTAY----EVGTNLSVA-IKQINLEKQPRKQLILNEIIVMKKSQHPN-IVNFID 675

Query: 91  SHAAKAILQNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHA 150
           S+     L +G  +++V+MEY E G L D +   +   L E +I  +  +V +G+  +H+
Sbjct: 676 SY-----LVDG--KLWVIMEYMEAGSLTDVVTRCI---LREGQIGAVCREVLKGLVFLHS 725

Query: 151 LQPPLIHRDIKIENVLISTNNEYKLCDFGSVCGI--IRLPRNSQELSYVQQDILKNTTAQ 208
               +IHRDIK +NVL+S + + KL DFG    +  I L RN+              T  
Sbjct: 726 --KGVIHRDIKSDNVLLSMDGDIKLTDFGFCAQLNDIHLKRNTMV-----------GTPY 772

Query: 209 YRSPEMIDIFRGLPIDEKSDIWALGIFLYKLCYYTTPF 246
           + +PE+++     P   K DIW+LG+ + ++     P+
Sbjct: 773 WMAPEIVEKKHYCP---KVDIWSLGVMIIEMIEGEPPY 807

>Skud_8.163 Chr8 (290415..293645) [3231 bp, 1076 aa] {ON} YHR102W
           (REAL)
          Length = 1076

 Score = 76.3 bits (186), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 60/209 (28%), Positives = 91/209 (43%), Gaps = 38/209 (18%)

Query: 101 GSY----EVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLI 156
           GSY     +++LMEYC  G L   +      ++ E  I  I+ ++   +  +H     +I
Sbjct: 87  GSYLKDTSLWILMEYCAGGSLRSLLRP---GKIDEKYIGVIMRELLVALKCIHKDN--VI 141

Query: 157 HRDIKIENVLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMID 216
           HRDIK  NVLI+     KLCDFG    + +     Q ++          T  + +PE+  
Sbjct: 142 HRDIKAANVLITNEGSVKLCDFGVAAQVNQTSLRRQTMA---------GTPYWMAPEV-- 190

Query: 217 IFRGLPIDEKSDIWALGIFLYKLCYYTTPFEK-----------GGEPAILSGKFEFPLYP 265
           I  G+  D K DIW+LGI  Y++     P+               +P  L G+       
Sbjct: 191 IMEGVYYDTKVDIWSLGITTYEIATGNPPYCDVEALRAMQLIIKSKPPRLEGR------- 243

Query: 266 NYSEQLKSLIRDILVQNPCHRPSVFQLLK 294
           +YS  LK  I   L ++P  R S   LL+
Sbjct: 244 SYSSSLKEFIALCLDEDPKERLSADDLLR 272

>KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} similar
           to uniprot|P32562 Saccharomyces cerevisiae YMR001C
          Length = 708

 Score = 75.9 bits (185), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 71/302 (23%), Positives = 129/302 (42%), Gaps = 30/302 (9%)

Query: 27  YLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVV 86
           +L  GGFA+ + +            VA L    +  + +   L +E+   + +K+   +V
Sbjct: 95  FLGEGGFARCFQMKDDKGKVFAAKTVAKLS---IKSEKTRRKLLSEIQIHKSMKHPN-IV 150

Query: 87  SYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVA 146
            + D              V++L+E C  G +++ +  R +  L E E+   + Q+   + 
Sbjct: 151 QFTDCFEDDT-------NVYILLEICPNGSVMELL--RQRKHLTEPEVRFCMIQIIGAIR 201

Query: 147 AMHALQPPLIHRDIKIENVLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTT 206
            MH+ +  +IHRD+K+ N+        K+ DFG    +  +  N +E  Y         T
Sbjct: 202 YMHSRR--VIHRDLKLGNIFFDKEYNLKIGDFG----LAAVLANDKERKYTICG-----T 250

Query: 207 AQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAILSG----KFEFP 262
             Y +PE++   +      + DIW++G+ LY L +   PF+      I        F FP
Sbjct: 251 PNYIAPEVL-TGKHTGHSYEVDIWSIGVMLYALLFGKPPFQAKEVETIYERIKCRDFIFP 309

Query: 263 LYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQNVPCPINDIQTVQAPS-SHLNL 321
                S   K+LI  +L  NP  RPS++++   +      P  +    T + P+  HL+ 
Sbjct: 310 ADKPVSSDAKNLISHLLQLNPAARPSLYEITDNVWFRNTFPSRLPSTITKEIPNFDHLSF 369

Query: 322 TE 323
           +E
Sbjct: 370 SE 371

>Skud_4.764 Chr4 complement(1351725..1353995) [2271 bp, 756 aa] {ON}
           YDR490C (REAL)
          Length = 756

 Score = 75.9 bits (185), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 55/196 (28%), Positives = 93/196 (47%), Gaps = 17/196 (8%)

Query: 105 VFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIEN 164
           ++ L+EY   G  +  +  +    L+E       SQ+   V ++HA+   +IHRDIK EN
Sbjct: 199 LYFLLEYASHGDFLGLI--KKYGSLNEKCARYYASQIIDAVDSLHAIG--IIHRDIKPEN 254

Query: 165 VLISTNNEYKLCDFGSVCGIIRLPRNSQELS-----YVQQDILKNTTAQYRSPEMI-DIF 218
           +L+  + + KL DFG+   +   P N+ +       Y +       TA+Y SPE++ D +
Sbjct: 255 ILLDKDMKVKLTDFGTAKILPEQPSNNADGKPCFDLYARSKSFVG-TAEYVSPELLNDSY 313

Query: 219 RGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAILSG--KFEFPLYPNYSEQLKSLIR 276
                D + DIWA G  LY++     PF+   E        K ++     +    K L++
Sbjct: 314 ----TDSRCDIWAFGCILYQMVAGKPPFKAANEYLTFQKVMKIQYAFTAGFPLIAKDLVK 369

Query: 277 DILVQNPCHRPSVFQL 292
            +LV+ P  R +V Q+
Sbjct: 370 KLLVREPNDRLTVEQI 385

>TDEL0E05310 Chr5 (972769..973893) [1125 bp, 374 aa] {ON} Anc_6.222
           YPL209C
          Length = 374

 Score = 74.7 bits (182), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 61/196 (31%), Positives = 88/196 (44%), Gaps = 24/196 (12%)

Query: 104 EVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIE 163
            V++LMEY   G L   +  R     ++      + Q+   +  MH  Q  +IHRD+K E
Sbjct: 188 RVYLLMEYLVNGELYKVLKAR--GPFNDIVASHYVYQMADALDFMH--QKNIIHRDVKPE 243

Query: 164 NVLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPI 223
           N+L+   N  KL DFG      R  R                T  Y SPE+I        
Sbjct: 244 NILMGFGNVVKLTDFGWSIISARGVRRKTLCG----------TIDYLSPELIT---SREY 290

Query: 224 DEKSDIWALGIFLYKLCYYTTPFEKGGEPA----ILSGKFEFPLYPNYSEQLKSLIRDIL 279
           D+K D+WALG+  Y+L   + PFE+  + +    I+SG  +FP     S   + LIR +L
Sbjct: 291 DDKVDVWALGVLTYELIVNSPPFEEDSKDSTYKRIVSGDLKFP--DTISSDAQDLIRKLL 348

Query: 280 VQNPCHRPSVFQLLKR 295
                 R S+ Q +KR
Sbjct: 349 RHKAKDRISL-QDVKR 363

>ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL150W
          Length = 851

 Score = 75.9 bits (185), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 59/205 (28%), Positives = 98/205 (47%), Gaps = 43/205 (20%)

Query: 105 VFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIEN 164
           V++ +EYC    L D++   L+ R+   E  ++ +Q+   V   H+LQ   +HRD+K+EN
Sbjct: 103 VWMALEYCPGNELYDYL--LLKQRIPLDETRRLFAQIVSAVFYAHSLQ--CVHRDLKLEN 158

Query: 165 VLISTNNEYKLCDFGSV--CGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMI--DIFRG 220
           +L+  N    L DFG    C            +  Q + +  TT  Y +PE+I  + + G
Sbjct: 159 ILLDKNGYAMLTDFGFTRECA-----------TKTQLETVCGTTV-YMAPELIKREAYDG 206

Query: 221 LPIDEKSDIWALGIFLYKLCYYTTPFEKGG-----------EPAILSGKFEFPLYPNYSE 269
             +    D W+LGI LY + +   PF++             EPA+L    E+      S 
Sbjct: 207 YKV----DTWSLGIILYTMLHGYMPFDEDDTVRTGLKIMHEEPAVLD---EYT-----SP 254

Query: 270 QLKSLIRDILVQNPCHRPSVFQLLK 294
           Q K LI  +L +N   RP++ ++L+
Sbjct: 255 QAKDLIVRLLDKNAAQRPNLNEVLQ 279

>NCAS0C04120 Chr3 complement(840008..842755) [2748 bp, 915 aa] {ON}
           Anc_8.140
          Length = 915

 Score = 75.9 bits (185), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 70/264 (26%), Positives = 117/264 (44%), Gaps = 44/264 (16%)

Query: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQN-GSYEVFVLMEYCERGGLID 119
           P +   N ++ E+  M+   NN++VV  I+      IL +  S ++++++EYCE+G ++ 
Sbjct: 136 PKRNDPNKIKKEIAIMKKC-NNKHVVKLIE------ILDDLSSRKIYLVLEYCEKGPILW 188

Query: 120 F------MNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEY 173
                  +++R   +L      +I   V  G+  +H+    +IHRDIK  N+L+  N   
Sbjct: 189 CPRDQLEIDSRGPPQLSFQRAREIFRDVILGLEYLHS--QGIIHRDIKPANLLMDKNGVV 246

Query: 174 KLCDFG-SVCGIIRLPRNSQELS----------YVQQDILKNTTAQYRSPEMIDIFRGLP 222
           K+ DFG S+     +  N  EL           Y  +  L     +  + +  ++F G  
Sbjct: 247 KISDFGVSLAANGNIDTNDDELELTKTVGTPVFYAPEICLGAAAMERFNLDKDELFNGSC 306

Query: 223 IDEKSDIWALGIFLYKLCYYTTPFEKGGE----PAILSGKFEFPLYPNYSE--------- 269
           I  K DIWALGI LY L +   PF    E      I++ K  FP +    +         
Sbjct: 307 ISFKIDIWALGITLYCLLFGMLPFVSEFELKLFEKIVNEKLRFPTFETLQDNHISEISHI 366

Query: 270 ----QLKSLIRDILVQNPCHRPSV 289
                 K L+  +L +NP  R S+
Sbjct: 367 REFVHAKDLLNKLLEKNPAKRISI 390

>YCL024W Chr3 (79162..82275) [3114 bp, 1037 aa] {ON}  KCC4Protein
           kinase of the bud neck involved in the septin
           checkpoint, associates with septin proteins, negatively
           regulates Swe1p by phosphorylation, shows structural
           homology to bud neck kinases Gin4p and Hsl1p
          Length = 1037

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 56/198 (28%), Positives = 93/198 (46%), Gaps = 28/198 (14%)

Query: 105 VFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIEN 164
           +++++EY E+G L + +       L E E +    Q+  G++  HAL   ++HRD+K EN
Sbjct: 102 LYLILEYAEKGELFNLLVD--HGPLPEREAINCFRQIIIGISYCHALG--IVHRDLKPEN 157

Query: 165 VLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNT--TAQYRSPEMIDIFRGLP 222
           +L+ +    K+ DFG                    D+L+ +  +  Y +PE++    GLP
Sbjct: 158 LLLDSFYNIKIADFGMAA------------LQTDADLLETSCGSPHYAAPEIVS---GLP 202

Query: 223 IDE-KSDIWALGIFLYKLCYYTTPF--EKGGEPAIL----SGKFEFPLYPNYSEQLKSLI 275
            +   SD+W+ G+ L+ L     PF  E G    +L     G+FE P     S   + LI
Sbjct: 203 YEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTEISRDAQDLI 262

Query: 276 RDILVQNPCHRPSVFQLL 293
             ILV +P  R  +  +L
Sbjct: 263 GKILVVDPRQRIKIRDIL 280

>KLTH0C09548g Chr3 (792218..795199) [2982 bp, 993 aa] {ON} similar
           to uniprot|Q12236 YOL100W Saccharomyces cerevisiae
           YOL100W PKH2 Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis
          Length = 993

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 54/194 (27%), Positives = 97/194 (50%), Gaps = 14/194 (7%)

Query: 105 VFVLMEYCERGGLIDFMNT-RLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIE 163
           ++ L+EY   G   DF++  +    L++   +   +Q+   +  +H  Q  +IHRDIK E
Sbjct: 237 LYFLLEYAPNG---DFLSVIKKYGSLNQDCSVYYSAQILDAIDYLH--QKGVIHRDIKPE 291

Query: 164 NVLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMI-DIFRGLP 222
           N+L+  + + KL DFG+   ++     +Q  + +++      TA+Y SPE++ D +    
Sbjct: 292 NILLDKDMKVKLTDFGT-AKLVEKDETTQTYNLLERSKSFVGTAEYVSPELLNDNY---- 346

Query: 223 IDEKSDIWALGIFLYKLCYYTTPFEKGGEPAILSG--KFEFPLYPNYSEQLKSLIRDILV 280
           +D K DIWA G  L+++     PF+   E        K ++     +   ++ LI+ ILV
Sbjct: 347 VDYKCDIWAFGCILFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPLIIRDLIKQILV 406

Query: 281 QNPCHRPSVFQLLK 294
           +NP  R    Q+ K
Sbjct: 407 KNPEQRLDTLQVKK 420

>YOL045W Chr15 (243497..246802) [3306 bp, 1101 aa] {ON}  PSK2One of
            two (see also PSK1) PAS domain containing S/T protein
            kinases; regulates sugar flux and translation in response
            to an unknown metabolite by phosphorylating Ugp1p and
            Gsy2p (sugar flux) and Caf20p, Tif11p and Sro9p
            (translation)
          Length = 1101

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 55/184 (29%), Positives = 86/184 (46%), Gaps = 21/184 (11%)

Query: 111  YCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTN 170
            + E G +  F     +  + E E   +  QV   +  +H     ++HRDIK ENV++ ++
Sbjct: 929  HGETGSIDLFDVIEFKKDMVEHEAKLVFKQVVASIKHLH--DQGIVHRDIKDENVIVDSH 986

Query: 171  NEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMI--DIFRGLPIDEKSD 228
               KL DFGS   I   P           D+    T  Y +PE++    ++G P     D
Sbjct: 987  GFVKLIDFGSAAYIKSGPF----------DVFVG-TMDYAAPEVLGGSSYKGKP----QD 1031

Query: 229  IWALGIFLYKLCYYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPS 288
            IWALG+ LY + Y   P+    E  IL G+  F    + SE+  SLI+ IL +    RP+
Sbjct: 1032 IWALGVLLYTIIYKENPYYNIDE--ILEGELRFDKSEHVSEECISLIKRILTREVDKRPT 1089

Query: 289  VFQL 292
            + ++
Sbjct: 1090 IDEI 1093

>Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045W -
            Hypothetical ORF [contig 47] FULL
          Length = 1213

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 54/179 (30%), Positives = 82/179 (45%), Gaps = 20/179 (11%)

Query: 116  GLIDFMN-TRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYK 174
            G ID  +   ++  + E E + I  Q+  G+  +H     ++HRDIK ENV++  N   K
Sbjct: 1045 GSIDLFDLIEMKTDMTEHEAMLIFKQIASGIKNLH--DNGIVHRDIKDENVIVDCNGFVK 1102

Query: 175  LCDFGSVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEK-SDIWALG 233
            + DFGS   +   P           D+   T   Y +PE   +  G P + K  DIWA+G
Sbjct: 1103 IVDFGSAAYVKSGPF----------DVFVGTI-DYAAPE---VLGGEPYEGKPQDIWAIG 1148

Query: 234  IFLYKLCYYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQL 292
            + LY + Y   PF    E  IL            S+   +LIR IL ++   RPS+ ++
Sbjct: 1149 VLLYTIIYKENPFYNIDE--ILDADLRVNSSERISDDCIALIRKILNRSVSKRPSIDEI 1205

>TPHA0E02820 Chr5 complement(589816..590970) [1155 bp, 384 aa] {ON}
           Anc_6.222 YPL209C
          Length = 384

 Score = 74.3 bits (181), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 62/218 (28%), Positives = 95/218 (43%), Gaps = 47/218 (21%)

Query: 102 SYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIK 161
           S  V+++MEY   G L   +  +     ++      + Q+T  +  +H  +  +IHRD+K
Sbjct: 196 SKRVYLIMEYIYNGELYSIL--KKNGPFNDIVASNFVFQLTNAIRYLH--KKRIIHRDLK 251

Query: 162 IENVLISTNNEYKLCDFG------------SVCGIIRLPRNSQELSYVQQDILKNTTAQY 209
            EN+LI  NN  K+ DFG            ++CG                      T  Y
Sbjct: 252 PENILIDFNNVIKITDFGWSVYNEAGNKRKTLCG----------------------TIDY 289

Query: 210 RSPEMIDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGE----PAILSGKFEFPLYP 265
            SPE+I+       D   D+WALGI  Y+L   T PFE+  +      I +    FP + 
Sbjct: 290 LSPELIN---SKEYDGLIDVWALGIIAYELIVGTPPFEEDTKELTYKRIKNCDLNFPAH- 345

Query: 266 NYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQNVP 303
             S+  K+LI  +L  NP  R ++  +LK   I +N P
Sbjct: 346 -VSQDAKNLISSLLKLNPSERITLTDVLKHPWINKNKP 382

>SAKL0G01848g Chr7 (154547..157204) [2658 bp, 885 aa] {ON} weakly
           similar to uniprot|P38692 Saccharomyces cerevisiae
           YHR102W KIC1 Protein kinase of the PAK/Ste20 kinase
           family required for cell integrity possibly through
           regulating 1 6-beta-glucan levels in the wall physically
           interacts with Cdc31p (centrin) which is a component of
           the spindle pole body
          Length = 885

 Score = 75.5 bits (184), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 70/259 (27%), Positives = 113/259 (43%), Gaps = 50/259 (19%)

Query: 101 GSY----EVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLI 156
           GSY    +++++MEYC  G L   +      ++ E  I  I+ ++   VA ++  +  +I
Sbjct: 90  GSYLYDTKLWIIMEYCAGGSLRTLLR---PGKIDEKYIGVIMRELL--VALLYIHKDNVI 144

Query: 157 HRDIKIENVLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMID 216
           HRDIK  NVLI+ +   KLCDFG    + +        S V++  +   T  + +PE+  
Sbjct: 145 HRDIKAANVLITNDGRVKLCDFGVAAQLTQ--------SNVRRQTMAG-TPYWMAPEV-- 193

Query: 217 IFRGLPIDEKSDIWALGIFLYKLCYYTTPFEK-----------GGEPAILSGKFEFPLYP 265
           I  G+  D K DIW+LGI  Y++     P+               +P  L G+       
Sbjct: 194 IMEGVYYDTKVDIWSLGITTYEITTGNPPYCDVEALRAMQLITKSKPPRLEGR------- 246

Query: 266 NYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQNVPCPINDI------------QTVQ 313
            YS  LK  I   L ++P  R +   LLK   I  +   P + +            + + 
Sbjct: 247 QYSPLLKEFIALCLDEDPKERLAAEDLLKTRFIKTHKSSPTSILKELITRYLLHRDKNIN 306

Query: 314 APSSHLNLTELHQLSATQN 332
             S+  NL +  Q+  TQN
Sbjct: 307 RESAMANLEDDEQIKGTQN 325

>Skud_1.44 Chr1 (95573..99643) [4071 bp, 1356 aa] {ON} YAL017W (REAL)
          Length = 1356

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 55/177 (31%), Positives = 82/177 (46%), Gaps = 22/177 (12%)

Query: 116  GLIDFMN-TRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYK 174
            G ID  +    +  + EFE   I  QV  G+  +H     ++HRDIK ENV++ +    K
Sbjct: 1188 GCIDLFDLIEFKTNMTEFEAKLIFKQVVAGIKHLH--DQGIVHRDIKDENVIVDSKGFVK 1245

Query: 175  LCDFGSVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMI--DIFRGLPIDEKSDIWAL 232
            + DFGS   +   P           D+   T   Y +PE++  + + G P     DIWA+
Sbjct: 1246 IIDFGSAAYVKSGPF----------DVFVGTI-DYAAPEVLGGNPYEGQP----QDIWAI 1290

Query: 233  GIFLYKLCYYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSV 289
            GI LY + +   PF    E  IL G  +F      SE    LI+ IL +   +RP++
Sbjct: 1291 GILLYTVVFKENPFYNIDE--ILEGDLKFNNAEEVSEDCIELIKSILNRRVPNRPTI 1345

>KNAG0L00520 Chr12 (79786..80892) [1107 bp, 368 aa] {ON} Anc_7.86
           YAL017W
          Length = 368

 Score = 73.9 bits (180), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 54/174 (31%), Positives = 82/174 (47%), Gaps = 21/174 (12%)

Query: 117 LIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLC 176
           L DF++ R  + + ++E   II Q+   +  +H     ++HRDIK EN+++      +L 
Sbjct: 204 LFDFIDIR--DEVSDWECKLIIKQLVSAIKYLH--DRDIVHRDIKDENIIMDARGHIQLI 259

Query: 177 DFGSVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLP-IDEKSDIWALGIF 235
           DFGS    +R P  +              T  Y  PE   + RG P + +  DIWALGI 
Sbjct: 260 DFGSATNAVRGPFRT-----------FLGTIDYEPPE---VARGEPFLGKPQDIWALGIL 305

Query: 236 LYKLCYYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSV 289
           LY L +   PF    + AIL+G  +FP   + +     LI  IL      RP++
Sbjct: 306 LYILRFKEPPFLD--QKAILTGDLKFPQGTSVNTDCIDLINAILSPRVDERPTI 357

>SAKL0A04246g Chr1 complement(396019..397221) [1203 bp, 400 aa] {ON}
           similar to uniprot|P38991 Saccharomyces cerevisiae
           YPL209C IPL1 Aurora kinase involved in regulating
           kinetochore-microtubule attachments associates with
           Sli5p which stimulates Ipl1p kinase activity and
           promotes its association with the mitotic spindle
           potential Cdc28p substrate
          Length = 400

 Score = 74.3 bits (181), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 63/205 (30%), Positives = 94/205 (45%), Gaps = 25/205 (12%)

Query: 104 EVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIE 163
            V++LMEY   G L  + + R+    ++      ++Q+   +  MH     ++HRDIK E
Sbjct: 212 RVYLLMEYLVNGEL--YRHLRVNGPFNDILASYYVNQMADALNYMHDRN--VLHRDIKPE 267

Query: 164 NVLISTNNEYKLCDFG-SVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLP 222
           N+LI   N  KL DFG SV       R +              T  Y SPE++  +R   
Sbjct: 268 NILIGFQNTLKLTDFGWSVISTTGAKRKTL-----------CGTLDYLSPELVK-YREY- 314

Query: 223 IDEKSDIWALGIFLYKLCYYTTPFEKGGE----PAILSGKFEFPLYPNYSEQLKSLIRDI 278
            DEK D+WALG+  Y+L   T PFE+  +      I+     FP     S   + LI  +
Sbjct: 315 -DEKVDVWALGVLAYELLVGTPPFEEASKELTYKRIVRRDLRFP--DQMSIDARDLIGRL 371

Query: 279 LVQNPCHRPSVFQLLKRISIMQNVP 303
           L  +P  R S+  +L    I++N P
Sbjct: 372 LENDPSTRISLKDVLSHPWIVKNKP 396

>YCR073C Chr3 complement(242588..246583) [3996 bp, 1331 aa] {ON}
            SSK22MAP kinase kinase kinase of the HOG1
            mitogen-activated signaling pathway; functionally
            redundant with, and homologous to, Ssk2p; interacts with
            and is activated by Ssk1p; phosphorylates Pbs2p
          Length = 1331

 Score = 75.5 bits (184), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 75/291 (25%), Positives = 131/291 (45%), Gaps = 48/291 (16%)

Query: 27   YLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIVPDKPSLNTL----RAEVDAMRLLKNN 82
            ++  G F QVYS +        N  +  +K + + D  ++  +    + E+  + +L + 
Sbjct: 1039 FIGGGTFGQVYSAI-----NLENGEILAVKEIKIHDTTTMKKIFPLIKEEMTVLEMLNHP 1093

Query: 83   RYVVSY-IDSHAAKAILQNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIIS-Q 140
              V  Y ++ H  K         V + MEYCE G L   ++     R+ +  + Q+ + +
Sbjct: 1094 NIVQYYGVEVHRDK---------VNIFMEYCEGGSLASLLD---HGRIEDEMVTQVYTFE 1141

Query: 141  VTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGSVCGII----RLPRNSQELSY 196
            + +G+A +H  Q  ++HRDIK EN+L+  N   K  DFG+   ++    R  RN+    +
Sbjct: 1142 LLEGLAYLH--QSGVVHRDIKPENILLDFNGIIKYVDFGTARTVVGSRTRTVRNAAVQDF 1199

Query: 197  -VQQDILKNT--TAQYRSPEMIDIFRGLPIDEK---SDIWALGIFLYKLCYYTTPFEK-G 249
             V+   L     T  Y +PE I    G  +  K    D+WALG  + ++     P+    
Sbjct: 1200 GVETKSLNEMMGTPMYMAPETIS---GSAVKGKLGADDVWALGCVVLEMATGRRPWSNLD 1256

Query: 250  GEPAIL----SGKFEFPLYPNYSEQL---KSLIRDILVQNPCHRPSVFQLL 293
             E AI+    +G+   P  PN  E     ++ +   LVQ+P  R +  +LL
Sbjct: 1257 NEWAIMYHVAAGR--IPQLPNRDEMTAAGRAFLERCLVQDPTMRATAVELL 1305

>KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa]
           {ON} 
          Length = 1009

 Score = 75.5 bits (184), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 61/198 (30%), Positives = 100/198 (50%), Gaps = 27/198 (13%)

Query: 104 EVFVLMEYCERGGLIDFMNTRLQ-NRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKI 162
           +V++ +EYC    L D +   LQ  R+   E +Q+ SQ+   V   H+L    +HRD+K+
Sbjct: 111 KVWMALEYCPGRELYDHV---LQMKRIPAEECIQLFSQIVGAVYYAHSLN--CVHRDLKL 165

Query: 163 ENVLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDI--FRG 220
           EN+L+  +   KL DFG         R   E   V  + +  TT  Y +PE+ +   + G
Sbjct: 166 ENILLDKDGNAKLTDFG-------FTRECME--KVNLETICGTTV-YMAPELTERKPYDG 215

Query: 221 LPIDEKSDIWALGIFLYKLCYYTTPFEKGGEPAILSGKF--EFPLYPN--YSEQLKSLIR 276
             I    DIW+LG+ LY +   + PF++  E A    K   E P Y +   + + + L+R
Sbjct: 216 FKI----DIWSLGVILYTMLSGSMPFDEDDE-AKTKWKIINEEPEYNSKFMTAEGEDLVR 270

Query: 277 DILVQNPCHRPSVFQLLK 294
            +L ++   RPSV ++L+
Sbjct: 271 KLLQKDSNLRPSVREILQ 288

>KAFR0A03730 Chr1 (761946..764312) [2367 bp, 788 aa] {ON} Anc_8.654
           YPL141C
          Length = 788

 Score = 75.1 bits (183), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 65/243 (26%), Positives = 113/243 (46%), Gaps = 40/243 (16%)

Query: 97  ILQNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLI 156
           +LQN  Y + +++EY   G    ++  +   RL E    ++ +Q+  GV  MH+    L+
Sbjct: 106 VLQNSKY-IGIVLEYASGGEFYKYIQKK--RRLKEPIACKLFAQLVSGVYYMHSKG--LV 160

Query: 157 HRDIKIENVLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTTAQ---YRSPE 213
           HRD+K+EN+L+  N    + DFG V              ++Q + L  T+     Y +PE
Sbjct: 161 HRDLKLENLLLDKNENLIITDFGFVN------------EFLQNNELMKTSCGSPCYAAPE 208

Query: 214 MIDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFE------KGGEPA-----ILSGKFEFP 262
           ++ +        K+D+W+ GI L+ +     P++      +G + A     I +   +FP
Sbjct: 209 LV-VTSNPYKARKADVWSCGIILFAMLAGYLPWDDDPDNPRGDDIAKLYNYITTSPLKFP 267

Query: 263 LYPNYSEQLKSLIRDILVQNPCHRPSV-----FQLLK-RISIMQNVPCPINDIQTVQAPS 316
            Y   S   + L+R ILV NP  R S+      Q LK   S ++  P   +D+  ++A  
Sbjct: 268 SY--ISAIPRDLLRKILVANPNQRLSLREIETHQWLKPHSSFLKISPKEWDDVMKLKADP 325

Query: 317 SHL 319
           S +
Sbjct: 326 SKI 328

>Smik_4.367 Chr4 (655941..659141) [3201 bp, 1066 aa] {ON} YDR122W
           (REAL)
          Length = 1066

 Score = 75.5 bits (184), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 78/306 (25%), Positives = 133/306 (43%), Gaps = 57/306 (18%)

Query: 102 SYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIK 161
           S   ++L EY   G L+D++       + E +  +    +   +  +HA    ++HRD+K
Sbjct: 214 SNHFYMLFEYVSGGQLLDYIIQ--HGSIREHQARKFARGIASALMYLHANN--IVHRDLK 269

Query: 162 IENVLISTNNEYKLCDFG------------SVCGIIRLPRNSQELSYVQQDILKNTTAQY 209
           IEN++IS ++E K+ DFG            + CG          L +   ++LK     Y
Sbjct: 270 IENIMISDSSEIKIIDFGLSNLYDSRKQLHTFCG---------SLYFAAPELLK--AHPY 318

Query: 210 RSPEMIDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGG----EPAILSGKFEFPLYP 265
             PE+             D+W+ G+ L+ L     PF+          I  GK E+P + 
Sbjct: 319 TGPEV-------------DVWSFGVVLFVLVCGKVPFDDENSSVLHEKIKQGKVEYPQH- 364

Query: 266 NYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQ--NVPCPINDIQTVQAPSSHLN--- 320
             S ++ SL+  +LV +P  R ++ Q+++   +++  N P P    + V      LN   
Sbjct: 365 -LSIEVISLLSKMLVVDPKRRATLKQVVEHHWMVRGFNAPPPSYLPKRVPLTIETLNTNV 423

Query: 321 LTELHQLSATQNIQSLNSHLVMGNSIPTTAF---QFSTPVNMATAQTLPIKEESNI---F 374
           L E+++L    +++   S LV   S PT      Q+ T V  A A++   +   NI   F
Sbjct: 424 LKEMYRLEFIDDVEETRSVLVSIISDPTYVLLSRQYWTLVAKARAESSDNESVPNITESF 483

Query: 375 YDPTSC 380
            DPT  
Sbjct: 484 EDPTRA 489

>KNAG0K02370 Chr11 complement(475088..477739) [2652 bp, 883 aa] {ON}
           Anc_3.60 YNL298W
          Length = 883

 Score = 75.1 bits (183), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 54/198 (27%), Positives = 97/198 (48%), Gaps = 26/198 (13%)

Query: 54  CLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCE 113
            +K++I+  +P    +  E+  M+  K+ + +V++I+S+           +++V+MEY E
Sbjct: 633 AIKQMILSKQPRKELIVNEIHVMKDSKH-KNIVNFIESYL------KTEDDLWVVMEYME 685

Query: 114 RGGLIDFM-----NTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLIS 168
            G L D +     N    + L E +I  I+ +  QG+  +H     +IHRDIK +NVL+ 
Sbjct: 686 GGSLTDIIENSPTNGSTHSPLTEPQIAYIVRETCQGLKFLHDKH--IIHRDIKSDNVLLD 743

Query: 169 TNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSD 228
           T+   K+ DFG  C  +   RN +             T  + +PE++   +    DEK D
Sbjct: 744 THARVKITDFG-FCAKLTDQRNKRATMV--------GTPYWMAPEVV---KQREYDEKVD 791

Query: 229 IWALGIFLYKLCYYTTPF 246
           +W+LGI   ++     P+
Sbjct: 792 VWSLGIMAIEMLESEPPY 809

>Kpol_1044.3 s1044 (4910..5845,5849..7711) [2799 bp, 932 aa] {ON}
           (4910..5845,5849..7711) [2799 nt, 933 aa]
          Length = 932

 Score = 75.1 bits (183), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 55/179 (30%), Positives = 87/179 (48%), Gaps = 23/179 (12%)

Query: 117 LIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLC 176
           L DF+  +  +++ E E   I  Q+  G+  +H L   +IHRDIK EN++I +    ++ 
Sbjct: 766 LFDFIEKK--DKIDEVEQKLIFKQIVAGIKHIHGL--GIIHRDIKTENIIIDSEGCVQVI 821

Query: 177 DFGSVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEK-SDIWALGIF 235
           DFGS       P             + + T  Y SPE   + +G P + K  D+WALGI 
Sbjct: 822 DFGSAAYATNGPFQ-----------VFHGTIDYASPE---VLKGEPYEGKPQDVWALGIL 867

Query: 236 LYKLCYYTTPFEKGGEPAILSGKFEF-PLY-PNYSEQLKSLIRDILVQNPCHRPSVFQL 292
           LY + +  TPF    E  I+  + E  P +  N S+Q + LI  +L +    RP + ++
Sbjct: 868 LYIITFKQTPFNSVAE--IIENELEIDPAHSENVSDQCRVLIHKMLDKKAWARPKISEI 924

>Suva_16.382 Chr16 (673009..674205) [1197 bp, 398 aa] {ON} YPR054W
           (REAL)
          Length = 398

 Score = 73.9 bits (180), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 65/238 (27%), Positives = 107/238 (44%), Gaps = 14/238 (5%)

Query: 1   MNQPQIGTYNVGTRLTVGSHQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIV 60
           +  PQ  T     R+++  +  EII++L  G +  V SV      P     V  +  +  
Sbjct: 26  LGPPQERTIFAKERISIPGY-YEIIQFLGKGAYGTVCSVKFKGQTPPAKIAVKKISNIFN 84

Query: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDF 120
            +      +R E+  M   K ++ +V+ ID     +   +G Y    L++Y     L   
Sbjct: 85  KEILLKRAIR-ELKFMNFFKGHKNIVNLIDLEIVSSSPYDGLYCYQELIDY----DLAKV 139

Query: 121 MNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGS 180
           +++ +Q  L EF I   + Q+  G+  +H+    +IHRD+K  N+L + N   K+CDFG 
Sbjct: 140 IHSSVQ--LSEFHIKYFLYQILCGLKYIHSAD--VIHRDLKPGNILCTLNGCLKICDFGL 195

Query: 181 VCGIIRLPRNSQELSYVQQDILKNTTA--QYRSPEMIDIFRGLPIDEKSDIWALGIFL 236
             GI       Q  +   Q  + N  A   YR+PE+  +    P D+  DIWA+G  L
Sbjct: 196 ARGIHTEFFQCQTTNSAVQPHITNYVATRWYRAPEL--LLSNQPYDKAIDIWAVGCIL 251

>Smik_8.180 Chr8 (292993..296214) [3222 bp, 1073 aa] {ON} YHR102W
           (REAL)
          Length = 1073

 Score = 75.1 bits (183), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 59/209 (28%), Positives = 91/209 (43%), Gaps = 38/209 (18%)

Query: 101 GSY----EVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLI 156
           GSY     ++++MEYC  G L   +      ++ E  I  I+ ++   +  +H     +I
Sbjct: 87  GSYLKDTSLWIIMEYCAGGSLRSLLRP---GKIDEKYIGVIMRELLVALKCIHKDN--VI 141

Query: 157 HRDIKIENVLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMID 216
           HRDIK  NVLI+     KLCDFG    + +     Q ++          T  + +PE+  
Sbjct: 142 HRDIKAANVLITNEGNVKLCDFGVAAQVNQTSLRRQTMA---------GTPYWMAPEV-- 190

Query: 217 IFRGLPIDEKSDIWALGIFLYKLCYYTTPFEK-----------GGEPAILSGKFEFPLYP 265
           I  G+  D K DIW+LGI  Y++     P+               +P  L G+       
Sbjct: 191 IMEGVYYDTKVDIWSLGITTYEIATGNPPYCDVEALRAMQLIIKSKPPRLEGR------- 243

Query: 266 NYSEQLKSLIRDILVQNPCHRPSVFQLLK 294
           +YS  LK  I   L ++P  R S   LL+
Sbjct: 244 SYSPSLKEFIALCLDEDPKERLSADDLLR 272

>KNAG0B04320 Chr2 complement(821265..824348) [3084 bp, 1027 aa] {ON}
           Anc_5.406 YHR102W
          Length = 1027

 Score = 75.1 bits (183), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 66/244 (27%), Positives = 107/244 (43%), Gaps = 41/244 (16%)

Query: 62  DKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFM 121
           D+  +  ++ E+  +  LK    V  Y  S+     L+N S  ++++MEYC  G L   +
Sbjct: 77  DEDEVEDVQREIQFLASLKQLPNVTRYYGSY-----LKNTS--LWIIMEYCAGGSLRSLL 129

Query: 122 NTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGSV 181
                 ++ E  I  I+ ++   +  +H     +IHRDIK  NVLI+     KLCDFG  
Sbjct: 130 R---PGKIDEKYIGVIMRELLVALKFIHKDN--IIHRDIKAANVLITNEGGVKLCDFGVA 184

Query: 182 CGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLCY 241
             + +     Q ++          T  + +PE+  I  G+  D K DIW+LGI  Y++  
Sbjct: 185 AQLNQRTLRRQTMA---------GTPYWMAPEV--IMEGVYYDTKVDIWSLGITAYEIST 233

Query: 242 YTTPFEK-----------GGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVF 290
              P+               +P  L G+       NY+  +K  I   L ++P  R S  
Sbjct: 234 GNPPYCDVEALRAMQLITKSKPPRLEGR-------NYTPLIKEFIALCLDEDPNERLSAD 286

Query: 291 QLLK 294
           +LLK
Sbjct: 287 ELLK 290

>NCAS0B01470 Chr2 (241003..243186) [2184 bp, 727 aa] {ON} Anc_8.654
          Length = 727

 Score = 74.7 bits (182), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 57/212 (26%), Positives = 101/212 (47%), Gaps = 34/212 (16%)

Query: 97  ILQNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLI 156
           +LQN  Y + +++EY   G    ++  +   RL E    ++ +Q+  GV+ MH+    ++
Sbjct: 114 VLQNSKY-IGIVLEYASGGEFYKYVQRK--RRLKEATACRLFAQLISGVSYMHS--KGIV 168

Query: 157 HRDIKIENVLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTTAQ--YRSPEM 214
           HRD+K+EN+L+  +    + DFG V              Y   +++K +     Y +PE+
Sbjct: 169 HRDLKLENLLLDKHENLIITDFGFVNEF-----------YADNELMKTSCGSPCYAAPEL 217

Query: 215 I---DIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEK-----GGEPAILSGKF--EFPL- 263
           +   + ++      K+DIW+ GI LY +     P++       GE  +    +  + PL 
Sbjct: 218 VITTEPYKA----RKADIWSCGIILYGMLAGYLPWDDDKQNPNGEDIVRLYHYITKTPLK 273

Query: 264 YPNYSEQL-KSLIRDILVQNPCHRPSVFQLLK 294
           +P Y   L + L+R ILV NP  R S   + K
Sbjct: 274 FPEYITPLPRDLLRHILVSNPVRRMSSRHIKK 305

>ACR281C Chr3 complement(864528..868307) [3780 bp, 1259 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YOL045W and
            YAL017W (FUN31)
          Length = 1259

 Score = 75.1 bits (183), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 55/181 (30%), Positives = 83/181 (45%), Gaps = 21/181 (11%)

Query: 111  YCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTN 170
            + E G +  F    L+  + E E   +  QV  G+  +H  +  ++HRDIK ENV++   
Sbjct: 1087 HGETGSIDLFDLIELKTNMTEHEAKLLFKQVASGLRHLH--ENGIVHRDIKDENVIVDNR 1144

Query: 171  NEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMI--DIFRGLPIDEKSD 228
               K+ DFGS   + R P           D+   T   Y +PE++  D + G P     D
Sbjct: 1145 GRVKIIDFGSAAYVKRGPF----------DVFVGTI-DYAAPEVLGGDPYEGKP----QD 1189

Query: 229  IWALGIFLYKLCYYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPS 288
            +WA+G+ LY + Y   PF    E  IL G          SE+  +LI  IL ++   RP+
Sbjct: 1190 VWAVGVLLYTIIYKENPFYNIDE--ILDGDLRISPAVVVSEECVALITRILNRSVNRRPT 1247

Query: 289  V 289
            V
Sbjct: 1248 V 1248

>SAKL0B09856g Chr2 complement(830531..834355) [3825 bp, 1274 aa] {ON}
            similar to uniprot|P31374 Saccharomyces cerevisiae
            YAL017W PSK1 One of two (see also PSK2) PAS domain
            containing S/T protein kinases coordinately regulates
            protein synthesis and carbohydrate metabolism and storage
            in response to a unknown metabolite that reflects
            nutritional status
          Length = 1274

 Score = 75.1 bits (183), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 63/231 (27%), Positives = 102/231 (44%), Gaps = 29/231 (12%)

Query: 66   LNTLRAEVDAMRLL--KNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFMNT 123
            L T+ +E+  M  L  K +  +++ +D        ++  Y       + E G +  F   
Sbjct: 1061 LGTIPSEIQIMATLNKKPHENILTLLD------FFEDDDYYYIETPMHGETGSIDLFDLI 1114

Query: 124  RLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGSVCG 183
             L+  + E E   I  QV  G+  +H     ++HRDIK EN+++      KL DFGS   
Sbjct: 1115 ELKTNMTEHEAKLIFKQVASGIKHLH--DNGIVHRDIKDENIIVDNKGFVKLIDFGSAAY 1172

Query: 184  IIRLPRNSQELSYVQQDILKNTTAQYRSPEMI--DIFRGLPIDEKSDIWALGIFLYKLCY 241
            +   P           D+   T   Y +PE++  D + G P     DIWA+G+ LY + +
Sbjct: 1173 VKSGPF----------DVFVGTI-DYAAPEVLGGDPYEGKP----QDIWAIGVLLYTIIF 1217

Query: 242  YTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQL 292
               PF    E  IL G          SE+  +LIR IL ++   RP++ ++
Sbjct: 1218 KENPFYNIDE--ILDGDLRISSSVTVSEECIALIRRILNRSVPKRPTIEEI 1266

>TBLA0B03970 Chr2 complement(904167..907793) [3627 bp, 1208 aa] {ON}
           Anc_8.654 YPL141C
          Length = 1208

 Score = 75.1 bits (183), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 58/212 (27%), Positives = 100/212 (47%), Gaps = 34/212 (16%)

Query: 97  ILQNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLI 156
           +LQN  Y + +++EY   G    ++  + + RL E     + SQ+  GV  MH     L+
Sbjct: 145 VLQNSKY-IGIVLEYASGGEFYKYI--QKKRRLKESVASNLFSQLVSGVYYMHCKG--LV 199

Query: 157 HRDIKIENVLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTTAQ--YRSPEM 214
           HRD+K+EN+L+       + DFG V    +             +++K +     Y +PE+
Sbjct: 200 HRDLKLENLLLDKYGNLIITDFGFVNEFSKF-----------SELMKTSCGSPCYAAPEL 248

Query: 215 IDIFRGLPID-EKSDIWALGIFLYKLCYYTTPFE------KGGEPA-----ILSGKFEFP 262
           +   R  P +  K+DIW+ GI L+ +     P++       G + A     I +   +FP
Sbjct: 249 VISTR--PYEARKADIWSCGIILFAMLAGYLPWDDDPKNPDGNDIAKLYKYITTTPLKFP 306

Query: 263 LYPNYSEQLKSLIRDILVQNPCHRPSVFQLLK 294
            Y   S   + L+R+IL+  P  R ++ Q+LK
Sbjct: 307 EY--ISPMARDLLRNILIPYPQKRATLKQILK 336

>TDEL0D05320 Chr4 complement(965082..968255) [3174 bp, 1057 aa] {ON}
           Anc_3.92 YDR490C
          Length = 1057

 Score = 75.1 bits (183), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 59/229 (25%), Positives = 110/229 (48%), Gaps = 28/229 (12%)

Query: 72  EVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHE 131
           E +A++ L N+R +V    +   ++ L       + L+EY   G  +  M  +    L+E
Sbjct: 215 EKNALQRLNNSRGIVKLYFTFQDESSL-------YFLLEYAPNGDFLSIM--KKYGSLNE 265

Query: 132 FEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGSVCGIIRLPRNS 191
                  +Q+   +  +H+    ++HRDIK EN+L+  + + KL DFG+    I  P+ +
Sbjct: 266 DCACYYSAQIIDAIDFLHSKG--IVHRDIKPENILLDKDFKVKLTDFGTAK--ILEPKPN 321

Query: 192 QELSYVQQDILKNT-----TAQYRSPEMI-DIFRGLPIDEKSDIWALGIFLYKLCYYTTP 245
              SY   D+L  +     TA+Y SPE++ D +    +D + DIWA G  L+++     P
Sbjct: 322 TTDSY---DLLSRSKSFVGTAEYVSPELLNDNY----VDYRCDIWAFGCILFQMIAGKPP 374

Query: 246 FEKGGEPAILSG--KFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQL 292
           F+   E        K ++     +   ++ L++ IL++ P  R ++ Q+
Sbjct: 375 FKATNEYLTFQKVMKVQYAFTAGFPLVVRDLVKGILIKQPAQRLTIPQI 423

>Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 aa]
           {ON} YDR507C (REAL)
          Length = 1024

 Score = 75.1 bits (183), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 56/200 (28%), Positives = 98/200 (49%), Gaps = 32/200 (16%)

Query: 105 VFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIEN 164
           +++++EY E+G L + +  R    L E E ++   Q+   ++  HAL   ++HRD+K EN
Sbjct: 94  LYLILEYAEKGELFNLLVDR--GPLPEKEAVKCFRQIIIAISYCHALG--IVHRDLKPEN 149

Query: 165 VLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQD--ILKNTTA--QYRSPEMIDIFRG 220
           +L+  +   K+ DFG              ++ +Q D  +L+ +     Y +PE++    G
Sbjct: 150 LLLDNDYNIKIADFG--------------MAALQTDARLLETSCGSPHYAAPEIVS---G 192

Query: 221 LPIDE-KSDIWALGIFLYKLCYYTTPFEK--GGEPAIL----SGKFEFPLYPNYSEQLKS 273
           LP     SD+W+ G+ L+ L     PF++  G    +L     G+FE P     S+  ++
Sbjct: 193 LPYRGFASDVWSCGVILFALLTGRLPFDEDNGNVRDLLLKVQRGQFEMPDATEISKDAQN 252

Query: 274 LIRDILVQNPCHRPSVFQLL 293
           LI  ILV +P  R     +L
Sbjct: 253 LISRILVVDPTQRMKTRDIL 272

>ZYRO0A06446g Chr1 complement(513126..515957) [2832 bp, 943 aa] {ON}
           weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 943

 Score = 74.7 bits (182), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 64/244 (26%), Positives = 102/244 (41%), Gaps = 41/244 (16%)

Query: 62  DKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFM 121
           D+  +  ++ EV  +  +K    +  Y  S+     L       ++++EYC  G L   +
Sbjct: 65  DEDEVEDVQREVQFLASMKQTPNITHYYGSYLKDTTL-------WIIIEYCAGGSLRTLL 117

Query: 122 NTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGSV 181
                 ++ E  I  I+ +V   +  +H     +IHRDIK  NVLI+     KLCDFG  
Sbjct: 118 R---PGKIDEKYIGIIMREVLIALKYIHKDN--VIHRDIKAANVLITNEGHVKLCDFGVA 172

Query: 182 CGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLCY 241
             + +     Q ++          T  + +PE+  I  G+  D K DIW+LGI  Y++  
Sbjct: 173 AQLNQSSLKRQTMA---------GTPYWMAPEV--IMEGVSYDTKVDIWSLGITTYEIAT 221

Query: 242 YTTPFEK-----------GGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVF 290
              P+               +P  L G+       +YS  LK  I   L ++P  R S  
Sbjct: 222 GNPPYCDVEALRAMQLITKSKPPRLEGR-------HYSPMLKEFIALCLDEDPKERLSAD 274

Query: 291 QLLK 294
            LLK
Sbjct: 275 DLLK 278

>NCAS0A05570 Chr1 (1093653..1096409) [2757 bp, 918 aa] {ON}
           Anc_6.371
          Length = 918

 Score = 74.7 bits (182), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 75/290 (25%), Positives = 120/290 (41%), Gaps = 35/290 (12%)

Query: 15  LTVGSHQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVA--CLKRVIVPDKPSLNTLRAE 72
           +TVG    E IK L  G   +VY V     +  TN   A     +  +  +  +  + AE
Sbjct: 512 ITVGPQSFEKIKLLGQGDVGKVYLVR----EKKTNRLYALKIFSKSEMIKRKKIKRILAE 567

Query: 73  VDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEF 132
            + +    N+ +VV+   S  ++  L       +  MEYC  G     + TR    + E 
Sbjct: 568 QEIL-ATSNHPFVVTLYHSFQSEDYL-------YFCMEYCMGGEFFRALQTRRTKCISED 619

Query: 133 EILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFG----SVCGIIRLP 188
           +     S+VT  +  +H L    I+RD+K EN+L+  +    L DF     +    + + 
Sbjct: 620 DARFYASEVTAALEYLHLLG--FIYRDLKPENILLHKSGHIMLSDFDLSVQAKDAKVPVM 677

Query: 189 RNSQELSYVQQDILKNT--------TAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLC 240
           + S E + V   I  +         T +Y +PE+I   RG       D W LGI +Y++ 
Sbjct: 678 KGSAESTVVDTKICSDGFRTNSFVGTEEYIAPEVI---RGNGHTAAVDWWTLGILIYEML 734

Query: 241 YYTTPFEKGGE----PAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHR 286
           +  TPF+          IL     FP   + S   K LI+ +L +N   R
Sbjct: 735 FGFTPFKGSSSNETFSNILKNDVSFPNNNDISRNCKDLIKKLLCKNEAKR 784

>Smik_1.50 Chr1 (103132..107205) [4074 bp, 1357 aa] {ON} YAL017W
            (REAL)
          Length = 1357

 Score = 74.7 bits (182), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 55/177 (31%), Positives = 81/177 (45%), Gaps = 22/177 (12%)

Query: 116  GLIDFMN-TRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYK 174
            G ID  +    +  + EFE   I  QV  G+  +H     ++HRDIK ENV++ +    K
Sbjct: 1189 GCIDLFDLIEFKTNMTEFEAKLIFKQVVAGIKHLH--DQGIVHRDIKDENVIVDSKGFVK 1246

Query: 175  LCDFGSVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMI--DIFRGLPIDEKSDIWAL 232
            + DFGS   +   P           D+   T   Y +PE++  + + G P     DIWA+
Sbjct: 1247 IIDFGSAAYVKSGPF----------DVFVGTI-DYAAPEVLGGNPYEGQP----QDIWAI 1291

Query: 233  GIFLYKLCYYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSV 289
            GI LY + +   PF    E  IL G  +F      SE    LI+ IL +    RP++
Sbjct: 1292 GILLYTVVFKENPFYNIDE--ILEGDLKFNNAEGVSEDCIELIKSILNRCVPKRPTI 1346

>SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {ON}
           weakly similar to uniprot|Q03002 Saccharomyces
           cerevisiae YPL141C Hypothetical ORF
          Length = 919

 Score = 74.7 bits (182), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 56/210 (26%), Positives = 100/210 (47%), Gaps = 34/210 (16%)

Query: 97  ILQNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLI 156
           +LQN  Y + +++EY   G    ++  +   RL E    ++ +Q+  GV  MH+    L+
Sbjct: 116 VLQNSKY-IGIVLEYASGGEFYRYIQKK--RRLKEHAACRLFAQLISGVHYMHSKG--LV 170

Query: 157 HRDIKIENVLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTTAQ--YRSPEM 214
           HRD+K+EN+L+  N    + DFG V           E ++ + +++K +     Y +PE+
Sbjct: 171 HRDLKLENLLLDKNENLLITDFGFV----------NEFNH-KNELMKTSCGSPCYAAPEL 219

Query: 215 IDIFRGLPID-EKSDIWALGIFLYKLCYYTTPFEKGGEPA-----------ILSGKFEFP 262
           +   +  P +  K+DIW+ G+ +Y +     P++   E             I     +FP
Sbjct: 220 VVTTK--PYEARKADIWSCGVIMYAMLAGYLPWDDDSENPEGDDIAKLYHYITKTPLKFP 277

Query: 263 LYPNYSEQLKSLIRDILVQNPCHRPSVFQL 292
            Y N     + L+R ILV NP  R ++ Q+
Sbjct: 278 EYIN--PVPRDLLRRILVSNPKKRLNLRQV 305

>CAGL0J03872g Chr10 (368472..370457) [1986 bp, 661 aa] {ON} similar
           to uniprot|Q01919 Saccharomyces cerevisiae YOR233w KIN4
           ser/thr protein kinase or and similar to uniprot|Q03002
           Saccharomyces cerevisiae YPL141c
          Length = 661

 Score = 74.3 bits (181), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 56/201 (27%), Positives = 98/201 (48%), Gaps = 28/201 (13%)

Query: 97  ILQNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLI 156
           +LQN  Y + +++EY   G    ++  + + RL E    ++ +Q+  GV  MH+    L+
Sbjct: 121 VLQNSKY-IGIVLEYASGGEFYKYI--QRKRRLKESTACRLFAQLISGVTYMHSKN--LV 175

Query: 157 HRDIKIENVLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTTAQ--YRSPEM 214
           HRD+K+EN+L+  N    + DFG V     LP N         + +K +     Y +PE+
Sbjct: 176 HRDLKLENLLLDKNENLVITDFGFVNEF--LPDN---------EYMKTSCGSPCYAAPEL 224

Query: 215 IDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGG---EPAILSGKFEF----PL-YPN 266
           +   R   +  K+D+W+ GI LY +     P++      E   +   +++    PL +P 
Sbjct: 225 VISTRPY-VARKADVWSCGIILYAMLAGYLPWDDDSTNPEGDDIGKLYQYITRTPLKFPE 283

Query: 267 YSEQL-KSLIRDILVQNPCHR 286
           Y   + + L+R ILV +P  R
Sbjct: 284 YITPIPRDLLRKILVPDPNKR 304

>YAL017W Chr1 (120225..124295) [4071 bp, 1356 aa] {ON}  PSK1One of two
            (see also PSK2) PAS domain containing S/T protein
            kinases; coordinately regulates protein synthesis and
            carbohydrate metabolism and storage in response to a
            unknown metabolite that reflects nutritional status
          Length = 1356

 Score = 74.7 bits (182), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 55/177 (31%), Positives = 81/177 (45%), Gaps = 22/177 (12%)

Query: 116  GLIDFMN-TRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYK 174
            G ID  +    +  + EFE   I  QV  G+  +H     ++HRDIK ENV++ +    K
Sbjct: 1188 GCIDLFDLIEFKTNMTEFEAKLIFKQVVAGIKHLH--DQGIVHRDIKDENVIVDSKGFVK 1245

Query: 175  LCDFGSVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMI--DIFRGLPIDEKSDIWAL 232
            + DFGS   +   P           D+   T   Y +PE++  + + G P     DIWA+
Sbjct: 1246 IIDFGSAAYVKSGPF----------DVFVGTI-DYAAPEVLGGNPYEGQP----QDIWAI 1290

Query: 233  GIFLYKLCYYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSV 289
            GI LY + +   PF    E  IL G  +F      SE    LI+ IL +    RP++
Sbjct: 1291 GILLYTVVFKENPFYNIDE--ILEGDLKFNNAEEVSEDCIELIKSILNRCVPKRPTI 1345

>NDAI0A00660 Chr1 (121773..124841) [3069 bp, 1022 aa] {ON} Anc_1.52
          Length = 1022

 Score = 74.3 bits (181), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 60/220 (27%), Positives = 106/220 (48%), Gaps = 32/220 (14%)

Query: 104 EVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIE 163
           ++++++EY E+G L + +  R    L E E ++   Q+  G++  HAL   ++HRD+K E
Sbjct: 104 KLYMILEYAEKGELFNLLVER--GPLPEKEAIRFFRQIIIGISYCHALG--IVHRDLKPE 159

Query: 164 NVLISTNNEYKLCDFGSVCGIIRLPRNSQELSYVQQDILKNTTA---QYRSPEMIDIFRG 220
           N+L+      K+ DFG                   +D +  T+     Y +PE++    G
Sbjct: 160 NLLLDHKLNIKIADFGMAA-------------LETKDKMLETSCGSPHYAAPEIVS---G 203

Query: 221 LPIDE-KSDIWALGIFLYKLCYYTTPF--EKGGEPAIL----SGKFEFPLYPNYSEQLKS 273
           +P    +SD+W+ G+ L+ L     PF  E G    +L    SG++E P     S++ + 
Sbjct: 204 VPYHGFQSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEYEMPDDDEISKEAQD 263

Query: 274 LIRDILVQNPCHRPSVFQLLKRISIMQNVPCPINDIQTVQ 313
           LI  IL  +P  R     +LK   ++Q  P  I D ++++
Sbjct: 264 LIGRILTVDPEQRIKTRDILKH-PLLQKYPS-IKDSRSIK 301

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.131    0.369 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 63,816,688
Number of extensions: 2812935
Number of successful extensions: 14052
Number of sequences better than 10.0: 1953
Number of HSP's gapped: 12797
Number of HSP's successfully gapped: 1993
Length of query: 637
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 521
Effective length of database: 40,180,143
Effective search space: 20933854503
Effective search space used: 20933854503
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)