Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_14.3102.285ON70670637110.0
Skud_14.3082.285ON70670635480.0
Suva_14.3262.285ON70670635350.0
YNL021W (HDA1)2.285ON70670635160.0
ZYRO0A01870g2.285ON70769829640.0
CAGL0J03454g2.285ON69369129340.0
TDEL0G021602.285ON71471229260.0
NCAS0G038002.285ON72669429180.0
NDAI0G006502.285ON68968829070.0
SAKL0E07700g2.285ON71269228600.0
KNAG0H020102.285ON69368528450.0
KAFR0H033202.285ON70269628210.0
KLTH0G10340g2.285ON70870627950.0
Kwal_27.115372.285ON70870327710.0
Ecym_33242.285ON70670827280.0
KLLA0E08383g2.285ON70471026720.0
ADL216C2.285ON70569826360.0
Kpol_1039.322.285ON65965526340.0
TPHA0C033902.285ON70166825970.0
TBLA0B069502.285ON79547920300.0
Kpol_1003.372.285ON57829813810.0
TDEL0B045808.153ON4463333491e-34
AFR172C8.153ON4493343463e-34
TPHA0H003208.153ON4503343464e-34
NDAI0B027108.153ON4533303446e-34
SAKL0H25124g8.153ON4483393421e-33
NCAS0B054808.153ON4513333412e-33
TBLA0D021408.153ON4563433402e-33
Kpol_246.58.153ON4533333375e-33
KLTH0E06446g8.153ON4493323359e-33
KNAG0G013508.153ON4513363351e-32
Ecym_23468.153ON4853373351e-32
Skud_7.798.153ON4523303332e-32
YGL194C (HOS2)8.153ON4523313305e-32
KAFR0C029208.153ON4533343296e-32
CAGL0A03322g8.153ON4503403288e-32
Kwal_55.207908.153ON4493323288e-32
Suva_7.718.153ON4523303289e-32
Smik_7.798.153ON4523303271e-31
ZYRO0G19316g8.153ON4483363271e-31
KLLA0F09119g8.153ON4523333252e-31
Kpol_1038.113.8ON4333263199e-31
Suva_14.113.8ON4333263181e-30
Skud_14.113.8ON4333263162e-30
NDAI0G037403.8ON4333263153e-30
Kwal_55.221423.8ON4323263153e-30
KNAG0A011603.8ON4333263154e-30
NCAS0C043203.8ON4343263144e-30
TBLA0I005603.8ON4333263144e-30
CAGL0B01441g3.8ON4333263145e-30
ZYRO0C03498g3.8ON4333263135e-30
Ecym_20103.8ON4333263135e-30
KLLA0E01981g3.8ON4323263136e-30
AGR395W3.8ON4333263136e-30
KLTH0F19668g3.8ON4323263127e-30
SAKL0C13706g3.8ON4333263127e-30
KAFR0A086303.8ON4333263129e-30
Smik_14.23.8ON4333263102e-29
TPHA0A003003.8ON4333263092e-29
YNL330C (RPD3)3.8ON4333263092e-29
TDEL0A002703.8ON4333263056e-29
NDAI0A051203.362ON5082482011e-15
TBLA0B023903.362ON5791821976e-15
Skud_16.3533.362ON4711831948e-15
Suva_16.3963.362ON4771831931e-14
TDEL0C050403.362ON4542091912e-14
KLTH0F10582g3.362ON4742281912e-14
NCAS0A111803.362ON4902091884e-14
Kwal_23.37243.362ON4732281869e-14
CAGL0D01430g3.362ON4452781859e-14
YPR068C (HOS1)3.362ON4701831842e-13
Smik_16.3093.362ON4701831822e-13
SAKL0B07854g3.362ON4891831813e-13
KAFR0H008903.362ON4742161761e-12
ZYRO0C16390g3.362ON4361951751e-12
Ecym_82908.607ON7093311744e-12
Kpol_376.153.362ON5181831691e-11
SAKL0H08338g8.607ON6903321701e-11
ADL339W3.362ON4372061671e-11
KNAG0H006303.362ON4561881653e-11
KLLA0B09394g3.362ON4411831653e-11
TDEL0A055208.607ON6743281628e-11
ADL265W8.607ON6942491602e-10
Ecym_34653.362ON4452341572e-10
KLLA0F00858g8.607ON7152621592e-10
TPHA0A011208.607ON6982521583e-10
KLTH0D09592g8.607ON7052561574e-10
TBLA0E040808.607ON6942431493e-09
Smik_6.3158.607ON6973181493e-09
CAGL0J06974g8.607ON6782471484e-09
YPL116W (HOS3)8.607ON6973171485e-09
Kwal_26.85058.607ON7082461468e-09
Suva_16.1948.607ON6993171451e-08
Kpol_479.68.607ON6882501422e-08
NCAS0C017608.607ON7001371422e-08
TPHA0M015903.362ON4942931413e-08
KNAG0J013008.607ON6771141413e-08
KAFR0H027908.607ON7171161405e-08
NDAI0E024808.607ON684981342e-07
Skud_16.1648.607ON697581342e-07
ZYRO0F10780g8.607ON6683221332e-07
Kwal_55.206504.25ON204110697.5
AFR659W1.92ON27371699.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_14.310
         (706 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_14.310 Chr14 (555609..557729) [2121 bp, 706 aa] {ON} YNL021...  1434   0.0  
Skud_14.308 Chr14 (563902..566022) [2121 bp, 706 aa] {ON} YNL021...  1371   0.0  
Suva_14.326 Chr14 (576098..578218) [2121 bp, 706 aa] {ON} YNL021...  1366   0.0  
YNL021W Chr14 (593227..595347) [2121 bp, 706 aa] {ON}  HDA1Putat...  1358   0.0  
ZYRO0A01870g Chr1 complement(154507..156630) [2124 bp, 707 aa] {...  1146   0.0  
CAGL0J03454g Chr10 complement(332090..334171) [2082 bp, 693 aa] ...  1134   0.0  
TDEL0G02160 Chr7 complement(424838..426982) [2145 bp, 714 aa] {O...  1131   0.0  
NCAS0G03800 Chr7 (701547..703727) [2181 bp, 726 aa] {ON}             1128   0.0  
NDAI0G00650 Chr7 complement(141981..144050) [2070 bp, 689 aa] {O...  1124   0.0  
SAKL0E07700g Chr5 (622822..624960) [2139 bp, 712 aa] {ON} highly...  1106   0.0  
KNAG0H02010 Chr8 (354923..357004) [2082 bp, 693 aa] {ON} Anc_2.2...  1100   0.0  
KAFR0H03320 Chr8 (633105..635213) [2109 bp, 702 aa] {ON} Anc_2.2...  1091   0.0  
KLTH0G10340g Chr7 complement(874566..876692) [2127 bp, 708 aa] {...  1081   0.0  
Kwal_27.11537 s27 (839198..841324) [2127 bp, 708 aa] {ON} YNL021...  1071   0.0  
Ecym_3324 Chr3 complement(620836..622956) [2121 bp, 706 aa] {ON}...  1055   0.0  
KLLA0E08383g Chr5 (754048..756162) [2115 bp, 704 aa] {ON} highly...  1033   0.0  
ADL216C Chr4 complement(324197..326314) [2118 bp, 705 aa] {ON} S...  1019   0.0  
Kpol_1039.32 s1039 (99859..101838) [1980 bp, 659 aa] {ON} (99859...  1019   0.0  
TPHA0C03390 Chr3 complement(743315..745420) [2106 bp, 701 aa] {O...  1004   0.0  
TBLA0B06950 Chr2 complement(1643756..1646143) [2388 bp, 795 aa] ...   786   0.0  
Kpol_1003.37 s1003 complement(91621..92301,92861..92869,92912..9...   536   0.0  
TDEL0B04580 Chr2 complement(817368..818708) [1341 bp, 446 aa] {O...   139   1e-34
AFR172C Chr6 complement(754470..755819) [1350 bp, 449 aa] {ON} S...   137   3e-34
TPHA0H00320 Chr8 complement(62605..63957) [1353 bp, 450 aa] {ON}...   137   4e-34
NDAI0B02710 Chr2 (674610..675971) [1362 bp, 453 aa] {ON} Anc_8.153    137   6e-34
SAKL0H25124g Chr8 (2184039..2185385) [1347 bp, 448 aa] {ON} high...   136   1e-33
NCAS0B05480 Chr2 complement(1033624..1034979) [1356 bp, 451 aa] ...   135   2e-33
TBLA0D02140 Chr4 complement(539873..541243) [1371 bp, 456 aa] {O...   135   2e-33
Kpol_246.5 s246 (11759..13120) [1362 bp, 453 aa] {ON} (11759..13...   134   5e-33
KLTH0E06446g Chr5 complement(594807..596156) [1350 bp, 449 aa] {...   133   9e-33
KNAG0G01350 Chr7 (300791..302146) [1356 bp, 451 aa] {ON} Anc_8.1...   133   1e-32
Ecym_2346 Chr2 complement(678792..680249) [1458 bp, 485 aa] {ON}...   133   1e-32
Skud_7.79 Chr7 complement(146016..147374) [1359 bp, 452 aa] {ON}...   132   2e-32
YGL194C Chr7 complement(140368..141726) [1359 bp, 452 aa] {ON}  ...   131   5e-32
KAFR0C02920 Chr3 complement(584668..586029) [1362 bp, 453 aa] {O...   131   6e-32
CAGL0A03322g Chr1 (338516..339868) [1353 bp, 450 aa] {ON} highly...   130   8e-32
Kwal_55.20790 s55 complement(559958..561307) [1350 bp, 449 aa] {...   130   8e-32
Suva_7.71 Chr7 complement(135837..137195) [1359 bp, 452 aa] {ON}...   130   9e-32
Smik_7.79 Chr7 complement(134747..136105) [1359 bp, 452 aa] {ON}...   130   1e-31
ZYRO0G19316g Chr7 (1600375..1601721) [1347 bp, 448 aa] {ON} high...   130   1e-31
KLLA0F09119g Chr6 (848467..849825) [1359 bp, 452 aa] {ON} highly...   129   2e-31
Kpol_1038.11 s1038 complement(25267..26568) [1302 bp, 433 aa] {O...   127   9e-31
Suva_14.11 Chr14 complement(13144..14445) [1302 bp, 433 aa] {ON}...   127   1e-30
Skud_14.11 Chr14 complement(11451..12752) [1302 bp, 433 aa] {ON}...   126   2e-30
NDAI0G03740 Chr7 complement(900866..902167) [1302 bp, 433 aa] {O...   125   3e-30
Kwal_55.22142 s55 (1130691..1131989) [1299 bp, 432 aa] {ON} YNL3...   125   3e-30
KNAG0A01160 Chr1 complement(7229..8530) [1302 bp, 433 aa] {ON} A...   125   4e-30
NCAS0C04320 Chr3 (887622..888926) [1305 bp, 434 aa] {ON} Anc_3.8      125   4e-30
TBLA0I00560 Chr9 (100393..101694) [1302 bp, 433 aa] {ON} Anc_3.8...   125   4e-30
CAGL0B01441g Chr2 complement(130216..131517) [1302 bp, 433 aa] {...   125   5e-30
ZYRO0C03498g Chr3 (278064..279365) [1302 bp, 433 aa] {ON} highly...   125   5e-30
Ecym_2010 Chr2 complement(12699..14000) [1302 bp, 433 aa] {ON} s...   125   5e-30
KLLA0E01981g Chr5 complement(186177..187475) [1299 bp, 432 aa] {...   125   6e-30
AGR395W Chr7 (1455659..1456960) [1302 bp, 433 aa] {ON} Syntenic ...   125   6e-30
KLTH0F19668g Chr6 (1595709..1597007) [1299 bp, 432 aa] {ON} high...   124   7e-30
SAKL0C13706g Chr3 (1207800..1209101) [1302 bp, 433 aa] {ON} high...   124   7e-30
KAFR0A08630 Chr1 (1731077..1732378) [1302 bp, 433 aa] {ON} Anc_3...   124   9e-30
Smik_14.2 Chr14 complement(2435..3736) [1302 bp, 433 aa] {ON} YN...   124   2e-29
TPHA0A00300 Chr1 complement(40868..42169) [1302 bp, 433 aa] {ON}...   123   2e-29
YNL330C Chr14 complement(18001..19302) [1302 bp, 433 aa] {ON}  R...   123   2e-29
TDEL0A00270 Chr1 complement(44950..46251) [1302 bp, 433 aa] {ON}...   122   6e-29
NDAI0A05120 Chr1 (1164314..1165840) [1527 bp, 508 aa] {ON} Anc_3...    82   1e-15
TBLA0B02390 Chr2 (558067..559806) [1740 bp, 579 aa] {ON} Anc_3.3...    80   6e-15
Skud_16.353 Chr16 complement(647799..649214) [1416 bp, 471 aa] {...    79   8e-15
Suva_16.396 Chr16 complement(689796..691229) [1434 bp, 477 aa] {...    79   1e-14
TDEL0C05040 Chr3 complement(901798..903162) [1365 bp, 454 aa] {O...    78   2e-14
KLTH0F10582g Chr6 (910298..911722) [1425 bp, 474 aa] {ON} simila...    78   2e-14
NCAS0A11180 Chr1 complement(2216701..2218173) [1473 bp, 490 aa] ...    77   4e-14
Kwal_23.3724 s23 (406773..408194) [1422 bp, 473 aa] {ON} YPR068C...    76   9e-14
CAGL0D01430g Chr4 (158990..160327) [1338 bp, 445 aa] {ON} simila...    76   9e-14
YPR068C Chr16 complement(682941..684353) [1413 bp, 470 aa] {ON} ...    75   2e-13
Smik_16.309 Chr16 complement(559713..561125) [1413 bp, 470 aa] {...    75   2e-13
SAKL0B07854g Chr2 complement(669743..671212) [1470 bp, 489 aa] {...    74   3e-13
KAFR0H00890 Chr8 (167453..168877) [1425 bp, 474 aa] {ON} Anc_3.3...    72   1e-12
ZYRO0C16390g Chr3 complement(1274651..1275961) [1311 bp, 436 aa]...    72   1e-12
Ecym_8290 Chr8 complement(589795..591924) [2130 bp, 709 aa] {ON}...    72   4e-12
Kpol_376.15 s376 complement(25558..27114) [1557 bp, 518 aa] {ON}...    70   1e-11
SAKL0H08338g Chr8 (716414..718486) [2073 bp, 690 aa] {ON} simila...    70   1e-11
ADL339W Chr4 (110772..112085) [1314 bp, 437 aa] {ON} Syntenic ho...    69   1e-11
KNAG0H00630 Chr8 (105506..106876) [1371 bp, 456 aa] {ON} Anc_3.3...    68   3e-11
KLLA0B09394g Chr2 (822629..823954) [1326 bp, 441 aa] {ON} simila...    68   3e-11
TDEL0A05520 Chr1 complement(970572..972596) [2025 bp, 674 aa] {O...    67   8e-11
ADL265W Chr4 (237911..239995) [2085 bp, 694 aa] {ON} Syntenic ho...    66   2e-10
Ecym_3465 Chr3 (874618..875955) [1338 bp, 445 aa] {ON} similar t...    65   2e-10
KLLA0F00858g Chr6 complement(78519..80666) [2148 bp, 715 aa] {ON...    66   2e-10
TPHA0A01120 Chr1 (216522..218618) [2097 bp, 698 aa] {ON} Anc_8.6...    65   3e-10
KLTH0D09592g Chr4 complement(792708..794825) [2118 bp, 705 aa] {...    65   4e-10
TBLA0E04080 Chr5 complement(1026669..1028753) [2085 bp, 694 aa] ...    62   3e-09
Smik_6.315 Chr6 complement(492590..494683) [2094 bp, 697 aa] {ON...    62   3e-09
CAGL0J06974g Chr10 (667811..669847) [2037 bp, 678 aa] {ON} highl...    62   4e-09
YPL116W Chr16 (329606..331699) [2094 bp, 697 aa] {ON}  HOS3Trich...    62   5e-09
Kwal_26.8505 s26 complement(815901..818027) [2127 bp, 708 aa] {O...    61   8e-09
Suva_16.194 Chr16 (339127..341226) [2100 bp, 699 aa] {ON} YPL116...    60   1e-08
Kpol_479.6 s479 complement(10892..12958) [2067 bp, 688 aa] {ON} ...    59   2e-08
NCAS0C01760 Chr3 (324446..326548) [2103 bp, 700 aa] {ON} Anc_8.6...    59   2e-08
TPHA0M01590 Chr13 complement(332934..334418) [1485 bp, 494 aa] {...    59   3e-08
KNAG0J01300 Chr10 (232784..234817) [2034 bp, 677 aa] {ON} Anc_8....    59   3e-08
KAFR0H02790 Chr8 complement(531813..533966) [2154 bp, 717 aa] {O...    59   5e-08
NDAI0E02480 Chr5 (512966..515020) [2055 bp, 684 aa] {ON} Anc_8.6...    56   2e-07
Skud_16.164 Chr16 (301141..303234) [2094 bp, 697 aa] {ON} YPL116...    56   2e-07
ZYRO0F10780g Chr6 complement(879680..881686) [2007 bp, 668 aa] {...    56   2e-07
Kwal_55.20650 s55 (505162..505776) [615 bp, 204 aa] {ON} YLL033W...    31   7.5  
AFR659W Chr6 (1640624..1641445) [822 bp, 273 aa] {ON} Non-synten...    31   9.5  

>Smik_14.310 Chr14 (555609..557729) [2121 bp, 706 aa] {ON} YNL021W
           (REAL)
          Length = 706

 Score = 1434 bits (3711), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 690/706 (97%), Positives = 690/706 (97%)

Query: 1   MDSEIVKKEAWENPDGNLKRRLEETKEDQNSLSTTSNNKRQVIVPACTPKIHYSPLKTGL 60
           MDSEIVKKEAWENPDGNLKRRLEETKEDQNSLSTTSNNKRQVIVPACTPKIHYSPLKTGL
Sbjct: 1   MDSEIVKKEAWENPDGNLKRRLEETKEDQNSLSTTSNNKRQVIVPACTPKIHYSPLKTGL 60

Query: 61  CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLK 120
           CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLK
Sbjct: 61  CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLK 120

Query: 121 IPVRAATSEEILEVHTKEHLEFIESTEKMSREQLLKETEKGDSVYFNNDSYASARLPCGG 180
           IPVRAATSEEILEVHTKEHLEFIESTEKMSREQLLKETEKGDSVYFNNDSYASARLPCGG
Sbjct: 121 IPVRAATSEEILEVHTKEHLEFIESTEKMSREQLLKETEKGDSVYFNNDSYASARLPCGG 180

Query: 181 AIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIM 240
           AIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIM
Sbjct: 181 AIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIM 240

Query: 241 ILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQAGEGKGEGFNCNIT 300
           ILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQAGEGKGEGFNCNIT
Sbjct: 241 ILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQAGEGKGEGFNCNIT 300

Query: 301 WPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTH 360
           WPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTH
Sbjct: 301 WPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTH 360

Query: 361 MLKSLARGNLCVVLEGGYNLDAIARSALSVAKVLIGXXXXXXXXXXXXXXXXVIEMIDKV 420
           MLKSLARGNLCVVLEGGYNLDAIARSALSVAKVLIG                VIEMIDKV
Sbjct: 361 MLKSLARGNLCVVLEGGYNLDAIARSALSVAKVLIGEPPDELPDSSSDPKPEVIEMIDKV 420

Query: 421 IRLQSKYWNCFRRRHANSGCNFNEPINDSIVSKNFPLQKAIRQQQQHYLSDEFNLVTLPL 480
           IRLQSKYWNCFRRRHANSGCNFNEPINDSIVSKNFPLQKAIRQQQQHYLSDEFNLVTLPL
Sbjct: 421 IRLQSKYWNCFRRRHANSGCNFNEPINDSIVSKNFPLQKAIRQQQQHYLSDEFNLVTLPL 480

Query: 481 INMDLPDNTVLCTPNVYESTTLLVVVHDTSDIWAKRNVISGTIDLSSSVIIDNCLDFIKW 540
           INMDLPDNTVLCTPNVYESTTLLVVVHDTSDIWAKRNVISGTIDLSSSVIIDNCLDFIKW
Sbjct: 481 INMDLPDNTVLCTPNVYESTTLLVVVHDTSDIWAKRNVISGTIDLSSSVIIDNCLDFIKW 540

Query: 541 GLDRKYGIIDVNIPLSLFEPDNYSGMITSQEVLIYLWDNYIKYFPAVAKIAFVGIGDSYS 600
           GLDRKYGIIDVNIPLSLFEPDNYSGMITSQEVLIYLWDNYIKYFPAVAKIAFVGIGDSYS
Sbjct: 541 GLDRKYGIIDVNIPLSLFEPDNYSGMITSQEVLIYLWDNYIKYFPAVAKIAFVGIGDSYS 600

Query: 601 GIVHLLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETLSEWYFKNSLIFSNNSHQCWKEN 660
           GIVHLLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETLSEWYFKNSLIFSNNSHQCWKEN
Sbjct: 601 GIVHLLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETLSEWYFKNSLIFSNNSHQCWKEN 660

Query: 661 ESRKPRKKFGRVLRCDTDGLNNTIEERFEEATDFILDSFEEWSDEE 706
           ESRKPRKKFGRVLRCDTDGLNNTIEERFEEATDFILDSFEEWSDEE
Sbjct: 661 ESRKPRKKFGRVLRCDTDGLNNTIEERFEEATDFILDSFEEWSDEE 706

>Skud_14.308 Chr14 (563902..566022) [2121 bp, 706 aa] {ON} YNL021W
           (REAL)
          Length = 706

 Score = 1371 bits (3548), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 657/706 (93%), Positives = 671/706 (95%)

Query: 1   MDSEIVKKEAWENPDGNLKRRLEETKEDQNSLSTTSNNKRQVIVPACTPKIHYSPLKTGL 60
           MDS  VK E  ENPD +LKR LE TKEDQNSLSTTS NKRQVIVPACTPKIHYSPLKTGL
Sbjct: 1   MDSARVKNEVLENPDHDLKRTLENTKEDQNSLSTTSRNKRQVIVPACTPKIHYSPLKTGL 60

Query: 61  CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLK 120
           CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDD+GDLMLK
Sbjct: 61  CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDIGDLMLK 120

Query: 121 IPVRAATSEEILEVHTKEHLEFIESTEKMSREQLLKETEKGDSVYFNNDSYASARLPCGG 180
           IPVRAATSEEILEVHTKEHLEFIESTEKMSREQLLKETEKGDSVYFNNDSYASARLPCGG
Sbjct: 121 IPVRAATSEEILEVHTKEHLEFIESTEKMSREQLLKETEKGDSVYFNNDSYASARLPCGG 180

Query: 181 AIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIM 240
           AIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIM
Sbjct: 181 AIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIM 240

Query: 241 ILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQAGEGKGEGFNCNIT 300
           ILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQ GEGKGEGFNCNIT
Sbjct: 241 ILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQTGEGKGEGFNCNIT 300

Query: 301 WPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTH 360
           WPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHV+PSCYGHMTH
Sbjct: 301 WPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTH 360

Query: 361 MLKSLARGNLCVVLEGGYNLDAIARSALSVAKVLIGXXXXXXXXXXXXXXXXVIEMIDKV 420
           MLKSLARGNLCVVLEGGYNLDAIARSALSVAKVLIG                VIEMIDKV
Sbjct: 361 MLKSLARGNLCVVLEGGYNLDAIARSALSVAKVLIGEPPDELPDSLSDPKPEVIEMIDKV 420

Query: 421 IRLQSKYWNCFRRRHANSGCNFNEPINDSIVSKNFPLQKAIRQQQQHYLSDEFNLVTLPL 480
           IRLQSKYWNCFRRRHANSGCNFNEPINDSI+SKNFPLQKAIRQQQ  YLS+EF+ VTLPL
Sbjct: 421 IRLQSKYWNCFRRRHANSGCNFNEPINDSIISKNFPLQKAIRQQQLQYLSNEFSFVTLPL 480

Query: 481 INMDLPDNTVLCTPNVYESTTLLVVVHDTSDIWAKRNVISGTIDLSSSVIIDNCLDFIKW 540
           INM LPDNT LCTPNV+ES  LLVVVHDTSD+WAKRNVISGTIDLSSSVIIDNC+DFIKW
Sbjct: 481 INMGLPDNTALCTPNVFESNALLVVVHDTSDVWAKRNVISGTIDLSSSVIIDNCIDFIKW 540

Query: 541 GLDRKYGIIDVNIPLSLFEPDNYSGMITSQEVLIYLWDNYIKYFPAVAKIAFVGIGDSYS 600
           GLDRKYGIIDVNIPL+LFE DNYSGMITSQEVLIYLWDNYIKYFP VAKIAF+GIGDS+S
Sbjct: 541 GLDRKYGIIDVNIPLTLFEADNYSGMITSQEVLIYLWDNYIKYFPNVAKIAFIGIGDSHS 600

Query: 601 GIVHLLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETLSEWYFKNSLIFSNNSHQCWKEN 660
           GIVHLLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETLSEWYFKNSLIFSNNSHQCWKEN
Sbjct: 601 GIVHLLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETLSEWYFKNSLIFSNNSHQCWKEN 660

Query: 661 ESRKPRKKFGRVLRCDTDGLNNTIEERFEEATDFILDSFEEWSDEE 706
           ESRKPRKKFGRVLRCDTDGL+NTIEERFEEATDFILDSFEEWSD+E
Sbjct: 661 ESRKPRKKFGRVLRCDTDGLSNTIEERFEEATDFILDSFEEWSDDE 706

>Suva_14.326 Chr14 (576098..578218) [2121 bp, 706 aa] {ON} YNL021W
           (REAL)
          Length = 706

 Score = 1366 bits (3535), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 650/706 (92%), Positives = 672/706 (95%)

Query: 1   MDSEIVKKEAWENPDGNLKRRLEETKEDQNSLSTTSNNKRQVIVPACTPKIHYSPLKTGL 60
           MDS  VK E  E PD +LK +LE  KE+QNSLSTTS NKRQVIVPACTPK+HY+PL+TGL
Sbjct: 1   MDSATVKNEVLETPDQDLKHKLEGMKEEQNSLSTTSKNKRQVIVPACTPKLHYTPLRTGL 60

Query: 61  CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLK 120
           CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLK
Sbjct: 61  CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLK 120

Query: 121 IPVRAATSEEILEVHTKEHLEFIESTEKMSREQLLKETEKGDSVYFNNDSYASARLPCGG 180
           IPVRAATSEEILEVHTKEHLEFIESTEKMSREQLLKETEKGDSVYFNNDSYASARLPCGG
Sbjct: 121 IPVRAATSEEILEVHTKEHLEFIESTEKMSREQLLKETEKGDSVYFNNDSYASARLPCGG 180

Query: 181 AIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIM 240
           AIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIM
Sbjct: 181 AIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIM 240

Query: 241 ILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQAGEGKGEGFNCNIT 300
           ILDWDIHHGNGTQKSFYQDDQVLY+SLHRFE+GKYYPGTIQGQYDQ GEGKGEGFNCNIT
Sbjct: 241 ILDWDIHHGNGTQKSFYQDDQVLYISLHRFEIGKYYPGTIQGQYDQTGEGKGEGFNCNIT 300

Query: 301 WPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTH 360
           WPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTH
Sbjct: 301 WPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTH 360

Query: 361 MLKSLARGNLCVVLEGGYNLDAIARSALSVAKVLIGXXXXXXXXXXXXXXXXVIEMIDKV 420
           MLKSLARGNLCVVLEGGYNLDAIA SALSVAKVLIG                VIEMIDKV
Sbjct: 361 MLKSLARGNLCVVLEGGYNLDAIAISALSVAKVLIGEPPDELPDPLSDPKPEVIEMIDKV 420

Query: 421 IRLQSKYWNCFRRRHANSGCNFNEPINDSIVSKNFPLQKAIRQQQQHYLSDEFNLVTLPL 480
           +RLQSKYWNCFRRRHANSGCNFNEPINDSI+SKNFPLQKAIRQQQ HYLSDEFN VTLPL
Sbjct: 421 VRLQSKYWNCFRRRHANSGCNFNEPINDSIISKNFPLQKAIRQQQLHYLSDEFNFVTLPL 480

Query: 481 INMDLPDNTVLCTPNVYESTTLLVVVHDTSDIWAKRNVISGTIDLSSSVIIDNCLDFIKW 540
           INM+LPDN VLCTPNV ES+TLLVVVHDTSD+WAKRNVISGTIDLSSSV+IDNCLDFIKW
Sbjct: 481 INMELPDNIVLCTPNVSESSTLLVVVHDTSDVWAKRNVISGTIDLSSSVVIDNCLDFIKW 540

Query: 541 GLDRKYGIIDVNIPLSLFEPDNYSGMITSQEVLIYLWDNYIKYFPAVAKIAFVGIGDSYS 600
           GLDRKYGIIDVNIPL+LFE DNYSGMITSQEVLIYLWDNYIKYFPAVAKIA++GIGDSYS
Sbjct: 541 GLDRKYGIIDVNIPLTLFEADNYSGMITSQEVLIYLWDNYIKYFPAVAKIAYIGIGDSYS 600

Query: 601 GIVHLLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETLSEWYFKNSLIFSNNSHQCWKEN 660
           GIVHLLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETL+EWYFKNSL+F+NNSHQCWKEN
Sbjct: 601 GIVHLLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETLTEWYFKNSLVFTNNSHQCWKEN 660

Query: 661 ESRKPRKKFGRVLRCDTDGLNNTIEERFEEATDFILDSFEEWSDEE 706
           ESRKPRKKFGRVLRCDTDGL+NT+EERFEEATDFILDSFEEWSDEE
Sbjct: 661 ESRKPRKKFGRVLRCDTDGLSNTVEERFEEATDFILDSFEEWSDEE 706

>YNL021W Chr14 (593227..595347) [2121 bp, 706 aa] {ON}  HDA1Putative
           catalytic subunit of a class II histone deacetylase
           complex that also contains Hda2p and Hda3p; Hda1p
           interacts with the Hda2p-Hda3p subcomplex to form an
           active tetramer; deletion increases histone H2B, H3 and
           H4 acetylation
          Length = 706

 Score = 1358 bits (3516), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 659/706 (93%), Positives = 676/706 (95%)

Query: 1   MDSEIVKKEAWENPDGNLKRRLEETKEDQNSLSTTSNNKRQVIVPACTPKIHYSPLKTGL 60
           MDS +VKKE  ENPD +LKR+LEE KE++NSLSTTS +KRQVIVP C PKIHYSPLKTGL
Sbjct: 1   MDSVMVKKEVLENPDHDLKRKLEENKEEENSLSTTSKSKRQVIVPVCMPKIHYSPLKTGL 60

Query: 61  CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLK 120
           CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLK
Sbjct: 61  CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLK 120

Query: 121 IPVRAATSEEILEVHTKEHLEFIESTEKMSREQLLKETEKGDSVYFNNDSYASARLPCGG 180
           IPVRAATSEEILEVHTKEHLEFIESTEKMSRE+LLKETEKGDSVYFNNDSYASARLPCGG
Sbjct: 121 IPVRAATSEEILEVHTKEHLEFIESTEKMSREELLKETEKGDSVYFNNDSYASARLPCGG 180

Query: 181 AIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIM 240
           AIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIM
Sbjct: 181 AIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIM 240

Query: 241 ILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQAGEGKGEGFNCNIT 300
           ILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQ GEGKGEGFNCNIT
Sbjct: 241 ILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQTGEGKGEGFNCNIT 300

Query: 301 WPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTH 360
           WPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTH
Sbjct: 301 WPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTH 360

Query: 361 MLKSLARGNLCVVLEGGYNLDAIARSALSVAKVLIGXXXXXXXXXXXXXXXXVIEMIDKV 420
           MLKSLARGNLCVVLEGGYNLDAIARSALSVAKVLIG                VIEMIDKV
Sbjct: 361 MLKSLARGNLCVVLEGGYNLDAIARSALSVAKVLIGEPPDELPDPLSDPKPEVIEMIDKV 420

Query: 421 IRLQSKYWNCFRRRHANSGCNFNEPINDSIVSKNFPLQKAIRQQQQHYLSDEFNLVTLPL 480
           IRLQSKYWNCFRRRHANSGCNFNEPINDSI+SKNFPLQKAIRQQQQHYLSDEFN VTLPL
Sbjct: 421 IRLQSKYWNCFRRRHANSGCNFNEPINDSIISKNFPLQKAIRQQQQHYLSDEFNFVTLPL 480

Query: 481 INMDLPDNTVLCTPNVYESTTLLVVVHDTSDIWAKRNVISGTIDLSSSVIIDNCLDFIKW 540
           ++MDLPDNTVLCTPN+ ES T+++VVHDTSDIWAKRNVISGTIDLSSSVIIDN LDFIKW
Sbjct: 481 VSMDLPDNTVLCTPNISESNTIIIVVHDTSDIWAKRNVISGTIDLSSSVIIDNSLDFIKW 540

Query: 541 GLDRKYGIIDVNIPLSLFEPDNYSGMITSQEVLIYLWDNYIKYFPAVAKIAFVGIGDSYS 600
           GLDRKYGIIDVNIPL+LFEPDNYSGMITSQEVLIYLWDNYIKYFP+VAKIAF+GIGDSYS
Sbjct: 541 GLDRKYGIIDVNIPLTLFEPDNYSGMITSQEVLIYLWDNYIKYFPSVAKIAFIGIGDSYS 600

Query: 601 GIVHLLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETLSEWYFKNSLIFSNNSHQCWKEN 660
           GIVHLLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETLSEWYFKNSLIFSNNSHQCWKEN
Sbjct: 601 GIVHLLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETLSEWYFKNSLIFSNNSHQCWKEN 660

Query: 661 ESRKPRKKFGRVLRCDTDGLNNTIEERFEEATDFILDSFEEWSDEE 706
           ESRKPRKKFGRVLRCDTDGLNN IEERFEEATDFILDSFEEWSDEE
Sbjct: 661 ESRKPRKKFGRVLRCDTDGLNNIIEERFEEATDFILDSFEEWSDEE 706

>ZYRO0A01870g Chr1 complement(154507..156630) [2124 bp, 707 aa] {ON}
           highly similar to uniprot|P53973 Saccharomyces
           cerevisiae YNL021W HDA1 Putative catalytic subunit of a
           class II histone deacetylase complex that also contains
           Hda2p and Hda3p Hda1p interacts with the Hda2p-Hda3p
           subcomplex to form an active tetramer deletion increases
           histone H2B H3 and H4 acetylation
          Length = 707

 Score = 1146 bits (2964), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 528/698 (75%), Positives = 616/698 (88%), Gaps = 7/698 (1%)

Query: 15  DGNLKRRLEETK----EDQNSLSTTSN--NKRQVIVPACTPKIHYSPLKTGLCYDVRMRY 68
           D   KR+LEE+     E + ++++ SN   KRQ+IVPAC PKIHY+PLKTGLCYDVRMRY
Sbjct: 11  DEGSKRKLEESPNGPVEKKPNVASVSNGRQKRQIIVPACEPKIHYTPLKTGLCYDVRMRY 70

Query: 69  HAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKIPVRAATS 128
           HAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSG DD+G+LMLKIPVR AT 
Sbjct: 71  HAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGEDDIGELMLKIPVREATV 130

Query: 129 EEILEVHTKEHLEFIESTEKMSREQLLKETEKGDSVYFNNDSYASARLPCGGAIEACKAV 188
           EE+L+VHTKEHLEFIE T +M+RE+LLKETE GDSVYFN+DSY++A+LPCGGAIEACKAV
Sbjct: 131 EELLQVHTKEHLEFIEKTSQMNREELLKETETGDSVYFNSDSYSAAKLPCGGAIEACKAV 190

Query: 189 VEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHH 248
           VEGRVKN+LAV+RPPGHHAEP+ AGGFCLFSNVAVAA+NILKNYPESVRRI+ILDWDIHH
Sbjct: 191 VEGRVKNALAVIRPPGHHAEPEMAGGFCLFSNVAVAAQNILKNYPESVRRILILDWDIHH 250

Query: 249 GNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQAGEGKGEGFNCNITWPVGGVGD 308
           GNGTQK+FY DD+VLY+SLHRFE+GKYYPGTI GQYDQ GEGKGEGFNCNITWPVGGVGD
Sbjct: 251 GNGTQKAFYNDDRVLYISLHRFELGKYYPGTIHGQYDQTGEGKGEGFNCNITWPVGGVGD 310

Query: 309 AEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARG 368
           AEYM AFEQ+VMPM RE++PDLVIISSGFDAADGDTIGQCHV+PSCYGHMTHMLKSLARG
Sbjct: 311 AEYMLAFEQIVMPMAREYRPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTHMLKSLARG 370

Query: 369 NLCVVLEGGYNLDAIARSALSVAKVLIGXXXXXXXXXXXXXXXXVIEMIDKVIRLQSKYW 428
           NLCV LEGGYNLDAIA SALSVAK+LIG                 IEMIDKVI +QSKYW
Sbjct: 371 NLCVALEGGYNLDAIATSALSVAKILIGEPPEELPDPSKNPKLEAIEMIDKVIHVQSKYW 430

Query: 429 NCFRRRHANSGCNFNEPINDSIVSKNFPLQKAIRQQQQHYLSDEFNLVTLPLINMDLPDN 488
            CFRR   NSGCNF EP+ +S+++KNFPLQKAIRQ+Q H L  E+  VTLP+  ++LP++
Sbjct: 431 KCFRRL-GNSGCNFKEPVTESLITKNFPLQKAIRQEQFHQLEKEYGFVTLPVPKLELPED 489

Query: 489 TVLCTPNVYESTTLLVVVHDTSDIWAKRNVISGTIDLSSSVIIDNCLDFIKWGLDRKYGI 548
           TVLC+P+V++ +T+++ VHDT +IWAKR+VI+G ID S+S+ +D+ LDFIKW L RKYG+
Sbjct: 490 TVLCSPDVFQESTVIIFVHDTPEIWAKRDVITGMIDPSTSITVDSPLDFIKWSLARKYGV 549

Query: 549 IDVNIPLSLFEPDNYSGMITSQEVLIYLWDNYIKYFPAVAKIAFVGIGDSYSGIVHLLGH 608
           IDVNIP SLFE DNYS MITSQEVLIYLWDN++KYFP+++K+AFVG+GD+YSGIVHLLGH
Sbjct: 550 IDVNIPQSLFEQDNYSAMITSQEVLIYLWDNFVKYFPSLSKVAFVGVGDAYSGIVHLLGH 609

Query: 609 RDTRAVTKTVINFLGDKQLKPLVPLVDETLSEWYFKNSLIFSNNSHQCWKENESRKPRKK 668
           RDTR+V K VINF+G KQLKPLVPLVDE+L +WYFKNSL+FS+ ++ CW +NE++KPR+K
Sbjct: 610 RDTRSVVKAVINFVGRKQLKPLVPLVDESLGDWYFKNSLVFSDRNNPCWVDNENKKPRRK 669

Query: 669 FGRVLRCDTDGLNNTIEERFEEATDFILDSFEEWSDEE 706
           FGRVLRC++DG+NN +EERF+EATDFILDSFEEWSD E
Sbjct: 670 FGRVLRCESDGINNNMEERFDEATDFILDSFEEWSDSE 707

>CAGL0J03454g Chr10 complement(332090..334171) [2082 bp, 693 aa]
           {ON} highly similar to uniprot|P53973 Saccharomyces
           cerevisiae YNL021w HDA1 histone deacetylase A
          Length = 693

 Score = 1134 bits (2934), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 522/691 (75%), Positives = 610/691 (88%), Gaps = 7/691 (1%)

Query: 16  GNLKRRLEETKEDQNSLSTTSNNKRQVIVPACTPKIHYSPLKTGLCYDVRMRYHAKIFTS 75
           G  KR+LE+    Q+        KR VIVP    +IHY+PLKTG+CYDVRMRYHAKIFTS
Sbjct: 10  GESKRKLEDDVASQDV-------KRPVIVPTRKAQIHYTPLKTGICYDVRMRYHAKIFTS 62

Query: 76  YFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKIPVRAATSEEILEVH 135
           YFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGV+D+GDLMLKIP+RAAT+EEILEVH
Sbjct: 63  YFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVNDIGDLMLKIPIRAATAEEILEVH 122

Query: 136 TKEHLEFIESTEKMSREQLLKETEKGDSVYFNNDSYASARLPCGGAIEACKAVVEGRVKN 195
           +KEHLEFIE TEKM+RE+LLKETEKGDSVYFNNDSYA++RLPCGGAIEACKAVVEGRVKN
Sbjct: 123 SKEHLEFIEKTEKMNREELLKETEKGDSVYFNNDSYATSRLPCGGAIEACKAVVEGRVKN 182

Query: 196 SLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKS 255
           SLAVVRPPGHHAEP+AAGGFCLFSNVAVAAKNILKNYPESVRRI+ILDWD+HHGNGTQK+
Sbjct: 183 SLAVVRPPGHHAEPEAAGGFCLFSNVAVAAKNILKNYPESVRRILILDWDVHHGNGTQKA 242

Query: 256 FYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQAGEGKGEGFNCNITWPVGGVGDAEYMWAF 315
           FY DD+VLY+SLHRFE+GKYYPGTIQGQYDQ GEGKG+GFNCNITWPVGGVGDAEYMWAF
Sbjct: 243 FYDDDRVLYISLHRFELGKYYPGTIQGQYDQIGEGKGKGFNCNITWPVGGVGDAEYMWAF 302

Query: 316 EQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVLE 375
           EQVVMPMGREF+PDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVLE
Sbjct: 303 EQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVLE 362

Query: 376 GGYNLDAIARSALSVAKVLIGXXXXXXXXXXXXXXXXVIEMIDKVIRLQSKYWNCFRRRH 435
           GGYNLDAIA SALSVAK+LIG                 +E+IDKVI LQSKYW CF +R+
Sbjct: 363 GGYNLDAIAISALSVAKILIGEPPDELPDPLREPKAEALEIIDKVISLQSKYWKCFGKRY 422

Query: 436 ANSGCNFNEPINDSIVSKNFPLQKAIRQQQQHYLSDEFNLVTLPLINMDLPDNTVLCTPN 495
            N G      +   ++SK+FPLQ AIRQ+Q H LS++F  VTLPL+NM++P ++V+C+PN
Sbjct: 423 GNLGLPSENVVKALMMSKSFPLQTAIRQEQFHQLSEDFGFVTLPLLNMEVPQDSVICSPN 482

Query: 496 VYESTTLLVVVHDTSDIWAKRNVISGTIDLSSSVIIDNCLDFIKWGLDRKYGIIDVNIPL 555
           ++  TT+LVVVHDT +IWAKRNVI+GTID S+S+++D+  +FIKWGL+RKYGI+D+NIP 
Sbjct: 483 LFNETTILVVVHDTPEIWAKRNVITGTIDPSTSLVVDSGAEFIKWGLERKYGIMDINIPQ 542

Query: 556 SLFEPDNYSGMITSQEVLIYLWDNYIKYFPAVAKIAFVGIGDSYSGIVHLLGHRDTRAVT 615
           SLFE +NY+ ++TSQE+LIY+WDNY+K+FP++ K+AF+GIGD+ +GIVHLLGHRDTR+V 
Sbjct: 543 SLFEQENYTAVLTSQEILIYIWDNYLKFFPSLTKVAFIGIGDASAGIVHLLGHRDTRSVV 602

Query: 616 KTVINFLGDKQLKPLVPLVDETLSEWYFKNSLIFSNNSHQCWKENESRKPRKKFGRVLRC 675
           K+V++F+G K LKPLVPLV+E+L +WYFKNSL+F+++SH CW +NE+RKPRKKFGRVLRC
Sbjct: 603 KSVVSFIGKKSLKPLVPLVNESLGDWYFKNSLVFTDHSHSCWGDNENRKPRKKFGRVLRC 662

Query: 676 DTDGLNNTIEERFEEATDFILDSFEEWSDEE 706
           D +G+NN IEER EE+TDFILDSFEEWSD E
Sbjct: 663 DAEGMNNIIEERLEESTDFILDSFEEWSDSE 693

>TDEL0G02160 Chr7 complement(424838..426982) [2145 bp, 714 aa] {ON}
           Anc_2.285 YNL021W
          Length = 714

 Score = 1131 bits (2926), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 522/712 (73%), Positives = 612/712 (85%), Gaps = 8/712 (1%)

Query: 1   MDSEIVKKEAWENPDGNLKRRLEETKE----DQNSLSTTSNNK--RQVIVPACTPKIHYS 54
           MD +IVK E   +    +KR++EE  +     ++ L+ T N    ++VIVPAC P +HY+
Sbjct: 5   MDCDIVKPE--NDTTLQVKRKMEEQNDGLDPKKSQLARTQNGAAGKRVIVPACAPNLHYT 62

Query: 55  PLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDL 114
           PLKT LCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYR+YKILAENGLINDPTLSG+D++
Sbjct: 63  PLKTALCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLINDPTLSGIDEI 122

Query: 115 GDLMLKIPVRAATSEEILEVHTKEHLEFIESTEKMSREQLLKETEKGDSVYFNNDSYASA 174
           GDLMLKIPVR AT EEILEVH+KE+LEF+E + +M RE+LLKETEKGDSVYFNNDSY SA
Sbjct: 123 GDLMLKIPVREATDEEILEVHSKENLEFVERSSRMKREELLKETEKGDSVYFNNDSYVSA 182

Query: 175 RLPCGGAIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPE 234
           +L CGG I+ACKAVVEGRVKN+LAVVRPPGHHAEP+A GGFCLFSNVAVAA+NILK YPE
Sbjct: 183 KLSCGGVIDACKAVVEGRVKNALAVVRPPGHHAEPEAPGGFCLFSNVAVAAQNILKQYPE 242

Query: 235 SVRRIMILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQAGEGKGEG 294
           SVRRI+ILDWDIHHGNGTQK+FY D +VLY+SLHRFEMGKYYPGTI G+YDQ GEGKGEG
Sbjct: 243 SVRRILILDWDIHHGNGTQKAFYNDPRVLYISLHRFEMGKYYPGTINGRYDQTGEGKGEG 302

Query: 295 FNCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSC 354
           FNCNITWPVGGVGDAEYM AFEQ+VMPM REF+PDLVIISSGFDAADGDTIGQCHVTPSC
Sbjct: 303 FNCNITWPVGGVGDAEYMLAFEQIVMPMAREFQPDLVIISSGFDAADGDTIGQCHVTPSC 362

Query: 355 YGHMTHMLKSLARGNLCVVLEGGYNLDAIARSALSVAKVLIGXXXXXXXXXXXXXXXXVI 414
           YG MTHMLKSLARGNLCV LEGGYNLDAIA SALSVAKVLIG                 I
Sbjct: 363 YGQMTHMLKSLARGNLCVALEGGYNLDAIAISALSVAKVLIGEPPDELPDPTKDPKLEAI 422

Query: 415 EMIDKVIRLQSKYWNCFRRRHANSGCNFNEPINDSIVSKNFPLQKAIRQQQQHYLSDEFN 474
           EMID VI  QSKYW CF+R+  N+GCNF+EP+ ++++SK+FPLQ AIRQ+Q   LS E+ 
Sbjct: 423 EMIDTVIHTQSKYWKCFQRKFGNAGCNFSEPVTETVISKSFPLQTAIRQEQFRQLSKEYG 482

Query: 475 LVTLPLINMDLPDNTVLCTPNVYESTTLLVVVHDTSDIWAKRNVISGTIDLSSSVIIDNC 534
            VTLP+  +++PD++VLC+P V++ +T++++VHDT +IWAKR+VI+G ID S+S+I+D+ 
Sbjct: 483 FVTLPISKLEIPDDSVLCSPEVFQQSTIVIIVHDTPEIWAKRDVITGVIDPSTSIIVDSP 542

Query: 535 LDFIKWGLDRKYGIIDVNIPLSLFEPDNYSGMITSQEVLIYLWDNYIKYFPAVAKIAFVG 594
           LDF KW ++RKYG+IDVNIP SLFE DNYS MITSQEVL+Y+WDNYIKYFP++AK+AFVG
Sbjct: 543 LDFTKWCMNRKYGVIDVNIPQSLFEQDNYSAMITSQEVLLYIWDNYIKYFPSLAKVAFVG 602

Query: 595 IGDSYSGIVHLLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETLSEWYFKNSLIFSNNSH 654
            GD+Y+GIVHLLGHRDTRA  K V++F+G KQLKPLVPLVDE+LS+WYFKNSLIF++ +H
Sbjct: 603 FGDAYAGIVHLLGHRDTRATVKAVVSFIGRKQLKPLVPLVDESLSDWYFKNSLIFTDKNH 662

Query: 655 QCWKENESRKPRKKFGRVLRCDTDGLNNTIEERFEEATDFILDSFEEWSDEE 706
            CW +NES+KPRKKFGRVLRCDTDGLN+ +EERFEEATDFILD FEEWSD E
Sbjct: 663 PCWADNESKKPRKKFGRVLRCDTDGLNSNMEERFEEATDFILDLFEEWSDSE 714

>NCAS0G03800 Chr7 (701547..703727) [2181 bp, 726 aa] {ON} 
          Length = 726

 Score = 1128 bits (2918), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 521/694 (75%), Positives = 602/694 (86%), Gaps = 2/694 (0%)

Query: 15  DGNLKRRLEETKEDQ--NSLSTTSNNKRQVIVPACTPKIHYSPLKTGLCYDVRMRYHAKI 72
           D   KR +   KE+        T  ++R VIVP    ++ Y+PLKTGLCYDVRMRYHAKI
Sbjct: 33  DTTQKRNMTAVKEEPELKKQKITDVSERPVIVPPRDAELSYTPLKTGLCYDVRMRYHAKI 92

Query: 73  FTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKIPVRAATSEEIL 132
           FTSYFEYIDPHPEDPRRIYRIYKILAENGLI DPTLSG++D+GDLMLKIPVR AT EEIL
Sbjct: 93  FTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIEDIGDLMLKIPVRDATEEEIL 152

Query: 133 EVHTKEHLEFIESTEKMSREQLLKETEKGDSVYFNNDSYASARLPCGGAIEACKAVVEGR 192
           EVH+KEH +FIE T  M+RE+LLK TEKGDSVYFNNDS+ASA+LP GG+IEACKAVVEGR
Sbjct: 153 EVHSKEHYDFIEKTSTMNREELLKATEKGDSVYFNNDSFASAKLPVGGSIEACKAVVEGR 212

Query: 193 VKNSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGT 252
           VKNSLAVVRPPGHHAEPQAAGGFCLFSNVA+AAKNILKNYPESVRRIMILDWDIHHGNGT
Sbjct: 213 VKNSLAVVRPPGHHAEPQAAGGFCLFSNVAIAAKNILKNYPESVRRIMILDWDIHHGNGT 272

Query: 253 QKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQAGEGKGEGFNCNITWPVGGVGDAEYM 312
           QK+FY DD+VLY+SLHRFE+GKYYPGTI GQYDQ GEGKGEGFNCNITWPVGGVGDAEY+
Sbjct: 273 QKAFYDDDRVLYISLHRFELGKYYPGTINGQYDQTGEGKGEGFNCNITWPVGGVGDAEYI 332

Query: 313 WAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCV 372
           WAFEQVVMPM REF+PDLVIISSGFDAADGD+IGQCHVTPSCYGHMTHMLKSLA+GNLCV
Sbjct: 333 WAFEQVVMPMAREFQPDLVIISSGFDAADGDSIGQCHVTPSCYGHMTHMLKSLAKGNLCV 392

Query: 373 VLEGGYNLDAIARSALSVAKVLIGXXXXXXXXXXXXXXXXVIEMIDKVIRLQSKYWNCFR 432
           VLEGGYNLDAIARSALSVAK+LIG                 IE+IDKVIRLQSKYW CF+
Sbjct: 393 VLEGGYNLDAIARSALSVAKILIGEPPDELPDPLRDPKPEAIEIIDKVIRLQSKYWKCFK 452

Query: 433 RRHANSGCNFNEPINDSIVSKNFPLQKAIRQQQQHYLSDEFNLVTLPLINMDLPDNTVLC 492
           RR+ N+GCNF + IN+S++SKNFPLQ+AIR+QQ + LS +F   TLPL+  +LP +TVLC
Sbjct: 453 RRYGNAGCNFKDEINESLISKNFPLQQAIREQQLNTLSQDFKFATLPLLKPELPKDTVLC 512

Query: 493 TPNVYESTTLLVVVHDTSDIWAKRNVISGTIDLSSSVIIDNCLDFIKWGLDRKYGIIDVN 552
           +PNVY+S T+++  HDT +IWAKR+VI GTID SSS+I+D+ LDFIKW  ++KYG+ID+N
Sbjct: 513 SPNVYQSKTVIICAHDTPEIWAKRDVIQGTIDPSSSIIVDSTLDFIKWANEKKYGVIDIN 572

Query: 553 IPLSLFEPDNYSGMITSQEVLIYLWDNYIKYFPAVAKIAFVGIGDSYSGIVHLLGHRDTR 612
           IP +LFE +NYS ++TSQEVL Y+WDNY+KYFP V K+AF+GIGD+YSGIVHLLGHRDTR
Sbjct: 573 IPQNLFEQENYSAIVTSQEVLTYIWDNYLKYFPNVEKVAFIGIGDAYSGIVHLLGHRDTR 632

Query: 613 AVTKTVINFLGDKQLKPLVPLVDETLSEWYFKNSLIFSNNSHQCWKENESRKPRKKFGRV 672
           +V K+VINF+  KQL+ LVPLVDE+LS+WYFKNSL+FS+ SH  W + E++KPRKK+GR+
Sbjct: 633 SVVKSVINFIAQKQLRALVPLVDESLSDWYFKNSLVFSDKSHTYWGDKENKKPRKKYGRL 692

Query: 673 LRCDTDGLNNTIEERFEEATDFILDSFEEWSDEE 706
           LRC+TDG+NN +EERFEEATDFILDSFEEWSD E
Sbjct: 693 LRCETDGINNIVEERFEEATDFILDSFEEWSDSE 726

>NDAI0G00650 Chr7 complement(141981..144050) [2070 bp, 689 aa] {ON}
           Anc_2.285 YNL021W
          Length = 689

 Score = 1124 bits (2907), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 524/688 (76%), Positives = 595/688 (86%), Gaps = 11/688 (1%)

Query: 30  NSLSTTSNN-----------KRQVIVPACTPKIHYSPLKTGLCYDVRMRYHAKIFTSYFE 78
           N   TTSNN            RQ+IVP    +IHY+PLKTGLCYDVRMRYHAKIFTSYFE
Sbjct: 2   NGGETTSNNDTIKKRKIDPESRQIIVPPRDAQIHYTPLKTGLCYDVRMRYHAKIFTSYFE 61

Query: 79  YIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKIPVRAATSEEILEVHTKE 138
           YIDPHPEDPRRIYRIYKILAENGLI DPTLSG+DD+GDLMLKIPVR ATSEEILEVH+KE
Sbjct: 62  YIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIDDIGDLMLKIPVREATSEEILEVHSKE 121

Query: 139 HLEFIESTEKMSREQLLKETEKGDSVYFNNDSYASARLPCGGAIEACKAVVEGRVKNSLA 198
           HL+FIEST KM+REQLLK TE GDSVYFN+DSYASA+LP GGAIEACKAVVEGRVKN+LA
Sbjct: 122 HLDFIESTSKMNREQLLKATESGDSVYFNSDSYASAKLPVGGAIEACKAVVEGRVKNALA 181

Query: 199 VVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQ 258
           VVRPPGHHAEP+AAGGFCLFSNVA+AAKNILKNYPESVR+I+ILDWDIHHGNGTQK+FY 
Sbjct: 182 VVRPPGHHAEPEAAGGFCLFSNVAIAAKNILKNYPESVRKILILDWDIHHGNGTQKAFYD 241

Query: 259 DDQVLYVSLHRFEMGKYYPGTIQGQYDQAGEGKGEGFNCNITWPVGGVGDAEYMWAFEQV 318
           DD++LYVSLHRF+MGKYYPGTI G+YDQ GEGKGEGFNCNITWPVGGVGDAEYMWAFEQ+
Sbjct: 242 DDRILYVSLHRFKMGKYYPGTIHGRYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQI 301

Query: 319 VMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVLEGGY 378
           VMPMGREF+PDLVIIS+GFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGN+ VVLEGGY
Sbjct: 302 VMPMGREFQPDLVIISAGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNMAVVLEGGY 361

Query: 379 NLDAIARSALSVAKVLIGXXXXXXXXXXXXXXXXVIEMIDKVIRLQSKYWNCFRRRHANS 438
           NLD+IA SALSVAK+LIG                VIEMIDKV+R+QSKYW CF+ +  N+
Sbjct: 362 NLDSIAISALSVAKILIGEPPDELPDVTRDPKPEVIEMIDKVLRIQSKYWKCFKSKFGNA 421

Query: 439 GCNFNEPINDSIVSKNFPLQKAIRQQQQHYLSDEFNLVTLPLINMDLPDNTVLCTPNVYE 498
           GC+F E IN+SI +KNFPLQ AIRQQQ   LS EFN   LP+   +LP++T+LC+ N+YE
Sbjct: 422 GCDFQEQINNSIATKNFPLQSAIRQQQVRNLSKEFNFSELPIYKSELPEDTILCSSNIYE 481

Query: 499 STTLLVVVHDTSDIWAKRNVISGTIDLSSSVIIDNCLDFIKWGLDRKYGIIDVNIPLSLF 558
           S T+++ VHDT +IWAKR+ I GTID SSS+I+D+ LD IKW ++RKYG+ID+NIP +L 
Sbjct: 482 SNTIIICVHDTPEIWAKRDAIQGTIDPSSSIIVDSSLDMIKWAIERKYGVIDINIPQNLL 541

Query: 559 EPDNYSGMITSQEVLIYLWDNYIKYFPAVAKIAFVGIGDSYSGIVHLLGHRDTRAVTKTV 618
           E +NY  +IT+QEVLI LWDNY+KYFP V KIAFVGIGD+YSGIVHLLGHRDTR+V K V
Sbjct: 542 EQENYYSIITAQEVLINLWDNYLKYFPNVNKIAFVGIGDAYSGIVHLLGHRDTRSVVKAV 601

Query: 619 INFLGDKQLKPLVPLVDETLSEWYFKNSLIFSNNSHQCWKENESRKPRKKFGRVLRCDTD 678
           INF+G KQLKPLVPLVDE+L EWYFKNSL+FSN +H  W + E++KPRKK+GRVLRCDTD
Sbjct: 602 INFVGQKQLKPLVPLVDESLGEWYFKNSLVFSNKNHIYWGDKENKKPRKKYGRVLRCDTD 661

Query: 679 GLNNTIEERFEEATDFILDSFEEWSDEE 706
           G++N +EERFEEATDFILDSFEEWSD E
Sbjct: 662 GISNIMEERFEEATDFILDSFEEWSDSE 689

>SAKL0E07700g Chr5 (622822..624960) [2139 bp, 712 aa] {ON} highly
           similar to uniprot|P53973 Saccharomyces cerevisiae
           YNL021W HDA1 Putative catalytic subunit of a class II
           histone deacetylase complex that also contains Hda2p and
           Hda3p Hda1p interacts with the Hda2p-Hda3p subcomplex to
           form an active tetramer deletion increases histone H2B
           H3 and H4 acetylation
          Length = 712

 Score = 1106 bits (2860), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 506/692 (73%), Positives = 593/692 (85%), Gaps = 3/692 (0%)

Query: 17  NLKRRLEETKEDQNSLSTTSNNKRQVIVPACTPKIHYSPLKTGLCYDVRMRYHAKIFTSY 76
           +LKR+++ T ED+      S     VIVP   P+IHY+ LKTGLCYDVRMRYHAKI+TSY
Sbjct: 22  SLKRKVD-TMEDEVESRKRSTGTLPVIVPEVPPRIHYTQLKTGLCYDVRMRYHAKIYTSY 80

Query: 77  FEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKIPVRAATSEEILEVHT 136
           FEYIDPHPEDPRRIYRIYKILAENGLI DPTLSGVD++G+LMLKIPVR AT+EEIL+VHT
Sbjct: 81  FEYIDPHPEDPRRIYRIYKILAENGLIRDPTLSGVDEIGELMLKIPVREATAEEILQVHT 140

Query: 137 KEHLEFIESTEKMSREQLLKETEKGDSVYFNNDSYASARLPCGGAIEACKAVVEGRVKNS 196
           KEHL F+E T KM+REQLLKETE GDSVYFNNDS  SA+L CGGAIEACKAVVEGRVKN+
Sbjct: 141 KEHLAFLEKTPKMTREQLLKETETGDSVYFNNDSLLSAKLSCGGAIEACKAVVEGRVKNA 200

Query: 197 LAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSF 256
           LAV+RPPGHHAEP+ AGGFCLFSNVAVAA+NILKNYPESVRRIMILDWDIHHGNGTQK+F
Sbjct: 201 LAVIRPPGHHAEPEIAGGFCLFSNVAVAAQNILKNYPESVRRIMILDWDIHHGNGTQKAF 260

Query: 257 YQDDQVLYVSLHRFEMGKYYPGTIQGQYDQAGEGKGEGFNCNITWPVGGVGDAEYMWAFE 316
           Y D++VLYVSLHR+E+GKYYPGT+ G Y+Q GEGKGEGFNCNI WP GG+GDAEYMWAF+
Sbjct: 261 YSDNRVLYVSLHRYELGKYYPGTVHGNYEQTGEGKGEGFNCNIPWPYGGLGDAEYMWAFQ 320

Query: 317 QVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVLEG 376
           QVVMPMGREF+PDLVIISSGFDAADGDTIGQCHV+PSCYGHMTHMLKSLARGNLCVVLEG
Sbjct: 321 QVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTHMLKSLARGNLCVVLEG 380

Query: 377 GYNLDAIARSALSVAKVLIGXXXXXXXXXXXXXXXXVIEMIDKVIRLQSKYWNCFRRRHA 436
           GYNLD+IA+SAL VAK+LIG                 IE I+ VIR QSKYWNCF+  H+
Sbjct: 381 GYNLDSIAKSALGVAKILIGEPPDELPHPTQQPKPEAIETIETVIRTQSKYWNCFKSTHS 440

Query: 437 NSGCNFNEPINDSIVSKNFPLQKAIRQQQQHYLSDEFNLVTLPLINMDLPDNTVLCTPNV 496
           N GCNF E + +S +SKNFPLQ+AIRQ+Q   LS++F  VTLPL+NM++P +TV+C+PN+
Sbjct: 441 NDGCNFKEEVTESTISKNFPLQQAIRQEQLQQLSEKFGFVTLPLLNMEVPQDTVICSPNI 500

Query: 497 YESTTLLVVVHDTSDIWAKRNVISGTIDLSSSVIIDNCLDFIKWGLDRKYGIIDVNIPLS 556
           Y++ T++V VHDT +IWA+RN I+GTID S+S+I+D  LD IKW L RKY +IDVNIP S
Sbjct: 501 YDAETVVVCVHDTPEIWAQRNPITGTIDPSTSIIVDTTLDIIKWSLQRKYSVIDVNIPQS 560

Query: 557 LFEPDNYSGMITSQEVLIYLWDNYIKYFPAVAKIAFVGIGDSYSGIVHLLGHRDTRAVTK 616
           LFE DNYS MITSQEVL+Y+WDNY+KYFP++AK+AF+G+GD+YSGIVHLLGHRDTR+V K
Sbjct: 561 LFEQDNYSAMITSQEVLVYIWDNYLKYFPSLAKVAFIGVGDAYSGIVHLLGHRDTRSVVK 620

Query: 617 TVINFLGDKQLKPLVPLVDETLSEWYFKNSLIFSNNSHQCWKE--NESRKPRKKFGRVLR 674
             ++F+  K LK LVPLVDE+L  WYFKNSL+F++ +H CW    NE++KPRK+FGRVL+
Sbjct: 621 AAVSFVDTKPLKSLVPLVDESLGNWYFKNSLVFTSKNHSCWGTDGNENKKPRKRFGRVLK 680

Query: 675 CDTDGLNNTIEERFEEATDFILDSFEEWSDEE 706
           CDT G+NN +EERF+EATDFILDSFEEWSD E
Sbjct: 681 CDTTGMNNIVEERFQEATDFILDSFEEWSDSE 712

>KNAG0H02010 Chr8 (354923..357004) [2082 bp, 693 aa] {ON} Anc_2.285
           YNL021W
          Length = 693

 Score = 1100 bits (2845), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 506/685 (73%), Positives = 584/685 (85%), Gaps = 2/685 (0%)

Query: 24  ETKEDQNSLSTTSNNKRQVIVPACTPKIHYSPLKTGLCYDVRMRYHAKIFTSYFEYIDPH 83
           E  + Q    +++++KRQ+IV  C PK+ Y+PLKTGLCYDVRMRYHAKIFTSYFEYIDPH
Sbjct: 9   ENPDSQKPAESSTHSKRQMIVAPCAPKLRYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPH 68

Query: 84  PEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKIPVRAATSEEILEVHTKEHLEFI 143
           PEDPRRIYRIYKILAENGLI DP LSG+DD+GDLMLKIPVR ATS+E+LEVH+KEHLEFI
Sbjct: 69  PEDPRRIYRIYKILAENGLITDPMLSGIDDIGDLMLKIPVREATSQEVLEVHSKEHLEFI 128

Query: 144 ESTEKMSREQLLKETEKGDSVYFNNDSYASARLPCGGAIEACKAVVEGRVKNSLAVVRPP 203
           ES  KMS ++LLK TE GDSVYFNNDS +SA+L CGGAIEACKAVVEGRVKN+ AVVRPP
Sbjct: 129 ESVTKMSHDELLKSTETGDSVYFNNDSSSSAKLSCGGAIEACKAVVEGRVKNAFAVVRPP 188

Query: 204 GHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVL 263
           GHH+EP++AGGFCLFSNVAVA+KNIL+NYPESVRRIMILDWDIHHGNGTQK+FY DD+VL
Sbjct: 189 GHHSEPESAGGFCLFSNVAVASKNILRNYPESVRRIMILDWDIHHGNGTQKAFYDDDRVL 248

Query: 264 YVSLHRFEMGKYYPGTIQGQYDQAGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMG 323
           Y+SLHRFE+GKYYPGT QG YD+ GEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPM 
Sbjct: 249 YISLHRFELGKYYPGTAQGHYDKTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMS 308

Query: 324 REFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAI 383
           REF+PDLVIIS+GFDAADGDTIGQCHV+PSCYGHMTHMLKSLA GNLCVVLEGGYNLDAI
Sbjct: 309 REFRPDLVIISAGFDAADGDTIGQCHVSPSCYGHMTHMLKSLANGNLCVVLEGGYNLDAI 368

Query: 384 ARSALSVAKVLIGXXXXXXXXXXXXXXXXVIEMIDKVIRLQSKYWNCFRRRHANSGCNFN 443
           ARSALSVAKVLIG                 IE+I+KVIRLQSKYW CF+RRH NSGC F 
Sbjct: 369 ARSALSVAKVLIGEPPEELLDPVKDPKPEAIEIINKVIRLQSKYWKCFQRRHGNSGCTFE 428

Query: 444 EPINDSIVSKNFPLQKAIRQQQQHYLSDEFNLVTLPLINMDLPDNTVLCTPNVYESTTLL 503
           + + +SI + NFPLQ AIRQQQ   LS EF  V  PL  M L D+TV+C+P VY   T++
Sbjct: 429 KHMTESISTDNFPLQSAIRQQQFSALSKEFGFVKFPLFEMKLSDDTVICSPEVYNKDTII 488

Query: 504 VVVHDTSDIWAKRNVISGTIDLSSSVIIDNCLDFIKWGLDRKYGIIDVNIPLSLFEPDNY 563
           ++V DT +IWAKR+VI GTID S+S+I D  L FIKW ++R YG+IDVNIP SLFE DNY
Sbjct: 489 ILVRDTPEIWAKRDVIQGTIDPSASIITDAALAFIKWAMERNYGVIDVNIPQSLFEQDNY 548

Query: 564 SGMITSQEVLIYLWDNYIKYFPAVAKIAFVGIGDSYSGIVHLLGHRDTRAVTKTVINFLG 623
           S MIT+QEV+ ++WDNYI++F + +KIAFVG+GD+ SGIVHLLGHRDTR+  K+VINF+ 
Sbjct: 549 SAMITAQEVMSFMWDNYIRFFGSASKIAFVGVGDACSGIVHLLGHRDTRSKVKSVINFIA 608

Query: 624 DKQLKPLVPLVDETLSEWYFKNSLIFSNNSHQCW--KENESRKPRKKFGRVLRCDTDGLN 681
            K LKPL+PLVDETL +WYFKNSL+FS+ +H CW   ENE++KPRKKFGRVLRC++DGL 
Sbjct: 609 QKTLKPLIPLVDETLGDWYFKNSLVFSDKNHACWGDNENENKKPRKKFGRVLRCNSDGLT 668

Query: 682 NTIEERFEEATDFILDSFEEWSDEE 706
           N IEERFEEATDF+LDSFEEWS+ +
Sbjct: 669 NIIEERFEEATDFMLDSFEEWSESD 693

>KAFR0H03320 Chr8 (633105..635213) [2109 bp, 702 aa] {ON} Anc_2.285
           YNL021W
          Length = 702

 Score = 1091 bits (2821), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 508/696 (72%), Positives = 592/696 (85%), Gaps = 8/696 (1%)

Query: 15  DGNLKRRLEETKEDQNSLSTTSNNKRQVIVPACTPKIHYSPLKTGLCYDVRMRYHAKIFT 74
           +G+ KR+ EE  E+  SL+     KRQVIVP   P++HY PLKTGLCYDVRMRYHAKIFT
Sbjct: 11  EGSTKRKQEE--ENLESLNVVP--KRQVIVPTKKPQVHYIPLKTGLCYDVRMRYHAKIFT 66

Query: 75  SYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKIPVRAATSEEILEV 134
           SYFEYIDPHPEDPRRIYRIYKILAENGLIND  LSGVDD+GD+MLKIPVR AT++EILEV
Sbjct: 67  SYFEYIDPHPEDPRRIYRIYKILAENGLINDTMLSGVDDIGDIMLKIPVREATADEILEV 126

Query: 135 HTKEHLEFIESTEKMSREQLLKETEKGDSVYFNNDSYASARLPCGGAIEACKAVVEGRVK 194
           H++EHLEF+EST  M+RE LLKETEKGDSVYFNNDSY SA+L CGGAIEACKAVVEG+VK
Sbjct: 127 HSREHLEFLESTTTMNREVLLKETEKGDSVYFNNDSYMSAKLSCGGAIEACKAVVEGKVK 186

Query: 195 NSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQK 254
           N+LAVVRPPGHH+EP+++GGFCLFSNVAVAAKNILKNYPESVR+IMILDWDIHHGNGTQK
Sbjct: 187 NALAVVRPPGHHSEPESSGGFCLFSNVAVAAKNILKNYPESVRKIMILDWDIHHGNGTQK 246

Query: 255 SFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQAGEGKGEGFNCNITWPVGGVGDAEYMWA 314
           +FYQD++VLYVSLHRFE GKYYPGT+QGQYDQ GEGKGEGFNCNITWP GGVGDAEYMWA
Sbjct: 247 AFYQDERVLYVSLHRFEAGKYYPGTVQGQYDQCGEGKGEGFNCNITWPTGGVGDAEYMWA 306

Query: 315 FEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVL 374
           FEQ+VMPMGREF+PDLVIISSGFDAADGD IGQCHVTPSCYGHMTHMLKSLARGNL VVL
Sbjct: 307 FEQIVMPMGREFQPDLVIISSGFDAADGDVIGQCHVTPSCYGHMTHMLKSLARGNLVVVL 366

Query: 375 EGGYNLDAIARSALSVAKVLIGXXXXXXXXXXXXXXXXVIEMIDKVIRLQSKYWNCFRRR 434
           EGGYNLD+IA SALSVAK LIG                 +EMI KVI++QSKYW CF+RR
Sbjct: 367 EGGYNLDSIAISALSVAKTLIGEPPDELPDPLKDPKPEALEMIYKVIKIQSKYWKCFKRR 426

Query: 435 HANSGCNFNEPINDSIVSKNFPLQKAIRQQQQHYLSDEFNLVTLPLINMDLPDNTVLCTP 494
           H N   NF+E  +D++ +K FPLQ AIRQQQ + L  E++ V  P  N+ LPD+ +LC+P
Sbjct: 427 HGNYNINFSEVASDTLATKTFPLQTAIRQQQYYNLFKEYDFVKFPTANLKLPDDLILCSP 486

Query: 495 NVYESTTLLVVVHDTSDIWAKRNVISGTIDLSSSVIIDNCLDFIKWGLDRKYGIIDVNIP 554
           N++ + T++++VHDT  IW ++++IS T+D  SS+IID+ LDF+KW  +RKYGIIDVNIP
Sbjct: 487 NIHTAETVIIIVHDTPQIWLEKDIISNTVDPCSSIIIDSTLDFLKWAHNRKYGIIDVNIP 546

Query: 555 LSLF----EPDNYSGMITSQEVLIYLWDNYIKYFPAVAKIAFVGIGDSYSGIVHLLGHRD 610
            SL      PDNYS +I +QE+L++LWDN+IK+   V KIAF+G+GDS SG+VHLLGHRD
Sbjct: 547 QSLIYGDENPDNYSSLINAQEILLFLWDNHIKFLNEVNKIAFIGVGDSVSGVVHLLGHRD 606

Query: 611 TRAVTKTVINFLGDKQLKPLVPLVDETLSEWYFKNSLIFSNNSHQCWKENESRKPRKKFG 670
           T+   K VINF+ DKQLKPLVPLVDE+LS+WYFKNSL+FSN +H CW + E++KPRKK+G
Sbjct: 607 TKERVKAVINFMADKQLKPLVPLVDESLSDWYFKNSLVFSNRTHPCWGDKENKKPRKKYG 666

Query: 671 RVLRCDTDGLNNTIEERFEEATDFILDSFEEWSDEE 706
           RVLRCDTDGLN+TIEERF+EATDFILDSFEEWSD E
Sbjct: 667 RVLRCDTDGLNSTIEERFDEATDFILDSFEEWSDSE 702

>KLTH0G10340g Chr7 complement(874566..876692) [2127 bp, 708 aa] {ON}
           highly similar to uniprot|P53973 Saccharomyces
           cerevisiae YNL021W HDA1 Putative catalytic subunit of a
           class II histone deacetylase complex that also contains
           Hda2p and Hda3p Hda1p interacts with the Hda2p-Hda3p
           subcomplex to form an active tetramer deletion increases
           histone H2B H3 and H4 acetylation
          Length = 708

 Score = 1081 bits (2795), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 495/706 (70%), Positives = 591/706 (83%), Gaps = 4/706 (0%)

Query: 3   SEIVKKEAWENPDGNLKRRLEETKEDQNSLSTTSNNKRQVIVPACTPKIHYSPLKTGLCY 62
           +E+ ++E  E  +G LKR  E    +  + +  S  KR  IVPAC PK+HY+PLKTGLCY
Sbjct: 5   AEVKQEEPSEQING-LKRDHESATLNDGTGNQASVAKRPTIVPACRPKLHYTPLKTGLCY 63

Query: 63  DVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKIP 122
           DVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLI+DPTLSGVD +GDLMLKIP
Sbjct: 64  DVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIDDPTLSGVDSIGDLMLKIP 123

Query: 123 VRAATSEEILEVHTKEHLEFIESTEKMSREQLLKETEKGDSVYFNNDSYASARLPCGGAI 182
           VR AT EEIL+VHTKEHLEFI  T  M+R+QLLKETEKGDSVYFNNDSY SA+L CGGAI
Sbjct: 124 VREATDEEILQVHTKEHLEFISKTTSMTRDQLLKETEKGDSVYFNNDSYLSAKLSCGGAI 183

Query: 183 EACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMIL 242
           EACKAVVEGRVKN+LAVVRPPGHHAEP+ AGGFCLFSNVAVAA+NILKNYPESVR+IM+L
Sbjct: 184 EACKAVVEGRVKNALAVVRPPGHHAEPEVAGGFCLFSNVAVAAQNILKNYPESVRKIMVL 243

Query: 243 DWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQAGEGKGEGFNCNITWP 302
           DWD+HHGNGTQK+FY DD+VLY+SLHR E+GKYYPGTI G  D+ GEGKGEGFNCNI WP
Sbjct: 244 DWDVHHGNGTQKAFYDDDRVLYISLHRHELGKYYPGTIHGNSDRVGEGKGEGFNCNIPWP 303

Query: 303 VGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHML 362
             GVGD+EY+WAFEQV+MPMGREF+PDLVIISSGFDAADGDT+GQCHVTPSCYGHMTHML
Sbjct: 304 WKGVGDSEYLWAFEQVIMPMGREFRPDLVIISSGFDAADGDTVGQCHVTPSCYGHMTHML 363

Query: 363 KSLARGNLCVVLEGGYNLDAIARSALSVAKVLIGXXXXXXXXXXXXXXXXVIEMIDKVIR 422
           KSLARGNLC VLEGGY+LD+IA+SAL+VAKVLIG                V E+ID VI+
Sbjct: 364 KSLARGNLCAVLEGGYSLDSIAKSALAVAKVLIGEPPDELPVVKQPKLEAV-EVIDSVIK 422

Query: 423 LQSKYWNCFRRRHANSGCNFNEPINDSIVSKNFPLQKAIRQQQQHYLSDEFNLVTLPLIN 482
            QSKYW CF+  H N GC+F E   D+ ++KNFPLQ AIRQQQ   L++EF  VTLPL  
Sbjct: 423 TQSKYWKCFKSTHGNDGCSFKEQATDTAINKNFPLQNAIRQQQMRLLANEFRFVTLPLFK 482

Query: 483 MDLPDNTVLCTPNVYESTTLLVVVHDTSDIWAKRNVISGTIDLSSSVIIDNCLDFIKWGL 542
            +LPD+T +C+PN+Y+++ ++V VHDT  IWA+R+  +GTID S+S+I+D  LD IKW  
Sbjct: 483 KELPDDTAICSPNIYDASAIIVCVHDTPSIWAQRSRATGTIDPSTSIIVDTTLDVIKWAS 542

Query: 543 DRKYGIIDVNIPLSLFEPDNYSGMITSQEVLIYLWDNYIKYFPAVAKIAFVGIGDSYSGI 602
            R YG+ID+NIP SL E DNYS +IT+QEVL+++WDNY+KYFP++ ++AFV IGD++SG+
Sbjct: 543 SRNYGVIDINIPQSLHEQDNYSAVITAQEVLVHIWDNYLKYFPSLNRVAFVAIGDAHSGV 602

Query: 603 VHLLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETLSEWYFKNSLIFSNNSHQCWKE--N 660
           VHLLGHRDTR+V K+ ++F+  + L+PL+PLVDETL++WYFKNSL+F++  H CW    N
Sbjct: 603 VHLLGHRDTRSVVKSAVSFVDQRPLRPLIPLVDETLADWYFKNSLVFASAEHTCWGNDGN 662

Query: 661 ESRKPRKKFGRVLRCDTDGLNNTIEERFEEATDFILDSFEEWSDEE 706
           E++KPRKKFGRVL+CD+DG+NN +EERFEEATDFILD+FEEWSD E
Sbjct: 663 ENKKPRKKFGRVLKCDSDGINNILEERFEEATDFILDTFEEWSDSE 708

>Kwal_27.11537 s27 (839198..841324) [2127 bp, 708 aa] {ON} YNL021W
           (HDA1) - histone deacetylase, shares sequence similarity
           with Rpd3p, Hos1p, Hos2p, and Hos3p [contig 27] FULL
          Length = 708

 Score = 1071 bits (2771), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 492/703 (69%), Positives = 588/703 (83%), Gaps = 3/703 (0%)

Query: 6   VKKEAWENPDGNLKRRLEETKEDQNSLSTTSNNKRQVIVPACTPKIHYSPLKTGLCYDVR 65
           +K+E     +   KR  E    ++ +  + +  KR VIVPAC  K+HY+PLKTGLCYDVR
Sbjct: 7   IKQEDSLKQENGFKRDAENALLEEENGGSETKVKRPVIVPACRAKLHYTPLKTGLCYDVR 66

Query: 66  MRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKIPVRA 125
           MRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLI DPTLSGVDD+GDLMLKIP R 
Sbjct: 67  MRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIIDPTLSGVDDIGDLMLKIPARE 126

Query: 126 ATSEEILEVHTKEHLEFIESTEKMSREQLLKETEKGDSVYFNNDSYASARLPCGGAIEAC 185
           AT EEIL+VHT EHLEF+  T  M+REQLLKETEKGDSVYFNNDSY SA+L CGGAIEAC
Sbjct: 127 ATDEEILQVHTPEHLEFLSKTTSMTREQLLKETEKGDSVYFNNDSYLSAKLSCGGAIEAC 186

Query: 186 KAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWD 245
           +AVVEGRVKN+LAVVRPPGHHAEP  AGGFCLFSNVAVAA+NILKNYPESV++IMILDWD
Sbjct: 187 RAVVEGRVKNALAVVRPPGHHAEPDLAGGFCLFSNVAVAAQNILKNYPESVKKIMILDWD 246

Query: 246 IHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQAGEGKGEGFNCNITWPVGG 305
           +HHGNGTQK+FY DD+VLYVSLHR E+GKYYPGTI G  D+ GEGKGEGFNCNI WP  G
Sbjct: 247 VHHGNGTQKAFYNDDRVLYVSLHRHELGKYYPGTIHGNADRVGEGKGEGFNCNIPWPWKG 306

Query: 306 VGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSL 365
           VGDAEY+WAFEQVV+PMGREF+PDLVIISSGFDAADGDT+GQCHVTPSCYGHMTHMLKSL
Sbjct: 307 VGDAEYIWAFEQVVLPMGREFQPDLVIISSGFDAADGDTVGQCHVTPSCYGHMTHMLKSL 366

Query: 366 ARGNLCVVLEGGYNLDAIARSALSVAKVLIGXXXXXXXXXXXXXXXXVIEMIDKVIRLQS 425
           ARGN+C VLEGGY+LD+IA+SAL VAKVLIG                V E+ID VI++QS
Sbjct: 367 ARGNICAVLEGGYSLDSIAKSALGVAKVLIGEPPDELPVVKQPKPEAV-EVIDAVIKMQS 425

Query: 426 KYWNCFRRRHANSGCNFNEPINDSIVSKNFPLQKAIRQQQQHYLSDEFNLVTLPLINMDL 485
           +YW CF+  HAN GC+F EP+ ++++++NFPLQ AIRQQQ   L+ E+N VTLPLI  +L
Sbjct: 426 RYWQCFKSTHANDGCSFKEPVTETLLNRNFPLQTAIRQQQVRLLTTEYNFVTLPLIKKEL 485

Query: 486 PDNTVLCTPNVYESTTLLVVVHDTSDIWAKRNVISGTIDLSSSVIIDNCLDFIKWGLDRK 545
           PD+T LC+PN+Y+S +++V VHDT +IWA+R+  +GTID S+S+I+D  LD IKW   R 
Sbjct: 486 PDDTALCSPNIYDSQSIIVCVHDTPEIWAQRSRATGTIDPSTSIIVDTTLDVIKWASKRN 545

Query: 546 YGIIDVNIPLSLFEPDNYSGMITSQEVLIYLWDNYIKYFPAVAKIAFVGIGDSYSGIVHL 605
           YG+ID+NIP SL E DNYS ++T+QEVL+Y+WD+Y+KYF +++K+AFV IGD+YSG+VHL
Sbjct: 546 YGVIDINIPQSLHEQDNYSAVLTAQEVLVYIWDSYLKYFTSLSKVAFVSIGDAYSGVVHL 605

Query: 606 LGHRDTRAVTKTVINFLGDKQLKPLVPLVDETLSEWYFKNSLIFSNNSHQCWKEN--ESR 663
           LGHRDTR V K  I+F+  + L+PLVPLVDE+L++WYFKNSL+F++  H CW  +  E++
Sbjct: 606 LGHRDTRNVVKAAISFIDQRPLRPLVPLVDESLADWYFKNSLVFASAGHTCWGNDGAENK 665

Query: 664 KPRKKFGRVLRCDTDGLNNTIEERFEEATDFILDSFEEWSDEE 706
           KPRKKFGRVL+C++DGLNN +EERFEEATDFILD+FEEWSD E
Sbjct: 666 KPRKKFGRVLKCNSDGLNNILEERFEEATDFILDTFEEWSDSE 708

>Ecym_3324 Chr3 complement(620836..622956) [2121 bp, 706 aa] {ON}
           similar to Ashbya gossypii ADL216C
          Length = 706

 Score = 1055 bits (2728), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 488/708 (68%), Positives = 587/708 (82%), Gaps = 4/708 (0%)

Query: 1   MDSEIVKKEAWENPDGNLKRRLEETKEDQNSLSTTSNNKRQVIVPACTPKIHYSPLKTGL 60
           M+ E  +K   E  DGN    +E  K   + L T +  KR +IVP   PKIHY PLKTGL
Sbjct: 1   MNQESKQKRKLE-IDGNDTIGVENMKTAVSKL-TVAQQKRPIIVPVVKPKIHYVPLKTGL 58

Query: 61  CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLK 120
           CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLI DPTLSGVDD+G+LMLK
Sbjct: 59  CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGVDDIGNLMLK 118

Query: 121 IPVRAATSEEILEVHTKEHLEFIESTEKMSREQLLKETEKGDSVYFNNDSYASARLPCGG 180
           IP+R AT +EIL VH+KEH+EF+++T  MSREQLLKETE GDSVY+NNDS  SA+L CGG
Sbjct: 119 IPIREATEDEILLVHSKEHVEFLKTTNTMSREQLLKETEAGDSVYYNNDSLVSAKLSCGG 178

Query: 181 AIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIM 240
           AIEACKAVVEGRVKN+LAVVRPPGHHAEP+ AGGFCLFSNVAVAA+NILKNYPESVR++M
Sbjct: 179 AIEACKAVVEGRVKNALAVVRPPGHHAEPEVAGGFCLFSNVAVAARNILKNYPESVRKVM 238

Query: 241 ILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQAGEGKGEGFNCNIT 300
           ILDWDIHHGNGTQ++FY D++VLYVSLHR+E+G+YYPGT  G Y+Q+GEGKGEGFNCNI 
Sbjct: 239 ILDWDIHHGNGTQRAFYNDNRVLYVSLHRYELGRYYPGTEYGNYNQSGEGKGEGFNCNIP 298

Query: 301 WPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTH 360
           W  GGVGDAEYMWAFEQ+V+PMGREF+PDLVIISSGFDAADGDTIGQCHV+P+CYGHMTH
Sbjct: 299 WSCGGVGDAEYMWAFEQIVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACYGHMTH 358

Query: 361 MLKSLARGNLCVVLEGGYNLDAIARSALSVAKVLIGXXXXXXXXXXXXXXXXVIEMIDKV 420
           MLKSLA+GN+CVVLEGGYNLD+IA+SAL V KVLIG                 I  I+ V
Sbjct: 359 MLKSLAKGNMCVVLEGGYNLDSIAKSALGVVKVLIGEPPDELPDPFKQPKPEAIATIETV 418

Query: 421 IRLQSKYWNCFRRRHANSGCNFNEPINDSIVSKNFPLQKAIRQQQQHYLSDEFNLVTLPL 480
           IR Q+KYW+CF+ +H N G N+ EP+++S+  KNFPLQ A+RQ+Q   LS E+  VTLPL
Sbjct: 419 IREQAKYWDCFKSKHGNCGVNWKEPVDESLTFKNFPLQSAVRQEQFRRLSKEYKFVTLPL 478

Query: 481 INMDLPDNTVLCTPNVYESTTLLVVVHDTSDIWAKRNVISGTIDLSSSVIIDNCLDFIKW 540
           ++M+L  +T++C+PN++E+ TL++ VHDT ++WAKRN ++G ID S+S+I+D  L    W
Sbjct: 479 LDMELSGDTIICSPNIHETDTLIICVHDTPEVWAKRNPLTGYIDPSTSIIVDTTLSITNW 538

Query: 541 GLDRKYGIIDVNIPLSLFEPDNYSGMITSQEVLIYLWDNYIKYFPAVAKIAFVGIGDSYS 600
            L R YGIID+NIP SLFE DNYS ++TSQEVL YLWD+Y+K+F  + ++AFVGIGD+YS
Sbjct: 539 ALGRSYGIIDINIPQSLFELDNYSAVLTSQEVLSYLWDHYLKFFAQLTRVAFVGIGDAYS 598

Query: 601 GIVHLLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETLSEWYFKNSLIFSNNSHQCW--K 658
           G VHLLGHRDTR++ K  I+F   KQL+PLVPLVDE++S+WYFKNSLIF++  H CW  +
Sbjct: 599 GFVHLLGHRDTRSIVKCAISFTDKKQLRPLVPLVDESISDWYFKNSLIFTSKYHSCWGTE 658

Query: 659 ENESRKPRKKFGRVLRCDTDGLNNTIEERFEEATDFILDSFEEWSDEE 706
            N+S+KPRKKFGRVL+C++DG+NN +EERFEEATDFILDSFEEWSD E
Sbjct: 659 GNDSKKPRKKFGRVLKCNSDGMNNILEERFEEATDFILDSFEEWSDSE 706

>KLLA0E08383g Chr5 (754048..756162) [2115 bp, 704 aa] {ON} highly
           similar to uniprot|P53973 Saccharomyces cerevisiae
           YNL021W HDA1 Putative catalytic subunit of a class II
           histone deacetylase complex that also contains Hda2p and
           Hda3p Hda1p interacts with the Hda2p-Hda3p subcomplex to
           form an active tetramer deletion increases histone H2B
           H3 and H4 acetylation
          Length = 704

 Score = 1033 bits (2672), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 477/710 (67%), Positives = 577/710 (81%), Gaps = 10/710 (1%)

Query: 1   MDSEIVKKEAWENPDGNLKRRLEETKEDQN--SLSTTSNNKRQVIVPACTPKIHYSPLKT 58
           M+S+   +E  E P       ++E K +    +L +   ++R VIVP   PKI YS LKT
Sbjct: 1   MESKKPAEEPLERPS------IKEIKNEGTAYTLPSKDESQRPVIVPPTKPKIRYSLLKT 54

Query: 59  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLM 118
           G+CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYR+YKILAENGLI DPTLSG D +GDLM
Sbjct: 55  GICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLIQDPTLSGADSIGDLM 114

Query: 119 LKIPVRAATSEEILEVHTKEHLEFIESTEKMSREQLLKETEKGDSVYFNNDSYASARLPC 178
           +K+PVR A  EEIL+VH+++HL+FI  TE++ RE LLKETE GDSVYFNNDSY SA+L C
Sbjct: 115 VKVPVREAEEEEILQVHSRQHLDFISQTEQLERESLLKETEGGDSVYFNNDSYLSAKLSC 174

Query: 179 GGAIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRR 238
           GGAIEACKAVVEGRVKNS+AVVRPPGHHAEP+ AGGFCLFSNVAVAA N+LK+YPESVR+
Sbjct: 175 GGAIEACKAVVEGRVKNSIAVVRPPGHHAEPEIAGGFCLFSNVAVAAANMLKSYPESVRK 234

Query: 239 IMILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQAGEGKGEGFNCN 298
           IMI+DWDIHHGNGTQK+FY DD+VLYVSLHR+++GKYYPGTI G YDQ GEGKGEGFNCN
Sbjct: 235 IMIVDWDIHHGNGTQKAFYDDDRVLYVSLHRYQLGKYYPGTIHGNYDQTGEGKGEGFNCN 294

Query: 299 ITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHM 358
           ITWP GGVGDAEYMWAFEQV+MPMGREF+PDLV+ISSGFDAADGDTIGQCHVTP+CYGHM
Sbjct: 295 ITWPTGGVGDAEYMWAFEQVIMPMGREFEPDLVLISSGFDAADGDTIGQCHVTPACYGHM 354

Query: 359 THMLKSLARGNLCVVLEGGYNLDAIARSALSVAKVLIGXXXXXXXXXXXXXXXXVIEMID 418
           THML SLA+GNLCVVLEGGYNLD+IA+SAL V KVL+G                  +MI+
Sbjct: 355 THMLLSLAKGNLCVVLEGGYNLDSIAKSALGVCKVLVGEPPDELPAPKKQPTPEAKKMIE 414

Query: 419 KVIRLQSKYWNCFRRRHANSGCNFNEPINDSIVSKNFPLQKAIRQQQQHYLSDEFNLVTL 478
            VIR QSKYW+CF+ RH N G NF + I  ++ ++NFPLQ AIR+ Q   LS +FN V L
Sbjct: 415 TVIRTQSKYWSCFKNRHGNDGINFKDAITSTLDTRNFPLQNAIREYQVSQLSSQFNFVQL 474

Query: 479 PLINMDLPDNTVLCTPNVYESTTLLVVVHDTSDIWAKRNVISGTIDLSSSVIIDNCLDFI 538
           P+++++LP NT+LCT  + +S TL+V+VHDT +IW++R+  +G ID SSS+I+DN L  I
Sbjct: 475 PILDLNLPANTMLCTSGIQDSETLVVIVHDTPEIWSERDTQTGIIDPSSSIIVDNALKMI 534

Query: 539 KWGLDRKYGIIDVNIPLSLFEPDNYSGMITSQEVLIYLWDNYIKYFPAVAKIAFVGIGDS 598
            W +DR+YGIID+NIP +LFE  NY G+ +SQE+LIYLWDNY+K+F  + K+AF+GIGD+
Sbjct: 535 NWAMDRRYGIIDINIPQTLFEHANYPGVASSQEILIYLWDNYLKFFQNLQKVAFIGIGDA 594

Query: 599 YSGIVHLLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETLSEWYFKNSLIFSNNSHQCW- 657
           Y GIVHLLGHRDTR+V K  I+FL  K LK +VPL+DETL +WYFKNSL+F++++H CW 
Sbjct: 595 YGGIVHLLGHRDTRSVVKCAISFLDKKPLKVMVPLIDETLGDWYFKNSLVFTSSTHSCWG 654

Query: 658 -KENESRKPRKKFGRVLRCDTDGLNNTIEERFEEATDFILDSFEEWSDEE 706
              NE++K RKK+GRVL+ D DG+ N  +ERFEEATDFILDSFEEWS+ E
Sbjct: 655 STANENKKLRKKYGRVLKADCDGMTNIFDERFEEATDFILDSFEEWSESE 704

>ADL216C Chr4 complement(324197..326314) [2118 bp, 705 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL021W
           (HDA1)
          Length = 705

 Score = 1019 bits (2636), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 480/698 (68%), Positives = 566/698 (81%), Gaps = 10/698 (1%)

Query: 19  KRRLEETKEDQNSLSTTSN-----NKRQVIVPACTPKIHYSPLKTGLCYDVRMRYHAKIF 73
           KR+LEE   D  +    ++      KR VIVP   PKI Y PLKTGLCYDVRMRYHAKIF
Sbjct: 8   KRKLEEGSPDGEANGGQASRKAIVQKRPVIVPPVRPKISYVPLKTGLCYDVRMRYHAKIF 67

Query: 74  TSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKIPVRAATSEEILE 133
           TSYFEYIDPHPEDPRRIYRIYKILAENGLI DPTLSG+D++G+LM KIPVR AT EEIL 
Sbjct: 68  TSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGIDEIGELMQKIPVREATEEEILT 127

Query: 134 VHTKEHLEFIESTEKMSREQLLKETEKGDSVYFNNDSYASARLPCGGAIEACKAVVEGRV 193
           VH+KEH+EF+++T  M REQLLKETE GDSVY+NNDS  SARL CGGAIEACKAVVEGRV
Sbjct: 128 VHSKEHVEFLKTTNTMDREQLLKETEAGDSVYYNNDSLISARLSCGGAIEACKAVVEGRV 187

Query: 194 KNSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQ 253
           KN++AVVRPPGHHAEP  AGGFCLFSNVAVAA+NILKNYPESVRR+MILDWDIHHGNGTQ
Sbjct: 188 KNAMAVVRPPGHHAEPGVAGGFCLFSNVAVAAQNILKNYPESVRRVMILDWDIHHGNGTQ 247

Query: 254 KSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQAGEGKGEGFNCNITWPVGGVGDAEYMW 313
           K+FY D++VLYVSLHR+E+GKYYPGT  G YDQ G+GKGEGFNCNI W   GVGDAEYMW
Sbjct: 248 KAFYGDNRVLYVSLHRYELGKYYPGTSYGNYDQCGDGKGEGFNCNIPWSCSGVGDAEYMW 307

Query: 314 AFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVV 373
           AFEQVV+PMGREF+PDLVIISSGFDAADGDTIGQCHV+P+CYGH+THMLKSLARGN+CVV
Sbjct: 308 AFEQVVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACYGHLTHMLKSLARGNMCVV 367

Query: 374 LEGGYNLDAIARSALSVAKVLIGXXXXXXXXXXXXXXXXVIEMID-KVIRLQSKYWNCFR 432
           LEGGYNLD+IA+SAL VAKVLIG                 I  ID  +++ QSKYWNCF+
Sbjct: 368 LEGGYNLDSIAKSALGVAKVLIGEPPDELPQPLKQPKPEAIVTIDMGLVKEQSKYWNCFK 427

Query: 433 RRHANSGCNFNE-PINDSIVSKNFPLQKAIRQQQQ-HYLSDEFNLVTLPLINMDLPDNTV 490
            RH N G N+ E  +NDS+ SKNFPLQK      Q   L+ E+  VTLPL+NM+LP +T+
Sbjct: 428 GRHGNDGINWREGAVNDSLTSKNFPLQKCCSPTTQFRRLAKEYKFVTLPLLNMELPSDTI 487

Query: 491 LCTPNVYESTTLLVVVHDTSDIWAKRNVISGTIDLSSSVIIDNCLDFIKWGLDRKYGIID 550
           +C+PN++ +  +++ VHDT +IWA+R+ ++G ID S+S+I+D  +  I W L R YG+ID
Sbjct: 488 ICSPNIHTTDAIIICVHDTPEIWAQRDSLTGHIDPSTSIIVDTTVSVINWALGRNYGVID 547

Query: 551 VNIPLSLFEPDNYSGMITSQEVLIYLWDNYIKYFPAVAKIAFVGIGDSYSGIVHLLGHRD 610
           +NIP SLFE DNYS +++SQEV+ YLWD+Y+K FP +A++AFVGIGD+YSG VHLLGHRD
Sbjct: 548 INIPQSLFEQDNYSAVLSSQEVVTYLWDSYLKTFPHLARVAFVGIGDAYSGFVHLLGHRD 607

Query: 611 TRAVTKTVINFLGDKQLKPLVPLVDETLSEWYFKNSLIFSNNSHQCWKE--NESRKPRKK 668
           TR+V K  I F   KQL+PLVPLVDE+L +WYFKNSL+F++  H CW    N+S+KPRKK
Sbjct: 608 TRSVVKCAIAFADKKQLRPLVPLVDESLGDWYFKNSLVFTSTYHPCWGTDGNDSKKPRKK 667

Query: 669 FGRVLRCDTDGLNNTIEERFEEATDFILDSFEEWSDEE 706
           FGRVLR   DG+NN +EER EEATDFILDSFEEWS+ E
Sbjct: 668 FGRVLRWTCDGMNNIVEERLEEATDFILDSFEEWSESE 705

>Kpol_1039.32 s1039 (99859..101838) [1980 bp, 659 aa] {ON}
           (99859..101838) [1980 nt, 660 aa]
          Length = 659

 Score = 1019 bits (2634), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/655 (70%), Positives = 560/655 (85%)

Query: 51  IHYSPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSG 110
           + Y+PLKTGLCYDVRMRYHAKI+TSY+EYIDPHPEDPRRIYRIYKILAENGLI DP LSG
Sbjct: 5   LSYTPLKTGLCYDVRMRYHAKIYTSYYEYIDPHPEDPRRIYRIYKILAENGLIRDPALSG 64

Query: 111 VDDLGDLMLKIPVRAATSEEILEVHTKEHLEFIESTEKMSREQLLKETEKGDSVYFNNDS 170
           +DD+GDLM KIPVR ATSEEILEVH KE LE++E T+ ++R++LL +TE GDSVYFNNDS
Sbjct: 65  IDDIGDLMCKIPVREATSEEILEVHPKEQLEYLEKTQYLNRDELLSKTELGDSVYFNNDS 124

Query: 171 YASARLPCGGAIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILK 230
           Y SA+L CGGAIEACKA+V+G+VKNSLA+VRPPGHH+EP+ AGGFCLFSNVAVA KNILK
Sbjct: 125 YFSAKLSCGGAIEACKAIVDGKVKNSLAIVRPPGHHSEPEVAGGFCLFSNVAVATKNILK 184

Query: 231 NYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQAGEG 290
           NYP+ V+++MI+DWDIHHGNGTQK+FY DD+VLYVSLHRFE+GKYYPGTI GQYDQ GEG
Sbjct: 185 NYPDKVKKVMIVDWDIHHGNGTQKAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQVGEG 244

Query: 291 KGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHV 350
           KGEGFNCNI W VGG+GDAEY+WAFEQ+VMPMGREF+PDLVI+SSGFDAADGDTIG+CHV
Sbjct: 245 KGEGFNCNIPWSVGGIGDAEYIWAFEQIVMPMGREFRPDLVIVSSGFDAADGDTIGKCHV 304

Query: 351 TPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIARSALSVAKVLIGXXXXXXXXXXXXXX 410
           TPSCYGHMTHMLKSLA G LCVVLEGGYNLDAIARSAL+VAKVLIG              
Sbjct: 305 TPSCYGHMTHMLKSLANGKLCVVLEGGYNLDAIARSALAVAKVLIGEPPDELPAPDKDPK 364

Query: 411 XXVIEMIDKVIRLQSKYWNCFRRRHANSGCNFNEPINDSIVSKNFPLQKAIRQQQQHYLS 470
              IEMID+VI L+SKYW CF+R+  NS C +  PI++S  +K FP+Q AIR QQ  YL+
Sbjct: 365 PEAIEMIDRVIDLKSKYWKCFKRQITNSNCEYKGPISESFFAKKFPIQDAIRAQQIQYLT 424

Query: 471 DEFNLVTLPLINMDLPDNTVLCTPNVYESTTLLVVVHDTSDIWAKRNVISGTIDLSSSVI 530
           +++N+V LPL+N +LP++TV+C+ ++ +S   ++ VHDT +IW+KR+ I+G ID S+S+ 
Sbjct: 425 NDYNMVPLPLMNSNLPEDTVMCSTDILQSNVAIIYVHDTPEIWSKRDAIAGVIDSSASLY 484

Query: 531 IDNCLDFIKWGLDRKYGIIDVNIPLSLFEPDNYSGMITSQEVLIYLWDNYIKYFPAVAKI 590
           +D  L F  W LDR YGIIDVNIP +L+E DNYS  +T+QEVLI LWDN +KYFP V KI
Sbjct: 485 MDASLQFYDWALDRGYGIIDVNIPQTLYEQDNYSASLTAQEVLIKLWDNNLKYFPNVNKI 544

Query: 591 AFVGIGDSYSGIVHLLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETLSEWYFKNSLIFS 650
           A++G+G++YSG+VHLLGHRDTR+V K+VI F+G K LK LVPLV+E+L++WYFK SL+F+
Sbjct: 545 AYIGVGEAYSGLVHLLGHRDTRSVVKSVIGFVGKKPLKALVPLVEESLADWYFKTSLLFA 604

Query: 651 NNSHQCWKENESRKPRKKFGRVLRCDTDGLNNTIEERFEEATDFILDSFEEWSDE 705
           + +H CW EN+S+KPRK++GRVLRCD+DG+ + IEERFEEATDFI+DS +EW++E
Sbjct: 605 DKNHSCWGENDSKKPRKRYGRVLRCDSDGIFSLIEERFEEATDFIIDSLDEWTEE 659

>TPHA0C03390 Chr3 complement(743315..745420) [2106 bp, 701 aa] {ON}
           Anc_2.285 YNL021W
          Length = 701

 Score = 1004 bits (2597), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 457/668 (68%), Positives = 561/668 (83%), Gaps = 2/668 (0%)

Query: 39  KRQVIVPACTPKIHYSPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 98
           KR VIVP   P +HY+PLKTG+CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA
Sbjct: 34  KRPVIVPTQKPNLHYTPLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 93

Query: 99  ENGLINDPTLSGVDDLGDLMLKIPVRAATSEEILEVHTKEHLEFIESTEKMSREQLLKET 158
           ENGLINDP+L+GV D+GDLMLKIPVR AT EEIL+VHT+EH++F+ESTEKM+RE+LL +T
Sbjct: 94  ENGLINDPSLTGVSDIGDLMLKIPVREATKEEILDVHTEEHMQFLESTEKMTREELLSKT 153

Query: 159 EKGDSVYFNNDSYASARLPCGGAIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLF 218
           EKGDSVY NNDSY SARL CGGAIEACKAVVEGRVKN+LA+VRPPGHHAEPQAAGGFCLF
Sbjct: 154 EKGDSVYLNNDSYISARLSCGGAIEACKAVVEGRVKNALAIVRPPGHHAEPQAAGGFCLF 213

Query: 219 SNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPG 278
           SNV+VAAK+ILK YPESVR+I+I+DWDIHHGNGTQK+FY+DD VLY+SLHRFE+GK+YPG
Sbjct: 214 SNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPG 273

Query: 279 TIQGQYDQAGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFD 338
             +G YD+ G+GKG+GFNCNITWPV GVGD EY+WAFEQ+V+PM REF+PDLVI+SSGFD
Sbjct: 274 FPEGNYDKVGDGKGKGFNCNITWPVKGVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFD 333

Query: 339 AADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIARSALSVAKVLIGXX 398
           AA GDTIGQCHVTP+CYG+MTHMLKSLARGNLCVVLEGGYNLD+I+ SAL+VAK+LIG  
Sbjct: 334 AAHGDTIGQCHVTPNCYGYMTHMLKSLARGNLCVVLEGGYNLDSISNSALAVAKILIGEP 393

Query: 399 XXXXXXXXXXXXXXVIEMIDKVIRLQSKYWNCFRRRHANSGCNFNEPINDSIVSKNFPLQ 458
                         V+EMI+KVIR+QSKYW CFRR+  N G  +   I +S + K FPLQ
Sbjct: 394 PDEIPESDRDPKPGVLEMINKVIRVQSKYWKCFRRKFGNFGGEYENAI-ESQIPKMFPLQ 452

Query: 459 KAIRQQQQHYLSDEFNLVTLPLINMDLPDNTVLCTPNVYESTTLLVVVHDTSDIWAKRNV 518
            AIR  Q  +  D+F +++L L N++LP N+++C+ N +++ +L V++HDT ++W  R++
Sbjct: 453 DAIRNAQLSHYYDDFGMISLSLPNLNLPKNSIICSSNFFKAKSLCVLLHDTPEVWGNRDI 512

Query: 519 ISGTIDLSSSVIIDNCLDFIKWGLDRKYGIIDVNIPLSLFEPDNYSGMITSQEVLIYLWD 578
           I+G ID S+S+I D+ L FI W ++R+  +ID+NIP S FE DNYS  + SQ+V+I LWD
Sbjct: 513 ITGIIDPSTSIIFDSSLKFINWAIERETAVIDINIPRSAFEADNYSSNLLSQDVMISLWD 572

Query: 579 NYIKYFPAVAKIAFVGIGDSYSGIVHLLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETL 638
           N+ KY  ++ K+ F+GIG++ SGIVHLLG RDTR VTK  INF+G   LKP+VP +DE+L
Sbjct: 573 NHFKYIESLEKLCFIGIGEATSGIVHLLGKRDTRTVTKAAINFVGSSSLKPIVPSLDESL 632

Query: 639 SEWYFKNSLIFSNNSHQCWKENESRKPRKKFGRVLRCDTDGLNNTIEERFEEATDFILDS 698
            +WYFKNSL+F+++ H CW EN+ +KPRKK+GRVLRCDTDG++N IEERFEEATDFILD+
Sbjct: 633 GDWYFKNSLVFTDHFHGCWSEND-KKPRKKYGRVLRCDTDGIHNIIEERFEEATDFILDA 691

Query: 699 FEEWSDEE 706
           F+EWSD E
Sbjct: 692 FDEWSDTE 699

>TBLA0B06950 Chr2 complement(1643756..1646143) [2388 bp, 795 aa]
           {ON} Anc_2.285 YNL021W
          Length = 795

 Score =  786 bits (2030), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/479 (76%), Positives = 406/479 (84%), Gaps = 7/479 (1%)

Query: 12  ENPDGNLKRRLEETKEDQNSLSTTS-------NNKRQVIVPACTPKIHYSPLKTGLCYDV 64
           E+  G LKR  EE +    ++ST +       N K+Q+IVP   PKIHY PLKTGLCYDV
Sbjct: 6   EDNSGGLKRNHEELETGTKNVSTNNILNKNPPNYKKQIIVPVQAPKIHYVPLKTGLCYDV 65

Query: 65  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKIPVR 124
           RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVD++GDLMLK+P+R
Sbjct: 66  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDNIGDLMLKLPIR 125

Query: 125 AATSEEILEVHTKEHLEFIESTEKMSREQLLKETEKGDSVYFNNDSYASARLPCGGAIEA 184
            AT  EILEVH+ EH +++E T   +REQLLKETE GDSVYFNNDS+ SA+L CGGAIEA
Sbjct: 126 EATMNEILEVHSIEHFKYLEKTSNDNREQLLKETENGDSVYFNNDSFQSAKLSCGGAIEA 185

Query: 185 CKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDW 244
           CKAVVEGRVKN++AVVRPPGHH+EP++AGGFCLFSNVAVA KNILKNYPESVR+++ILDW
Sbjct: 186 CKAVVEGRVKNAMAVVRPPGHHSEPESAGGFCLFSNVAVATKNILKNYPESVRKVLILDW 245

Query: 245 DIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQAGEGKGEGFNCNITWPVG 304
           DIHHGNGTQK+FY DD VLY+SLHRFE+GKYYPGTIQGQYDQ GEGKGEGFNCNITWP+G
Sbjct: 246 DIHHGNGTQKAFYNDDNVLYISLHRFELGKYYPGTIQGQYDQTGEGKGEGFNCNITWPIG 305

Query: 305 GVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLKS 364
            VGDAEYMWAFEQVVMPM REF+PDLVIISSGFDAADGDTIGQCHV+PSCYGHMTHMLKS
Sbjct: 306 AVGDAEYMWAFEQVVMPMSREFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTHMLKS 365

Query: 365 LARGNLCVVLEGGYNLDAIARSALSVAKVLIGXXXXXXXXXXXXXXXXVIEMIDKVIRLQ 424
           LARGNLCVVLEGGYNLDAIARSALSV+K+LIG                VIEMIDK+IRLQ
Sbjct: 366 LARGNLCVVLEGGYNLDAIARSALSVSKILIGEPPDELPDPLKDPKPEVIEMIDKIIRLQ 425

Query: 425 SKYWNCFRRRHANSGCNFNEPINDSIVSKNFPLQKAIRQQQQHYLSDEFNLVTLPLINM 483
           SKYW CFRRRH N GCNF E INDS++SKNFPLQ AIR  Q   L DE N +TLP+ N 
Sbjct: 426 SKYWKCFRRRHGNLGCNFKESINDSLISKNFPLQTAIRNFQSKKLFDELNFLTLPIKNF 484

 Score =  332 bits (850), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 147/222 (66%), Positives = 186/222 (83%)

Query: 485 LPDNTVLCTPNVYESTTLLVVVHDTSDIWAKRNVISGTIDLSSSVIIDNCLDFIKWGLDR 544
           L +NT+LC+P +  S TL+V+VHD+ D+W KR+V +G +DLSS++IID+ LDFIKW LDR
Sbjct: 574 LNENTILCSPAIIRSKTLVVLVHDSPDLWTKRDVSTGVVDLSSTIIIDSTLDFIKWSLDR 633

Query: 545 KYGIIDVNIPLSLFEPDNYSGMITSQEVLIYLWDNYIKYFPAVAKIAFVGIGDSYSGIVH 604
            YG+ID+NIP +LFE DNYS ++ +QE L+  WDNY+KYFP + KI F+G GD+++GIVH
Sbjct: 634 NYGVIDINIPQTLFEQDNYSSILAAQETLLSFWDNYLKYFPYIEKIVFIGFGDAHAGIVH 693

Query: 605 LLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETLSEWYFKNSLIFSNNSHQCWKENESRK 664
           LLGHRDTR+V K+VINFLG K LK LVPLVDETLS+WYFKNSL+F++ +H  W +NE++K
Sbjct: 694 LLGHRDTRSVVKSVINFLGKKPLKALVPLVDETLSDWYFKNSLVFTDKNHPFWADNENKK 753

Query: 665 PRKKFGRVLRCDTDGLNNTIEERFEEATDFILDSFEEWSDEE 706
           PRKKFGRVLR   DG+ N IEERF+EATDFILDSFEEWSDEE
Sbjct: 754 PRKKFGRVLRSQQDGIANLIEERFDEATDFILDSFEEWSDEE 795

>Kpol_1003.37 s1003
           complement(91621..92301,92861..92869,92912..93958) [1737
           bp, 578 aa] {ON}
           complement(91621..92301,92861..92869,92912..93958) [1737
           nt, 579 aa]
          Length = 578

 Score =  536 bits (1381), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 241/298 (80%), Positives = 272/298 (91%)

Query: 39  KRQVIVPACTPKIHYSPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 98
           KRQVIVP   PK+HY+PLKTGLCYDVRMRYHAKIFTS FEYIDPHPEDPRR+YRIYKILA
Sbjct: 52  KRQVIVPIRQPKLHYTPLKTGLCYDVRMRYHAKIFTSNFEYIDPHPEDPRRVYRIYKILA 111

Query: 99  ENGLINDPTLSGVDDLGDLMLKIPVRAATSEEILEVHTKEHLEFIESTEKMSREQLLKET 158
           ENGLI D  LSG+DD+GD+MLKIPVR AT EEIL VHT+EHL+FIE+ E  SRE+L+K T
Sbjct: 112 ENGLIKDENLSGLDDIGDIMLKIPVRTATEEEILAVHTREHLDFIENIESQSREELIKLT 171

Query: 159 EKGDSVYFNNDSYASARLPCGGAIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLF 218
           EK DSVY+NNDSY SA+L CGG IEAC+AVVEGRVKNSLA+VRPPGHHAEPQAAGGFCLF
Sbjct: 172 EKADSVYYNNDSYYSAKLSCGGVIEACRAVVEGRVKNSLAIVRPPGHHAEPQAAGGFCLF 231

Query: 219 SNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPG 278
           SNV+VAA++IL+ YPESVR+I+ILDWDIHHGNGTQK+FY+D+ VLY+SLHR+E   +YPG
Sbjct: 232 SNVSVAARSILRTYPESVRKILILDWDIHHGNGTQKAFYEDENVLYISLHRYESTAFYPG 291

Query: 279 TIQGQYDQAGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSG 336
           TI G+YDQ GEGKGEGFNCNITWPVGGVGDAEYMWAFE VVMP+GREF+PDLVI+SSG
Sbjct: 292 TIHGRYDQVGEGKGEGFNCNITWPVGGVGDAEYMWAFEHVVMPLGREFRPDLVIVSSG 349

 Score =  270 bits (689), Expect = 7e-81,   Method: Compositional matrix adjust.
 Identities = 116/217 (53%), Positives = 166/217 (76%)

Query: 490 VLCTPNVYESTTLLVVVHDTSDIWAKRNVISGTIDLSSSVIIDNCLDFIKWGLDRKYGII 549
           VL +  ++++ TL+++VHDT ++W  R++I+G +D S+SV+ID  + FIKW  DR Y I+
Sbjct: 360 VLASQKIFKAETLVILVHDTPELWGDRDIITGVLDPSTSVLIDTSMKFIKWAADRNYSIL 419

Query: 550 DVNIPLSLFEPDNYSGMITSQEVLIYLWDNYIKYFPAVAKIAFVGIGDSYSGIVHLLGHR 609
           D+NIP S  E + +S    + E+++ LWDN+++Y   + KI F+GIG+SY GIVHL+G R
Sbjct: 420 DINIPKSNLEKETFSSSKAANEIMLSLWDNHLQYISTLTKICFIGIGESYQGIVHLIGER 479

Query: 610 DTRAVTKTVINFLGDKQLKPLVPLVDETLSEWYFKNSLIFSNNSHQCWKENESRKPRKKF 669
           D R ++K VINF+G+  LK L    DET+ +WYFKNSL+F+N+SH CWKE+E ++PRKKF
Sbjct: 480 DLRVLSKAVINFVGNFPLKSLSSNFDETMVDWYFKNSLVFTNDSHNCWKESEEKRPRKKF 539

Query: 670 GRVLRCDTDGLNNTIEERFEEATDFILDSFEEWSDEE 706
           GRVL+ D+DG+ + I ERF+EATDFILD+FEEWSDEE
Sbjct: 540 GRVLKSDSDGIISIINERFDEATDFILDAFEEWSDEE 576

>TDEL0B04580 Chr2 complement(817368..818708) [1341 bp, 446 aa] {ON}
           Anc_8.153 YGL194C
          Length = 446

 Score =  139 bits (349), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 98/333 (29%), Positives = 169/333 (50%), Gaps = 30/333 (9%)

Query: 59  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLM 118
           G  Y  R+ YH     S + Y   HP  P      +++L  + L++   L  + DL +  
Sbjct: 21  GSAYCPRVSYHFNPKVSNYHYGVRHPMKP------FRLLLTDHLVSSYGLHKIMDLYE-- 72

Query: 119 LKIPVRAATSEEILEVHTKEHLEFI-----ESTEKMSREQLLKETEKGDSVYFNNDSYAS 173
                R ATSEEI E HT+++++F+     E+  KM R  L K     D   F N  +  
Sbjct: 73  ----TRVATSEEIAEFHTQDYIDFLHKVTPENLSKMPRGTLEKFNIGDDCPIFQN-LFNY 127

Query: 174 ARLPCGGAIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNILKNY 232
            +L  G +++A + ++    ++ +A+    G HHA+     GFC  +++ +A  N+L+ +
Sbjct: 128 CKLYAGASLDAARKLIND--QSDIAINWSGGLHHAKKSNPSGFCYVNDIVLAILNLLRYH 185

Query: 233 PESVRRIMILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQAGEGKG 292
           P    R++ +D D+HHG+G Q++FY  D+V  VS H++  G+++PGT  G +D+ G   G
Sbjct: 186 P----RVLYIDIDLHHGDGVQEAFYTTDRVYTVSFHKYN-GEFFPGT--GNHDEVGCANG 238

Query: 293 EGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTP 352
           + F  N+     G+ D  Y+  F+ ++ P+   +KP ++I   G D+   D IG  ++T 
Sbjct: 239 KHFAMNVPLE-DGIDDDSYINLFKSIMDPLITSYKPTVIIQQCGADSLGHDRIGCFNLTI 297

Query: 353 SCYGHMTHMLKSLARGNLCVVLEGGYNLDAIAR 385
             +G     ++S     L VV  GGY    ++R
Sbjct: 298 KGHGECVKFIRSFGIPML-VVGGGGYTPRNVSR 329

>AFR172C Chr6 complement(754470..755819) [1350 bp, 449 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL194C
           (HOS2)
          Length = 449

 Score =  137 bits (346), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 95/334 (28%), Positives = 170/334 (50%), Gaps = 32/334 (9%)

Query: 59  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLM 118
           G  Y  R+ YH     S + Y   HP  P      ++++  + L++   L  V DL +  
Sbjct: 21  GASYTPRVSYHYNSRVSQYHYGVRHPMKP------FRLMLTDHLVSRYGLHKVMDLYE-- 72

Query: 119 LKIPVRAATSEEILEVHTKEHLEFI-----ESTEKMSREQLLKETEKGDSVYFNNDSYAS 173
                RAAT EE+L  H +++++F+     E+  K+ R  L K    GD        +  
Sbjct: 73  ----TRAATKEEVLAFHAQDYVDFLSHVAPENLNKLPRGSLEK-FNIGDDCPIFQGLFEY 127

Query: 174 ARLPCGGAIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNILKNY 232
           + L  G +++A + ++ G  ++ +A+    G HHA+     GFC  +++ +A  N+L+ +
Sbjct: 128 SMLYAGASLDASRKLING--QSEIAINWSGGLHHAKKSNPSGFCYVNDIVLAILNLLRYH 185

Query: 233 PESVRRIMILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQAGEGKG 292
           P    R++ +D D+HHG+G Q++FY  D+V  VS H++  G+++PGT  G  D+ G  +G
Sbjct: 186 P----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GDLDEIGCSRG 238

Query: 293 EGFNCNITWPVG-GVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVT 351
           + F+ N+  P+  G+ D  Y+  F+ ++ P+   +KP ++I   G D+   D +G  ++ 
Sbjct: 239 KHFSLNV--PLNDGIDDDSYINLFKSIIDPLVTSYKPTVIIQQCGADSLGHDRLGCFNLN 296

Query: 352 PSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIAR 385
              +G     +KS     LCV   GGY    ++R
Sbjct: 297 IRAHGECVKFVKSFGIPMLCVG-GGGYTPRNVSR 329

>TPHA0H00320 Chr8 complement(62605..63957) [1353 bp, 450 aa] {ON}
           Anc_8.153 YGL194C
          Length = 450

 Score =  137 bits (346), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 96/334 (28%), Positives = 165/334 (49%), Gaps = 32/334 (9%)

Query: 59  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLM 118
           G  Y  R+ YH     S + Y   HP  P R      +++  GL N            +M
Sbjct: 22  GSTYSPRVSYHYNPKVSNYHYGVKHPMKPFRFMLTDHLVSSYGLHN------------IM 69

Query: 119 LKIPVRAATSEEILEVHTKEHLEFI-----ESTEKMSREQLLKETEKGDSVYFNNDSYAS 173
                R AT EE+L+ H+++++EF+     ++  KM R    K     D   F N  Y  
Sbjct: 70  DLYETREATKEELLQFHSEDYVEFLSKVSPDNISKMPRGTFDKYNIGDDCPIFQN-IYEY 128

Query: 174 ARLPCGGAIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNILKNY 232
            +L  G +++A + ++    ++ +A+    G HHA+     GFC  +++ +A  N+L+ +
Sbjct: 129 CKLYAGASLDASRKLIND--QSDIAINWSGGLHHAKKSNPSGFCYVNDIVLATLNLLRYH 186

Query: 233 PESVRRIMILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQAGEGKG 292
           P    R++ +D D+HHG+G Q++FY  D+V  VS H++  G+++PGT  G YD+ G  +G
Sbjct: 187 P----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GNYDEIGCAEG 239

Query: 293 EGFNCNITWPVG-GVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVT 351
           + F  N+  P+  G+ D  Y+  F+ V+ P+   FKP  +I   G D+   D +G  ++ 
Sbjct: 240 KHFAMNV--PLNDGIDDDSYINLFKSVMEPIITSFKPTAIIQQCGADSLGHDRLGCFNLN 297

Query: 352 PSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIAR 385
              +G     ++S     + VV  GGY    ++R
Sbjct: 298 IKAHGECVKFIRSFGIP-MVVVGGGGYTPRNVSR 330

>NDAI0B02710 Chr2 (674610..675971) [1362 bp, 453 aa] {ON} Anc_8.153
          Length = 453

 Score =  137 bits (344), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 92/330 (27%), Positives = 169/330 (51%), Gaps = 30/330 (9%)

Query: 62  YDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKI 121
           Y  R+ YH     S + Y   HP  P      ++++  + L++   L  + DL +     
Sbjct: 28  YTPRVSYHFNPKVSNYHYGVKHPMKP------FRLMLTDHLVSSYGLHKIMDLYE----- 76

Query: 122 PVRAATSEEILEVHTKEHLEFI-----ESTEKMSREQLLKETEKGDSVYFNNDSYASARL 176
             R AT+EE+++ H++++L+F+     E+  KM R  L K     D   F N  Y  + L
Sbjct: 77  -TRPATNEEMVQFHSEDYLDFLSKVTPENLSKMPRGTLEKFNIGDDCPIFQN-LYDYSTL 134

Query: 177 PCGGAIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNILKNYPES 235
             G +++A + ++    ++ +A+    G HHA+     GFC  +++ ++  N+L+ +P  
Sbjct: 135 YTGASLDATRKLIND--QSDIAINWSGGLHHAKKNNPSGFCYINDIVLSIVNLLRYHP-- 190

Query: 236 VRRIMILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQAGEGKGEGF 295
             R++ +D D+HHG+G Q++FY  D+V  +S H+F  G+++PGT  G YD+ G  KG+ F
Sbjct: 191 --RVLYIDIDLHHGDGVQEAFYTTDRVFTISFHKFN-GEFFPGT--GDYDETGCAKGKHF 245

Query: 296 NCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCY 355
             N+     G+ D  Y+  F+ ++ P+   +KP +++   G D+   D +G  ++    +
Sbjct: 246 AMNVPLE-DGIDDDSYINLFKSIMDPLITSYKPTVIVQQCGADSLGHDRLGCFNLNIKGH 304

Query: 356 GHMTHMLKSLARGNLCVVLEGGYNLDAIAR 385
           G     +KS     + VV  GGY    ++R
Sbjct: 305 GECVKFIKSFGIP-MLVVGGGGYTPRNVSR 333

>SAKL0H25124g Chr8 (2184039..2185385) [1347 bp, 448 aa] {ON} highly
           similar to uniprot|P53096 Saccharomyces cerevisiae
           YGL194C HOS2 Histone deacetylase required for gene
           activation via specific deacetylation of lysines in H3
           and H4 histone tails subunit of the Set3 complex a
           meiotic-specific repressor of sporulation specific genes
           that contains deacetylase activity
          Length = 448

 Score =  136 bits (342), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 94/339 (27%), Positives = 170/339 (50%), Gaps = 30/339 (8%)

Query: 53  YSPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVD 112
           Y P + G  Y   + YH     S + Y   HP  P      ++++  + L++   L  + 
Sbjct: 14  YLPYEFGSTYSPHVSYHFNSDVSQYHYGVRHPMKP------FRLMLTDHLVSSYGLHKIM 67

Query: 113 DLGDLMLKIPVRAATSEEILEVHTKEHLEFI-----ESTEKMSREQLLKETEKGDSVYFN 167
           DL +       R AT +E+LE H+ +++EF+     ++  KM R  L K    GD     
Sbjct: 68  DLYE------TREATRDELLEFHSADYIEFLSKVSPDTLSKMPRGSLEK-FNIGDDCPIF 120

Query: 168 NDSYASARLPCGGAIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAK 226
              +  + L  G +++A + ++ G  ++ +A+    G HHA+     GFC  +++ +A  
Sbjct: 121 QGIFEYSSLYAGASLDASRKLIAG--QSEIAINWSGGLHHAKKAKPSGFCYVNDIVLAIL 178

Query: 227 NILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQ 286
           N+L+ +P    R++ +D D+HHG+G Q++FY  D+V  VS H++  G+++PGT  G +D+
Sbjct: 179 NLLRFHP----RVLYVDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GDFDE 231

Query: 287 AGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIG 346
            G  +G+ F  N+     G+ D  Y+  F+ ++ P+   +KP ++I   G D+   D +G
Sbjct: 232 IGCSRGKHFALNVPLD-DGIDDDSYINLFKSIMDPLITSYKPTVIIQQCGADSLGHDRLG 290

Query: 347 QCHVTPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIAR 385
             ++    +G     +KS     L VV  GGY    ++R
Sbjct: 291 CFNLNIRAHGECVKFVKSFGIPML-VVGGGGYTPRNVSR 328

>NCAS0B05480 Chr2 complement(1033624..1034979) [1356 bp, 451 aa]
           {ON} Anc_8.153
          Length = 451

 Score =  135 bits (341), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 93/333 (27%), Positives = 168/333 (50%), Gaps = 30/333 (9%)

Query: 59  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLM 118
           G  Y  R+ YH     S + Y   HP  P      ++++  + L++   L  + DL +  
Sbjct: 23  GSSYTPRVSYHFNPKVSNYHYGVRHPMKP------FRLMLTDHLVSSYGLHKIMDLYE-- 74

Query: 119 LKIPVRAATSEEILEVHTKEHLEFI-----ESTEKMSREQLLKETEKGDSVYFNNDSYAS 173
                R AT EE+ + H+++++EF+     E+  KM R  L K     D   F N  Y  
Sbjct: 75  ----TREATREEMSQFHSQDYIEFLSKVTPENLSKMPRGTLEKFNIGDDCPIFQN-IYDY 129

Query: 174 ARLPCGGAIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNILKNY 232
           + L  G +++A + ++    ++ +A+    G HHA+     GFC  +++ ++  N+L+ +
Sbjct: 130 STLYTGASLDASRKLIND--QSDIAINWSGGLHHAKKNNPSGFCYVNDIVLSILNLLRYH 187

Query: 233 PESVRRIMILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQAGEGKG 292
           P    R++ +D D+HHG+G Q++FY  D+V  +S H+F  G+++PGT  G +D+ G  KG
Sbjct: 188 P----RVLYIDIDLHHGDGVQEAFYTTDRVFTISFHKFN-GEFFPGT--GDFDEIGCAKG 240

Query: 293 EGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTP 352
           + F  N+     G+ D  Y+  F+ ++ P+   +KP ++I   G D+   D +G  ++  
Sbjct: 241 KHFAMNVPLE-DGIDDDSYINLFKSIIDPLITAYKPTVIIQQCGADSLGHDRLGCFNLNI 299

Query: 353 SCYGHMTHMLKSLARGNLCVVLEGGYNLDAIAR 385
             +G     +KS     + VV  GGY    ++R
Sbjct: 300 KAHGECVKFVKSFGIP-MLVVGGGGYTPRNVSR 331

>TBLA0D02140 Chr4 complement(539873..541243) [1371 bp, 456 aa] {ON}
           Anc_8.153 YGL194C
          Length = 456

 Score =  135 bits (340), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 96/343 (27%), Positives = 171/343 (49%), Gaps = 33/343 (9%)

Query: 49  PKIHYSPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTL 108
           P+ +Y   + G  Y  R+ YH     S + +   HP  P R+           ++ D  +
Sbjct: 16  PQFNY---EFGSTYAPRVSYHFNPKVSSYHFGVRHPMKPFRL-----------MLTDHLV 61

Query: 109 SGVDDLGDLMLKIPVRAATSEEILEVHTKEHLEFI-----ESTEKMSREQLLKETEKGDS 163
           SG   L  +M     R A+ +E+LE HT +++ F+     ++  KM R  L K     D 
Sbjct: 62  SGYG-LHKIMDLYETRKASDDELLEFHTDDYINFLKKVNPDNVNKMPRGTLDKFNIGDDC 120

Query: 164 VYFNNDSYASARLPCGGAIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVA 222
             F+N  Y  + L  G +++A + ++ G  ++ +A+    G HHA+  +  GFC  +++ 
Sbjct: 121 PIFHN-LYEYSSLYTGASLDASRKLLNG--QSDIAINWSGGLHHAKKTSPSGFCYINDIV 177

Query: 223 VAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQG 282
           ++  N+L+ +P    R++ +D D+HHG+G Q++FY  D+V  VS H++  G+++PGT  G
Sbjct: 178 LSILNLLRFHP----RVLYIDIDLHHGDGVQEAFYTTDRVYTVSFHKYN-GEFFPGT--G 230

Query: 283 QYDQAGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADG 342
            YD+ G   G+ F  N+     G+ D  Y+  F+ ++ P+   + P ++I   G D+   
Sbjct: 231 NYDETGCSNGKHFALNVPLK-DGIDDDSYINLFKSIIDPLITSYNPTVIIQQCGADSLGH 289

Query: 343 DTIGQCHVTPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIAR 385
           D +G  ++    +G     +KS     L VV  GGY    ++R
Sbjct: 290 DRLGCFNLNIKAHGECVKFVKSFGIPML-VVGGGGYTPKNVSR 331

>Kpol_246.5 s246 (11759..13120) [1362 bp, 453 aa] {ON}
           (11759..13120) [1362 nt, 454 aa]
          Length = 453

 Score =  134 bits (337), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 92/333 (27%), Positives = 168/333 (50%), Gaps = 30/333 (9%)

Query: 59  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLM 118
           G  Y  R+ YH     S + Y   HP  P      ++++  + L++   L  + DL +  
Sbjct: 25  GSAYCPRVSYHFNPKVSNYHYGVKHPMKP------FRLMLTDHLVSSYGLHKIMDLYE-- 76

Query: 119 LKIPVRAATSEEILEVHTKEHLEFI-----ESTEKMSREQLLKETEKGDSVYFNNDSYAS 173
                R+AT +E+L+ H+ +++ F+     E+  KM R  L K     D   F N  Y  
Sbjct: 77  ----TRSATKDELLDFHSDDYVSFLQKVTPENLSKMPRGTLEKYNIGDDCPIFQN-LYDY 131

Query: 174 ARLPCGGAIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNILKNY 232
           + L  G +++A + ++    ++ +A+    G HHA+     GFC  +++ +A  N+L+ +
Sbjct: 132 SALYAGASLDASRKLINN--QSDIAINWSGGLHHAKKTNPSGFCYVNDIVLAILNLLRYH 189

Query: 233 PESVRRIMILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQAGEGKG 292
           P    R++ +D D+HHG+G Q++FY  D+V  +S H++  G+++PGT  G YD+ G  +G
Sbjct: 190 P----RVLYIDIDLHHGDGVQEAFYTTDRVFTISFHKYN-GEFFPGT--GNYDEIGCAQG 242

Query: 293 EGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTP 352
           + F  N+     G+ D  Y+  F+ ++ P+   +KP ++I   G D+   D +G  ++  
Sbjct: 243 KHFAMNVPLE-DGIDDDSYINLFKSIIDPLITSYKPTVIIQQCGADSLGHDRLGCFNLNI 301

Query: 353 SCYGHMTHMLKSLARGNLCVVLEGGYNLDAIAR 385
             +G     ++S     L VV  GGY    ++R
Sbjct: 302 KAHGECVKFIRSFGIPML-VVGGGGYTPRNVSR 333

>KLTH0E06446g Chr5 complement(594807..596156) [1350 bp, 449 aa] {ON}
           highly similar to uniprot|P53096 Saccharomyces
           cerevisiae YGL194C HOS2 Histone deacetylase required for
           gene activation via specific deacetylation of lysines in
           H3 and H4 histone tails subunit of the Set3 complex a
           meiotic-specific repressor of sporulation specific genes
           that contains deacetylase activity
          Length = 449

 Score =  133 bits (335), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 92/332 (27%), Positives = 166/332 (50%), Gaps = 28/332 (8%)

Query: 59  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLM 118
           G  Y+  + YH     S F Y   HP  P      ++++  + L++   L  + DL +  
Sbjct: 21  GAPYEPNVSYHFNSDVSQFHYGVRHPMKP------FRLMLTDHLVSSYGLHKIMDLYE-- 72

Query: 119 LKIPVRAATSEEILEVHTKEHLEFIESTEKMSREQLLKET-EK---GDSVYFNNDSYASA 174
                R AT EE+ E H  +++EF+      +  +L + T EK   GD        Y  +
Sbjct: 73  ----TRPATREELCEFHADDYVEFLAKVSPDNLSKLPRGTLEKFNIGDDCPIFQGLYQYS 128

Query: 175 RLPCGGAIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNILKNYP 233
            L  G +++A + ++ G  ++ +A+    G HHA+  +  GFC  +++ ++  N+L+ +P
Sbjct: 129 TLYAGASLDATRKLING--QSEIAINWSGGLHHAKKSSPSGFCYVNDIVLSVLNLLRYHP 186

Query: 234 ESVRRIMILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQAGEGKGE 293
               R++ +D D+HHG+G Q++FY  D+V  VS H++  G+++PGT  G  D+ G  +G+
Sbjct: 187 ----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GNLDETGCSRGK 239

Query: 294 GFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPS 353
            F  N+     G+ D  Y+  F+ ++ P+   FKP ++I   G D+   D +G  ++   
Sbjct: 240 HFALNVPLE-DGIDDDSYINLFKSIIDPLITSFKPTVIIQQCGADSLGHDRLGCFNLNVK 298

Query: 354 CYGHMTHMLKSLARGNLCVVLEGGYNLDAIAR 385
            +G     +KS     L V+  GGY    ++R
Sbjct: 299 AHGECVRFVKSFGIPML-VLGGGGYTPRNVSR 329

>KNAG0G01350 Chr7 (300791..302146) [1356 bp, 451 aa] {ON} Anc_8.153
           YGL194C
          Length = 451

 Score =  133 bits (335), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 94/336 (27%), Positives = 166/336 (49%), Gaps = 30/336 (8%)

Query: 56  LKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLG 115
            + G    +R+ YH     S++ Y   HP  P R+           ++ D  +SG   + 
Sbjct: 19  FELGAARPLRVSYHFNPKVSHYHYGVKHPMKPFRL-----------MLTDHLVSGYG-MH 66

Query: 116 DLMLKIPVRAATSEEILEVHTKEHLEFIESTE-----KMSREQLLKETEKGDSVYFNNDS 170
            +M     RAAT++E+ E HT++++ F++        K+ R  L K     D   F N  
Sbjct: 67  KVMDLYETRAATNDELTEFHTEDYVHFLQKVSPDNLGKLPRGTLEKFNIGDDCPIFQN-L 125

Query: 171 YASARLPCGGAIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNIL 229
           Y  A L  G +++A + ++ G  ++ +A+    G HHA+  +  GFC  +++ ++  N+L
Sbjct: 126 YDYATLYTGASLDATRKLING--QSDIAINWSGGLHHAKKNSPSGFCYVNDIVLSIVNLL 183

Query: 230 KNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQAGE 289
           + +P    R++ +D D+HHG+G Q++FY  D+V  +S H++  G ++PGT  G  D+ G 
Sbjct: 184 RYHP----RVLYIDIDLHHGDGVQEAFYTTDRVYTISFHKYN-GDFFPGT--GDIDETGC 236

Query: 290 GKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCH 349
             GE F  N+     G+ D  Y+  F+ V+ P+   + P ++I   G D+   D +G  +
Sbjct: 237 DAGERFALNVPLE-DGIDDDSYINLFKSVIGPLITAYNPTVIIQQCGADSLGHDRLGCFN 295

Query: 350 VTPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIAR 385
           +    +G     +KS     L VV  GGY    ++R
Sbjct: 296 LNIKAHGECVKFVKSFGIPML-VVGGGGYTPRNVSR 330

>Ecym_2346 Chr2 complement(678792..680249) [1458 bp, 485 aa] {ON}
           similar to Ashbya gossypii AFR172C
          Length = 485

 Score =  133 bits (335), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 93/337 (27%), Positives = 168/337 (49%), Gaps = 30/337 (8%)

Query: 55  PLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDL 114
           P + G  Y  ++ YH     S + Y   HP  P      ++++  + L++   L  + DL
Sbjct: 53  PFEFGSSYSPQVSYHFNPKVSQYHYGVRHPMKP------FRLMLTDHLVSCYGLHKIMDL 106

Query: 115 GDLMLKIPVRAATSEEILEVHTKEHLEFI-----ESTEKMSREQLLKETEKGDSVYFNND 169
            +       R AT EE+LE H  +++EF+     E+  K+ R  L K    GD       
Sbjct: 107 YE------TREATKEELLEFHAPDYIEFLSHVTPENLNKLPRGSLEK-FNIGDDCPIFQG 159

Query: 170 SYASARLPCGGAIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNI 228
            +  + L  G +++A + ++    ++ +A+    G HHA+     GFC  +++ +A  ++
Sbjct: 160 MFDYSILYAGASLDAARKLINN--QSEIAINWSGGLHHAKKSNPSGFCYVNDIVLAIISL 217

Query: 229 LKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQAG 288
           L+ +P    R++ +D D+HHG+G Q++FY  D+V  VS H++  G+++PGT  G  D+ G
Sbjct: 218 LRYHP----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GDLDEIG 270

Query: 289 EGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQC 348
             KG+ F+ N+     G+ D  Y+  F+ ++ P+   +KP ++I   G D+   D +G  
Sbjct: 271 CSKGKKFSLNVPLQ-DGIDDDSYINLFKSIIDPLVTSYKPTVIIQQCGADSLGHDRLGCF 329

Query: 349 HVTPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIAR 385
           ++    +G     +KS     LCV   GGY    ++R
Sbjct: 330 NLNIKAHGECVKFVKSFGIPILCVG-GGGYTPRNVSR 365

>Skud_7.79 Chr7 complement(146016..147374) [1359 bp, 452 aa] {ON}
           YGL194C (REAL)
          Length = 452

 Score =  132 bits (333), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 89/330 (26%), Positives = 166/330 (50%), Gaps = 28/330 (8%)

Query: 61  CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLK 120
            Y  R+ YH     S++ Y   HP  P      ++++  + L++   L  + DL +    
Sbjct: 23  AYSPRVSYHFNPKVSHYHYGVKHPMKP------FRLMLTDHLVSSYGLHKIMDLYE---- 72

Query: 121 IPVRAATSEEILEVHTKEHLEFIESTEKMSREQLLKETEK----GDSVYFNNDSYASARL 176
              R+AT +E+LE H+++++ F+      +  +L + T +    GD      + Y    L
Sbjct: 73  --TRSATRDELLEFHSEDYINFLSKVSPDNSNKLPRGTLENFNIGDDCPIFQNLYDYTTL 130

Query: 177 PCGGAIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNILKNYPES 235
             G +++A + ++    ++ +A+    G HHA+  +  GFC  +++ ++  N+L+ +P  
Sbjct: 131 YTGASLDATRKLINN--QSDIAINWSGGLHHAKKNSPSGFCYVNDIVLSILNLLRYHP-- 186

Query: 236 VRRIMILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQAGEGKGEGF 295
             RI+ +D D+HHG+G Q++FY  D+V  +S H++  G+++PGT  G   + G  KG+ F
Sbjct: 187 --RILYIDIDLHHGDGVQEAFYTTDRVFTLSFHKYN-GEFFPGT--GDLTEIGCDKGKHF 241

Query: 296 NCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCY 355
             N+     G+ D  Y+  F+ +V P+   FKP L++   G D+   D +G  ++    +
Sbjct: 242 ALNVPLE-DGIDDDSYINLFKSIVDPLIMTFKPTLIVQQCGADSLGHDRLGCFNLNIKAH 300

Query: 356 GHMTHMLKSLARGNLCVVLEGGYNLDAIAR 385
           G     +KS     L VV  GGY    ++R
Sbjct: 301 GECVKFVKSFGLPML-VVGGGGYTPRNVSR 329

>YGL194C Chr7 complement(140368..141726) [1359 bp, 452 aa] {ON}
           HOS2Histone deacetylase required for gene activation via
           specific deacetylation of lysines in H3 and H4 histone
           tails; subunit of the Set3 complex, a meiotic-specific
           repressor of sporulation specific genes that contains
           deacetylase activity
          Length = 452

 Score =  131 bits (330), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 91/331 (27%), Positives = 166/331 (50%), Gaps = 30/331 (9%)

Query: 61  CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLK 120
            Y  R+ YH     S++ Y   HP  P      ++++  + L++   L  + DL +    
Sbjct: 23  AYSPRVSYHFNSKVSHYHYGVKHPMKP------FRLMLTDHLVSSYGLHKIMDLYE---- 72

Query: 121 IPVRAATSEEILEVHTKEHLEFI-----ESTEKMSREQLLKETEKGDSVYFNNDSYASAR 175
              R+AT +E+L+ H+++++ F+     E+  K+ R  L       D   F N  Y    
Sbjct: 73  --TRSATRDELLQFHSEDYVNFLSKVSPENANKLPRGTLENFNIGDDCPIFQN-LYDYTT 129

Query: 176 LPCGGAIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNILKNYPE 234
           L  G +++A + ++    ++ +A+    G HHA+  +  GFC  +++ ++  N+L+ +P 
Sbjct: 130 LYTGASLDATRKLINN--QSDIAINWSGGLHHAKKNSPSGFCYVNDIVLSILNLLRYHP- 186

Query: 235 SVRRIMILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQAGEGKGEG 294
              RI+ +D D+HHG+G Q++FY  D+V  +S H++  G+++PGT  G   + G  KG+ 
Sbjct: 187 ---RILYIDIDLHHGDGVQEAFYTTDRVFTLSFHKYN-GEFFPGT--GDLTEIGCDKGKH 240

Query: 295 FNCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSC 354
           F  N+     G+ D  Y+  F+ +V P+   FKP L++   G D+   D +G  ++    
Sbjct: 241 FALNVPLE-DGIDDDSYINLFKSIVDPLIMTFKPTLIVQQCGADSLGHDRLGCFNLNIKA 299

Query: 355 YGHMTHMLKSLARGNLCVVLEGGYNLDAIAR 385
           +G     +KS     L VV  GGY    ++R
Sbjct: 300 HGECVKFVKSFGLPML-VVGGGGYTPRNVSR 329

>KAFR0C02920 Chr3 complement(584668..586029) [1362 bp, 453 aa] {ON}
           Anc_8.153 YGL194C
          Length = 453

 Score =  131 bits (329), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 91/334 (27%), Positives = 168/334 (50%), Gaps = 32/334 (9%)

Query: 59  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLM 118
           G  Y  R+ YH     S + Y   HP  P      ++++  + L++   L  + DL +  
Sbjct: 23  GSSYTPRVSYHFNPKVSNYHYGVNHPMKP------FRLMLTDHLVSSYGLHKIMDLYE-- 74

Query: 119 LKIPVRAATSEEILEVHTKEHLEFIE-----STEKMSREQLLKETEKGDSVYFNNDSYAS 173
                R AT EE+ + H+ ++L+F+E     +  K+ R  L K     D   F N  Y  
Sbjct: 75  ----TREATKEEMSQFHSSDYLDFLEKISPDTLNKIPRGTLEKFNIGSDCPIFEN-IYDY 129

Query: 174 ARLPCGGAIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNILKNY 232
           + L  G +++A + ++ G  ++ +A+    G HHA+     GFC  +++ ++  N+L+ +
Sbjct: 130 STLYTGASLDASRKLING--QSEIAINWSGGLHHAKKNNPSGFCYINDIVLSILNLLRYH 187

Query: 233 PESVRRIMILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQAGEGKG 292
           P    R++ +D D+HHG+G Q++FY  D+V  +S H++  G+++PGT  G YD+ G   G
Sbjct: 188 P----RVLYIDIDLHHGDGVQEAFYTTDRVFTISFHKYN-GEFFPGT--GNYDEIGCSGG 240

Query: 293 EGFNCNITWPVG-GVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVT 351
           + F  N+  P+  G+ D  Y+  F+ ++ P+   ++P ++I   G D+   D +G  ++ 
Sbjct: 241 KHFAMNV--PLNDGIDDDSYIKLFKSIIDPLITSYQPTVIIQQCGADSLGHDRLGCFNLN 298

Query: 352 PSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIAR 385
              +G     + S     + VV  GGY    ++R
Sbjct: 299 IKAHGECVKFVSSFGIP-MLVVGGGGYTPRNVSR 331

>CAGL0A03322g Chr1 (338516..339868) [1353 bp, 450 aa] {ON} highly
           similar to uniprot|P53096 Saccharomyces cerevisiae
           YGL194c HOS2 or uniprot|P32561 Saccharomyces cerevisiae
           YNL330c RPD3
          Length = 450

 Score =  130 bits (328), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 93/340 (27%), Positives = 171/340 (50%), Gaps = 31/340 (9%)

Query: 53  YSPL-KTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGV 111
           + PL + G  Y  R+ YH     S++ Y   HP  P R+           ++ D  +SG 
Sbjct: 14  FQPLYEFGSNYAPRVSYHINPEVSHYHYGVRHPMKPFRL-----------MLTDHLVSGY 62

Query: 112 DDLGDLMLKIPVRAATSEEILEVHTKEHLEFI-----ESTEKMSREQLLKETEKGDSVYF 166
             L  +M     R AT+EE+ E H+++++ F+     E+  K+ R  L K     D   F
Sbjct: 63  G-LHKIMDLYKTRKATAEEMEEFHSEDYVNFLSKVTPENLSKLPRGTLEKFNIGDDCPIF 121

Query: 167 NNDSYASARLPCGGAIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAA 225
            N  +  + L  G +++A + ++    ++ +A+    G HHA+  +  GFC  +++ +A 
Sbjct: 122 PN-IFQYSSLYTGASLDASRKLINN--QSDIAINWSGGLHHAKKNSPSGFCYINDIVLAI 178

Query: 226 KNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYD 285
            N+L+ +P    R++ +D D+HHG+G Q++FY  D+V  +S H++  G+++PGT  G+ D
Sbjct: 179 LNLLRYHP----RVLYIDIDLHHGDGVQEAFYTTDRVYTISFHKYN-GEFFPGT--GKND 231

Query: 286 QAGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTI 345
           + G   G+ F  N+     G+ D  Y+  F+ ++ P+   FKP +++   G D+   D +
Sbjct: 232 ETGCADGKHFAMNVPLE-DGIDDDSYINLFKSIIDPLITTFKPTVILQQCGADSLGHDRL 290

Query: 346 GQCHVTPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIAR 385
           G  ++    +G     ++S     + VV  GGY    ++R
Sbjct: 291 GCFNLNIKAHGECVKFVRSFGIP-MLVVGGGGYTPRNVSR 329

>Kwal_55.20790 s55 complement(559958..561307) [1350 bp, 449 aa] {ON}
           YGL194C (HOS2) - (putative) histone deacetylase [contig
           139] FULL
          Length = 449

 Score =  130 bits (328), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 90/332 (27%), Positives = 165/332 (49%), Gaps = 28/332 (8%)

Query: 59  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLM 118
           G  +   + YH     S F Y   HP  P      ++++  + L++   L  + DL +  
Sbjct: 21  GASHQPAVSYHFNDDVSQFHYGVKHPMKP------FRLMLTDHLVSSYGLHKIMDLYE-- 72

Query: 119 LKIPVRAATSEEILEVHTKEHLEFIESTEKMSREQL----LKETEKGDSVYFNNDSYASA 174
                R AT EE+ E H+++++EF+      +  +L    L++   GD        Y  +
Sbjct: 73  ----TRPATREELCEFHSEDYVEFLARVSPDNLAKLPRGSLEKFNIGDDCPIFQGLYQYS 128

Query: 175 RLPCGGAIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNILKNYP 233
            L  G +++A + ++ G  ++ +A+    G HHA+     GFC  +++ ++  N+L+ +P
Sbjct: 129 TLYAGASLDATRKLING--QSEIAINWSGGLHHAKKSNPSGFCYVNDIVLSVLNLLRYHP 186

Query: 234 ESVRRIMILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQAGEGKGE 293
               R++ +D D+HHG+G Q++FY  D+V  VS H++  G+++PGT  G  D+ G  +G+
Sbjct: 187 ----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GNLDEIGCSRGK 239

Query: 294 GFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPS 353
            F  N+     G+ D  Y+  F+ ++ P+   FKP ++I   G D+   D +G  ++   
Sbjct: 240 HFALNVPLD-DGIDDDSYINLFKSIIDPLITSFKPTVIIQQCGADSLGHDRLGCFNLNVK 298

Query: 354 CYGHMTHMLKSLARGNLCVVLEGGYNLDAIAR 385
            +G     +KS     L VV  GGY    ++R
Sbjct: 299 AHGECVKYVKSFGLPML-VVGGGGYTPRNVSR 329

>Suva_7.71 Chr7 complement(135837..137195) [1359 bp, 452 aa] {ON}
           YGL194C (REAL)
          Length = 452

 Score =  130 bits (328), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 90/330 (27%), Positives = 160/330 (48%), Gaps = 30/330 (9%)

Query: 62  YDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKI 121
           Y  R+ YH     S++ Y   HP  P R+     +++  GL              +M   
Sbjct: 24  YSPRVSYHFNPKASHYHYGVKHPMKPIRLMLTDHLVSSYGL------------HKIMDLY 71

Query: 122 PVRAATSEEILEVHTKEHLEFI-----ESTEKMSREQLLKETEKGDSVYFNNDSYASARL 176
             R+AT +E+ E HT++++ F+     E+  K+ R  L       D   F N  Y    L
Sbjct: 72  ETRSATKDELFEFHTEDYVNFLSKVSPENVNKLPRGTLENFNIGDDCPIFQN-LYDYTTL 130

Query: 177 PCGGAIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNILKNYPES 235
             G  ++A + ++    ++ +A+    G HHA+  +  GFC  +++ ++  N+L+ +P  
Sbjct: 131 YTGATLDATRKLINN--QSDIAINWSGGLHHAKKNSPSGFCYVNDIVLSILNLLRYHP-- 186

Query: 236 VRRIMILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQAGEGKGEGF 295
             R++ +D D+HHG+G Q++FY  D+V  +S H++  G+++PGT  G   + G  KG+ F
Sbjct: 187 --RVLYIDIDLHHGDGVQEAFYTTDRVFTLSFHKYN-GEFFPGT--GDLTEIGCDKGKHF 241

Query: 296 NCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCY 355
             N+     G+ D  Y+  F+ +V P+   FKP +++   G D+   D +G  ++    +
Sbjct: 242 ALNVPLE-DGIDDDSYINLFKSIVDPLITTFKPTVIVQQCGADSLGHDRLGCFNLNIKAH 300

Query: 356 GHMTHMLKSLARGNLCVVLEGGYNLDAIAR 385
           G     +KS     L VV  GGY    ++R
Sbjct: 301 GECVKFVKSFGLPML-VVGGGGYTPKNVSR 329

>Smik_7.79 Chr7 complement(134747..136105) [1359 bp, 452 aa] {ON}
           YGL194C (REAL)
          Length = 452

 Score =  130 bits (327), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 88/330 (26%), Positives = 166/330 (50%), Gaps = 28/330 (8%)

Query: 61  CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLK 120
            Y  R+ YH     S++ Y   HP  P      ++++  + L++   L  + DL +    
Sbjct: 23  AYSPRVSYHFNSKVSHYHYGVKHPMKP------FRLMLTDHLVSSYGLHKIMDLYE---- 72

Query: 121 IPVRAATSEEILEVHTKEHLEFIESTEKMSREQLLKETEK----GDSVYFNNDSYASARL 176
              R+AT +E+L+ H+++++ F+      +  +L + T +    GD      + Y    L
Sbjct: 73  --TRSATRDELLQFHSEDYVNFLSKVSPDNANKLPRGTLENFNIGDDCPIFQNLYDYTTL 130

Query: 177 PCGGAIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNILKNYPES 235
             G +++A + ++    ++ +A+    G HHA+  +  GFC  +++ ++  N+L+ +P  
Sbjct: 131 YTGASLDATRKLINN--QSDIAINWSGGLHHAKKNSPSGFCYVNDIVLSILNLLRYHP-- 186

Query: 236 VRRIMILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQAGEGKGEGF 295
             RI+ +D D+HHG+G Q++FY  D+V  +S H++  G+++PGT  G   + G  KG+ F
Sbjct: 187 --RILYIDIDLHHGDGVQEAFYTTDRVFTLSFHKYN-GEFFPGT--GDLTEIGCDKGKHF 241

Query: 296 NCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCY 355
             N+     G+ D  Y+  F+ +V P+   FKP L++   G D+   D +G  ++    +
Sbjct: 242 ALNVPLE-DGIDDDSYINLFKSIVDPLIITFKPTLIVQQCGADSLGHDRLGCFNLNIKAH 300

Query: 356 GHMTHMLKSLARGNLCVVLEGGYNLDAIAR 385
           G     +KS     L VV  GGY    ++R
Sbjct: 301 GECVKFVKSFGLPML-VVGGGGYTPRNVSR 329

>ZYRO0G19316g Chr7 (1600375..1601721) [1347 bp, 448 aa] {ON} highly
           similar to uniprot|P53096 Saccharomyces cerevisiae
           YGL194C HOS2 Histone deacetylase required for gene
           activation via specific deacetylation of lysines in H3
           and H4 histone tails subunit of the Set3 complex a
           meiotic-specific repressor of sporulation specific genes
           that contains deacetylase activity
          Length = 448

 Score =  130 bits (327), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 91/336 (27%), Positives = 169/336 (50%), Gaps = 30/336 (8%)

Query: 56  LKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLG 115
            + G  Y  R+ YH     S + Y   HP  P      ++++  + L++   L  + DL 
Sbjct: 17  FQFGSSYCPRVSYHFNPKVSNYHYGTKHPMKP------FRLMLTDHLVSSYGLHKIMDLY 70

Query: 116 DLMLKIPVRAATSEEILEVHTKEHLEFI-----ESTEKMSREQLLKETEKGDSVYFNNDS 170
           +       R AT EE+   H++E+++F+     E+  K+ R  L K     D   F N  
Sbjct: 71  E------TRVATWEEMTAFHSEEYVDFMKRVTPENLNKLPRGTLEKFNIGDDCPIFPN-L 123

Query: 171 YASARLPCGGAIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNIL 229
           Y  + L  G +++A + ++    ++ +A+    G HHA+     GFC  +++ +A  N+L
Sbjct: 124 YDYSSLYAGASLDASRKLIND--QSDIAINWSGGLHHAKKSNPSGFCYVNDIVLATLNLL 181

Query: 230 KNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQAGE 289
           + +P    R++ +D D+HHG+G Q++FY  D+V  VS H++  G+++PGT  G +D+ G 
Sbjct: 182 RYHP----RVLYIDIDLHHGDGVQEAFYTTDRVYTVSFHKYN-GEFFPGT--GNHDEVGC 234

Query: 290 GKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCH 349
            +G+ F  N+     G+ D  Y+  F+ ++ P+   +KP +++   G D+   D +G  +
Sbjct: 235 ARGKHFALNVPLQ-DGIDDDSYINLFKSIIDPLITSYKPTVIVQQCGADSLGHDRLGCFN 293

Query: 350 VTPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIAR 385
           +    +G   + ++S     L VV  GGY    ++R
Sbjct: 294 LNVKAHGECVNFVRSFGLPML-VVGGGGYTPRNVSR 328

>KLLA0F09119g Chr6 (848467..849825) [1359 bp, 452 aa] {ON} highly
           similar to uniprot|P53096 Saccharomyces cerevisiae
           YGL194C HOS2 Histone deacetylase required for gene
           activation via specific deacetylation of lysines in H3
           and H4 histone tails subunit of the Set3 complex a
           meiotic-specific repressor of sporulation specific genes
           that contains deacetylase activity
          Length = 452

 Score =  129 bits (325), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 91/333 (27%), Positives = 167/333 (50%), Gaps = 30/333 (9%)

Query: 59  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLM 118
           G  Y  R+ YH     S + Y   HP  P      ++++  + L++   L  V DL +  
Sbjct: 24  GTSYSPRVSYHFNSKVSQYHYGVKHPMKP------FRLMLTDHLVSAYGLHKVMDLYE-- 75

Query: 119 LKIPVRAATSEEILEVHTKEHLEFI-----ESTEKMSREQLLKETEKGDSVYFNNDSYAS 173
                R+AT +E+ + H+++++ F+     ++  K+ R  L K     D   F    +  
Sbjct: 76  ----TRSATKDELTKFHSEDYVNFLAKVTPDTLNKLPRGSLEKFNIGDDCPIFQG-MFDY 130

Query: 174 ARLPCGGAIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNILKNY 232
           A L  G +++A + ++ G  ++ +A+    G HHA+     GFC  +++ +A  N+L+ +
Sbjct: 131 AALYAGASLDASRKLLNG--QSEIAINWSGGLHHAKKNNPSGFCYVNDIVLAIVNLLRYH 188

Query: 233 PESVRRIMILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQAGEGKG 292
           P    R++ +D D+HHG+G Q++FY  D+V  VS H++  G+++PGT  G  D+ G  +G
Sbjct: 189 P----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GDLDEIGCSRG 241

Query: 293 EGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTP 352
           + F  N+     G+ D  Y+  F+ ++ P+   F+P ++I   G D+   D +G  ++  
Sbjct: 242 KHFALNVPLQ-DGIEDDSYINLFKSIIDPVITSFRPSVIIQQCGADSLGHDRLGCFNLNI 300

Query: 353 SCYGHMTHMLKSLARGNLCVVLEGGYNLDAIAR 385
             +G     +KS     L VV  GGY    ++R
Sbjct: 301 KAHGECVRFVKSFGVPML-VVGGGGYTPRNVSR 332

>Kpol_1038.11 s1038 complement(25267..26568) [1302 bp, 433 aa] {ON}
           complement(25267..26568) [1302 nt, 434 aa]
          Length = 433

 Score =  127 bits (319), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 87/326 (26%), Positives = 156/326 (47%), Gaps = 28/326 (8%)

Query: 65  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKIPVR 124
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLVMNYGLYKK------------MEIYRAK 67

Query: 125 AATSEEILEVHTKEHLEFIESTEKMSREQLLKETEK---GDSVYFNNDSYASARLPCGGA 181
            AT +E+ + HT E+++F+      + +   KE+ K   GD     +  Y    +  GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 182 IEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIM 240
           +E    +  G  K  +A+    G HHA+   A GFC  +++ +    +L+ +P    R++
Sbjct: 128 MEGAARLNRG--KCDVAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 241 ILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQAGEGKGEGFNCNIT 300
            +D D+HHG+G +++FY  D+V+  S H++  G+++PGT  G+    G GKG+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKNYAVNVP 237

Query: 301 WPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTH 360
               G+ DA Y   FE V+  +   ++P  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 LR-DGIDDATYRAVFESVISKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMRGHANCVN 296

Query: 361 MLKSLARGNLCVVLEGGYNLDAIARS 386
            +KS     L VV  GGY +  +AR+
Sbjct: 297 FVKSFGI-PLMVVGGGGYTMRNVART 321

>Suva_14.11 Chr14 complement(13144..14445) [1302 bp, 433 aa] {ON}
           YNL330C (REAL)
          Length = 433

 Score =  127 bits (318), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 88/326 (26%), Positives = 158/326 (48%), Gaps = 28/326 (8%)

Query: 65  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKIPVR 124
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 125 AATSEEILEVHTKEHLEFIESTEKMSREQLLKETEK---GDSVYFNNDSYASARLPCGGA 181
            AT +E+ + HT E+++F+      + E   +E+ K   GD     +  Y    +  GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKRESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 182 IEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIM 240
           +E    +  G  K  +AV    G HHA+   A GFC  +++ +    +L+ +P    R++
Sbjct: 128 MEGAARLNRG--KCDVAVNYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 241 ILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQAGEGKGEGFNCNIT 300
            +D D+HHG+G +++FY  D+V+  S H++  G+++PGT  G+    G GKG+ ++ N+ 
Sbjct: 182 YVDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDVGVGKGKNYSVNVP 237

Query: 301 WPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTH 360
               G+ DA Y   FE VV  +   ++P  V++ +G D+  GD +G  +++   + +  +
Sbjct: 238 LR-DGIDDATYRAVFEPVVKRIMDWYQPSAVVLQTGGDSLSGDRLGCFNLSMEGHANCVN 296

Query: 361 MLKSLARGNLCVVLEGGYNLDAIARS 386
            +KS     + VV  GGY +  +AR+
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVART 321

>Skud_14.11 Chr14 complement(11451..12752) [1302 bp, 433 aa] {ON}
           YNL330C (REAL)
          Length = 433

 Score =  126 bits (316), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 87/326 (26%), Positives = 156/326 (47%), Gaps = 28/326 (8%)

Query: 65  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKIPVR 124
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 125 AATSEEILEVHTKEHLEFIESTEKMSREQLLKETEK---GDSVYFNNDSYASARLPCGGA 181
            AT +E+ + HT E+++F+      + E   +E+ K   GD     +  Y    +  GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKRESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 182 IEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIM 240
           +E    +  G  K  +AV    G HHA+   A GFC  +++ +    +L+ +P    R++
Sbjct: 128 MEGAARLNRG--KCDVAVNYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 241 ILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQAGEGKGEGFNCNIT 300
            +D D+HHG+G +++FY  D+V+  S H++  G+++PGT  G+    G G G+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYSTDRVMTCSFHKY--GEFFPGT--GELRDIGVGTGKNYAVNVP 237

Query: 301 WPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTH 360
               G+ DA Y   FE V+  +   ++P  V++  G D+  GD +G  +++   +G+  +
Sbjct: 238 LR-DGIDDATYRSVFEPVIKKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMEGHGNCVN 296

Query: 361 MLKSLARGNLCVVLEGGYNLDAIARS 386
            +KS     + VV  GGY +  +AR+
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVART 321

>NDAI0G03740 Chr7 complement(900866..902167) [1302 bp, 433 aa] {ON}
           Anc_3.8
          Length = 433

 Score =  125 bits (315), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 87/326 (26%), Positives = 156/326 (47%), Gaps = 28/326 (8%)

Query: 65  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKIPVR 124
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGSGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 125 AATSEEILEVHTKEHLEFIESTEKMSREQLLKETEK---GDSVYFNNDSYASARLPCGGA 181
            AT +E+ + HT E+++F+      + E   KE+ K   GD     +  Y    +  GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLELFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 182 IEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIM 240
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    R++
Sbjct: 128 MEGAARLNRGKC--DVAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 241 ILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQAGEGKGEGFNCNIT 300
            +D D+HHG+G +++FY  D+V+  S H++  G+++PGT  G+    G GKG+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYSTDRVMTCSFHKY--GEFFPGT--GELRDVGVGKGKYYAVNVP 237

Query: 301 WPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTH 360
               G+ DA Y   FE VV  +   ++P  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 LR-DGIDDATYRNVFEPVVKRIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHANCVN 296

Query: 361 MLKSLARGNLCVVLEGGYNLDAIARS 386
            +KS     + VV  GGY +  +AR+
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVART 321

>Kwal_55.22142 s55 (1130691..1131989) [1299 bp, 432 aa] {ON} YNL330C
           (RPD3) - histone deacetylase [contig 124] FULL
          Length = 432

 Score =  125 bits (315), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 88/326 (26%), Positives = 157/326 (48%), Gaps = 28/326 (8%)

Query: 65  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKIPVR 124
           R+ Y      S + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDSDVSNYSYGASHPMKPARIRMAHSLVMNYGLYKK------------MEIYRAK 67

Query: 125 AATSEEILEVHTKEHLEFIESTEKMSREQLLKETEK---GDSVYFNNDSYASARLPCGGA 181
            AT +E+ + HT E+++F+      + E   KE+ K   GD     +  Y    +  GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFQKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 182 IEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIM 240
           +E    +  G  K  +A+    G HHA+   A GFC  +++ +    +L+ +P    R++
Sbjct: 128 MEGAARLNRG--KCDVAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 241 ILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQAGEGKGEGFNCNIT 300
            +D D+HHG+G +++FY  D+V+  S H++  G+++PGT  G+    G GKG+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYAVNVP 237

Query: 301 WPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTH 360
               G+ D+ Y   FE V+  +   ++P  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 LR-DGIDDSTYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMRGHANCVN 296

Query: 361 MLKSLARGNLCVVLEGGYNLDAIARS 386
            +KS     L VV  GGY +  +AR+
Sbjct: 297 YVKSFGIPML-VVGGGGYTMRNVART 321

>KNAG0A01160 Chr1 complement(7229..8530) [1302 bp, 433 aa] {ON}
           Anc_3.8 YNL330C
          Length = 433

 Score =  125 bits (315), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 88/326 (26%), Positives = 156/326 (47%), Gaps = 28/326 (8%)

Query: 65  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKIPVR 124
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 125 AATSEEILEVHTKEHLEFIESTEKMSREQLLKETEK---GDSVYFNNDSYASARLPCGGA 181
            AT +E+ + HT E+++F+      + E   KE+ K   GD     +  Y    +  GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 182 IEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIM 240
           +E+   +  G  K  +A+    G HHA+   A GFC  +++ +    +L+ +P    R++
Sbjct: 128 MESAARLNRG--KCDIAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 241 ILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQAGEGKGEGFNCNIT 300
            +D D+HHG+G +++FY  D+V+  S H++  G+++PGT  G+    G GKG+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGKGQNYAVNVP 237

Query: 301 WPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTH 360
               G+ DA Y   FE VV  +   ++P  V++  G D+  GD +G  +++   +    +
Sbjct: 238 L-RDGIDDATYRSVFEPVVGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHASCVN 296

Query: 361 MLKSLARGNLCVVLEGGYNLDAIARS 386
            +KS     + VV  GGY +  +AR+
Sbjct: 297 YVKSFNI-PMMVVGGGGYTMRNVART 321

>NCAS0C04320 Chr3 (887622..888926) [1305 bp, 434 aa] {ON} Anc_3.8
          Length = 434

 Score =  125 bits (314), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 86/326 (26%), Positives = 156/326 (47%), Gaps = 28/326 (8%)

Query: 65  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKIPVR 124
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 21  RVAYFYDADVGNYAYGSGHPMKPHRIRMTHSLVMNYGLYKK------------MEIYRAK 68

Query: 125 AATSEEILEVHTKEHLEFIESTEKMSREQLLKETEK---GDSVYFNNDSYASARLPCGGA 181
            AT +E+ + HT E+++F+      + E   KE+ K   GD     +  Y    +  GG+
Sbjct: 69  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 128

Query: 182 IEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIM 240
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    R++
Sbjct: 129 MEGAARLNRGKC--DVAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRFHP----RVL 182

Query: 241 ILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQAGEGKGEGFNCNIT 300
            +D D+HHG+G +++FY  D+V+  S H++  G+++PGT  G+    G GKG+ +  N+ 
Sbjct: 183 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYAVNVP 238

Query: 301 WPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTH 360
               G+ DA Y   FE V+  +   ++P  V++  G D+  GD +G  +++   + +  +
Sbjct: 239 LR-DGIDDATYRNVFEPVIKRIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHANCVN 297

Query: 361 MLKSLARGNLCVVLEGGYNLDAIARS 386
            +KS     + VV  GGY +  +AR+
Sbjct: 298 YVKSFGI-PMMVVGGGGYTMRNVART 322

>TBLA0I00560 Chr9 (100393..101694) [1302 bp, 433 aa] {ON} Anc_3.8
           YNL330C
          Length = 433

 Score =  125 bits (314), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 84/326 (25%), Positives = 156/326 (47%), Gaps = 28/326 (8%)

Query: 65  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKIPVR 124
           R+ Y        + Y   HP  P RI   + ++   GL  +            M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKN------------MEIYRAK 67

Query: 125 AATSEEILEVHTKEHLEFIESTEKMSREQLLKETEK---GDSVYFNNDSYASARLPCGGA 181
            AT +E+ + HT E+++F+      + +   KE+ K   GD     +  Y    +  GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 182 IEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIM 240
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    R++
Sbjct: 128 MEGAARLNRGKC--DVAINYAGGLHHAKKSEASGFCFLNDIVLGIIELLRYHP----RVL 181

Query: 241 ILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQAGEGKGEGFNCNIT 300
            +D D+HHG+G +++FY  D+V+  S H++  G+++PGT  G+    G G G+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGNGKNYAVNVP 237

Query: 301 WPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTH 360
               G+ DA Y   FE V+  +   ++P  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 L-RDGIDDATYRSVFEPVISKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHANCVN 296

Query: 361 MLKSLARGNLCVVLEGGYNLDAIARS 386
            +KS     + VV  GGY +  +AR+
Sbjct: 297 FVKSFNI-PMMVVGGGGYTMRNVART 321

>CAGL0B01441g Chr2 complement(130216..131517) [1302 bp, 433 aa] {ON}
           highly similar to uniprot|P32561 Saccharomyces
           cerevisiae YNL330c RPD3 histone deacetylase B or
           uniprot|P53096 Saccharomyces cerevisiae YGL194c HOS2
          Length = 433

 Score =  125 bits (314), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 86/326 (26%), Positives = 156/326 (47%), Gaps = 28/326 (8%)

Query: 65  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKIPVR 124
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 125 AATSEEILEVHTKEHLEFIESTEKMSREQLLKETEK---GDSVYFNNDSYASARLPCGGA 181
            AT +E+ + HT E+++F+      + E   KE+ K   GD     +  Y    +  GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 182 IEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIM 240
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    R++
Sbjct: 128 MEGAARLNRGKC--DVAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 241 ILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQAGEGKGEGFNCNIT 300
            +D D+HHG+G +++FY  D+V+  S H++  G+++PGT  G+    G GKG+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGKGKYYAVNVP 237

Query: 301 WPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTH 360
               G+ DA Y   FE V+  +   ++P  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 L-RDGIDDATYRSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMEGHANCVN 296

Query: 361 MLKSLARGNLCVVLEGGYNLDAIARS 386
            +KS     + VV  GGY +  +AR+
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVART 321

>ZYRO0C03498g Chr3 (278064..279365) [1302 bp, 433 aa] {ON} highly
           similar to uniprot|P32561 Saccharomyces cerevisiae
           YNL330C RPD3 Histone deacetylase regulates transcription
           and silencing
          Length = 433

 Score =  125 bits (313), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 86/326 (26%), Positives = 156/326 (47%), Gaps = 28/326 (8%)

Query: 65  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKIPVR 124
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYNYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 125 AATSEEILEVHTKEHLEFIESTEKMSREQLLKETEK---GDSVYFNNDSYASARLPCGGA 181
            AT +E+ + HT E+++F+      + +   KE+ K   GD     +  Y    +  GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 182 IEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIM 240
           +E    +  G  K  +A+    G HHA+   A GFC  +++ +    +L+ +P    R++
Sbjct: 128 MEGAARLNRG--KCDVAINYAGGLHHAKKTEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 241 ILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQAGEGKGEGFNCNIT 300
            +D D+HHG+G +++FY  D+V+  S H++  G+++PGT  G+    G GKG+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYAVNVP 237

Query: 301 WPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTH 360
               G+ DA Y   FE VV  +   ++P  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 L-RDGIDDATYKSVFEPVVSRIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSIRGHANCVN 296

Query: 361 MLKSLARGNLCVVLEGGYNLDAIARS 386
            +KS     + +V  GGY +  +AR+
Sbjct: 297 FVKSFGL-PMMIVGGGGYTMRNVART 321

>Ecym_2010 Chr2 complement(12699..14000) [1302 bp, 433 aa] {ON}
           similar to Ashbya gossypii AGR395W
          Length = 433

 Score =  125 bits (313), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 86/326 (26%), Positives = 157/326 (48%), Gaps = 28/326 (8%)

Query: 65  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKIPVR 124
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 125 AATSEEILEVHTKEHLEFIESTEKMSREQLLKETEK---GDSVYFNNDSYASARLPCGGA 181
            AT +E+ + HT E+++F+      + +   KE+ K   GD     +  Y    +  GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFQKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 182 IEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIM 240
           +E    +  G  K  +A+    G HHA+   A GFC  +++ +    +L+ +P    R++
Sbjct: 128 MEGAARLNRG--KCDVAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 241 ILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQAGEGKGEGFNCNIT 300
            +D D+HHG+G +++FY  D+V+  S H++  G+++PGT  G+    G GKG+ ++ N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYSVNVP 237

Query: 301 WPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTH 360
               G+ DA Y   FE V+  +   ++P  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 LR-DGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMRGHANCVN 296

Query: 361 MLKSLARGNLCVVLEGGYNLDAIARS 386
            +KS     + VV  GGY +  +AR+
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVART 321

>KLLA0E01981g Chr5 complement(186177..187475) [1299 bp, 432 aa] {ON}
           highly similar to uniprot|P32561 Saccharomyces
           cerevisiae YNL330C RPD3 Histone deacetylase regulates
           transcription and silencing
          Length = 432

 Score =  125 bits (313), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 86/326 (26%), Positives = 156/326 (47%), Gaps = 28/326 (8%)

Query: 65  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKIPVR 124
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 125 AATSEEILEVHTKEHLEFIESTEKMSREQLLKETEK---GDSVYFNNDSYASARLPCGGA 181
            AT +E+ + HT E+++F+      + +   KE+ K   GD     +  Y    +  GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFQKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 182 IEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIM 240
           +E    +  G  K  +A+    G HHA+   A GFC  +++ +    +L+ +P    R++
Sbjct: 128 MEGAARLNRG--KCDVAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 241 ILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQAGEGKGEGFNCNIT 300
            +D D+HHG+G +++FY  D+V+  S H++  G+++PGT  G+    G GKG+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYAVNVP 237

Query: 301 WPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTH 360
               G+ DA Y   FE V+  +   ++P  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 LR-DGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMKGHANCVN 296

Query: 361 MLKSLARGNLCVVLEGGYNLDAIARS 386
            +KS     L +V  GGY +  +AR+
Sbjct: 297 YMKSFGV-PLMIVGGGGYTMRNVART 321

>AGR395W Chr7 (1455659..1456960) [1302 bp, 433 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL330C (RPD3)
          Length = 433

 Score =  125 bits (313), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 86/326 (26%), Positives = 157/326 (48%), Gaps = 28/326 (8%)

Query: 65  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKIPVR 124
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 125 AATSEEILEVHTKEHLEFIESTEKMSREQLLKETEK---GDSVYFNNDSYASARLPCGGA 181
            AT +E+ + HT E+++F+      + +   KE+ K   GD     +  Y    +  GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFQKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 182 IEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIM 240
           +E    +  G  K  +A+    G HHA+   A GFC  +++ +    +L+ +P    R++
Sbjct: 128 MEGAARLNRG--KCDVAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 241 ILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQAGEGKGEGFNCNIT 300
            +D D+HHG+G +++FY  D+V+  S H++  G+++PGT  G+    G GKG+ ++ N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYSVNVP 237

Query: 301 WPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTH 360
               G+ DA Y   FE V+  +   ++P  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 LR-DGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMRGHANCVN 296

Query: 361 MLKSLARGNLCVVLEGGYNLDAIARS 386
            +KS     + VV  GGY +  +AR+
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVART 321

>KLTH0F19668g Chr6 (1595709..1597007) [1299 bp, 432 aa] {ON} highly
           similar to uniprot|P32561 Saccharomyces cerevisiae
           YNL330C RPD3 Histone deacetylase regulates transcription
           and silencing
          Length = 432

 Score =  124 bits (312), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 87/326 (26%), Positives = 157/326 (48%), Gaps = 28/326 (8%)

Query: 65  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKIPVR 124
           R+ Y      S + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDSDVSNYSYGASHPMKPARIRMAHSLVMNYGLYKK------------MEIYRAK 67

Query: 125 AATSEEILEVHTKEHLEFIESTEKMSREQLLKETEK---GDSVYFNNDSYASARLPCGGA 181
            AT +E+ + H+ E+++F+      + E   KE+ K   GD     +  Y    +  GG+
Sbjct: 68  PATKQEMCQFHSDEYIDFLSRVTPDNLEMFQKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 182 IEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIM 240
           +E    +  G  K  +A+    G HHA+   A GFC  +++ +    +L+ +P    R++
Sbjct: 128 MEGAARLNRG--KCDVAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 241 ILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQAGEGKGEGFNCNIT 300
            +D D+HHG+G +++FY  D+V+  S H++  G+++PGT  G+    G GKG+ ++ N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYSVNVP 237

Query: 301 WPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTH 360
               G+ D  Y   FE V+  +   ++P  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 LR-DGIDDTTYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMRGHANCVN 296

Query: 361 MLKSLARGNLCVVLEGGYNLDAIARS 386
            +KS     L VV  GGY +  +AR+
Sbjct: 297 YVKSFGIPML-VVGGGGYTMRNVART 321

>SAKL0C13706g Chr3 (1207800..1209101) [1302 bp, 433 aa] {ON} highly
           similar to uniprot|P32561 Saccharomyces cerevisiae
           YNL330C RPD3 Histone deacetylase regulates transcription
           and silencing
          Length = 433

 Score =  124 bits (312), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 85/326 (26%), Positives = 156/326 (47%), Gaps = 28/326 (8%)

Query: 65  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKIPVR 124
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 125 AATSEEILEVHTKEHLEFIESTEKMSREQLLKETEK---GDSVYFNNDSYASARLPCGGA 181
            AT +E+ + HT E+++F+      +     KE+ K   GD     +  Y    +  GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLNMFQKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 182 IEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIM 240
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    R++
Sbjct: 128 MEGAARLNRGKC--DVAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 241 ILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQAGEGKGEGFNCNIT 300
            +D D+HHG+G +++FY  D+V+  S H++  G+++PGT  G+    G GKG+ ++ N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYSVNVP 237

Query: 301 WPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTH 360
               G+ DA Y   FE V+  +   ++P  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 L-RDGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMKGHANCVN 296

Query: 361 MLKSLARGNLCVVLEGGYNLDAIARS 386
            +KS     + VV  GGY +  +AR+
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVART 321

>KAFR0A08630 Chr1 (1731077..1732378) [1302 bp, 433 aa] {ON} Anc_3.8
           YNL330C
          Length = 433

 Score =  124 bits (312), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 85/326 (26%), Positives = 156/326 (47%), Gaps = 28/326 (8%)

Query: 65  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKIPVR 124
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 125 AATSEEILEVHTKEHLEFIESTEKMSREQLLKETEK---GDSVYFNNDSYASARLPCGGA 181
            AT +E+ + HT E+++F+      + +   KE+ K   GD     +  Y    +  GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 182 IEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIM 240
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    R++
Sbjct: 128 MEGAARLNRGKC--DIAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 241 ILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQAGEGKGEGFNCNIT 300
            +D D+HHG+G +++FY  D+V+  S H++  G+++PGT  G+    G GKG+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGKGKNYAVNVP 237

Query: 301 WPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTH 360
               G+ DA Y   FE V+  +   ++P  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 L-RDGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHANCVN 296

Query: 361 MLKSLARGNLCVVLEGGYNLDAIARS 386
            +KS     + VV  GGY +  +AR+
Sbjct: 297 YVKSFNI-PMMVVGGGGYTMRNVART 321

>Smik_14.2 Chr14 complement(2435..3736) [1302 bp, 433 aa] {ON}
           YNL330C (REAL)
          Length = 433

 Score =  124 bits (310), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 86/326 (26%), Positives = 155/326 (47%), Gaps = 28/326 (8%)

Query: 65  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKIPVR 124
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 125 AATSEEILEVHTKEHLEFIESTEKMSREQLLKETEK---GDSVYFNNDSYASARLPCGGA 181
            AT +E+ + HT E+++F+      + E   +E+ K   GD     +  Y    +  GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKRESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 182 IEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIM 240
           +E    +  G  K  +AV    G HHA+   A GFC  +++ +    +L+ +P    R++
Sbjct: 128 MEGAARLNRG--KCDVAVNYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 241 ILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQAGEGKGEGFNCNIT 300
            +D D+HHG+G +++FY  D+V+  S H++  G+++PGT  G+    G G G+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGTGKNYAVNVP 237

Query: 301 WPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTH 360
               G+ DA Y   FE V+  +   ++P  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 LR-DGIDDATYRSVFEPVIKKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMEGHANCVN 296

Query: 361 MLKSLARGNLCVVLEGGYNLDAIARS 386
            +KS     + VV  GGY +  +AR+
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVART 321

>TPHA0A00300 Chr1 complement(40868..42169) [1302 bp, 433 aa] {ON}
           Anc_3.8 YNL330C
          Length = 433

 Score =  123 bits (309), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 85/326 (26%), Positives = 156/326 (47%), Gaps = 28/326 (8%)

Query: 65  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKIPVR 124
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLVMNYGLYKK------------MEIYRAK 67

Query: 125 AATSEEILEVHTKEHLEFIESTEKMSREQLLKETEK---GDSVYFNNDSYASARLPCGGA 181
            AT +E+ + HT E+++F+      + +   KE+ K   GD     +  +    +  GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESVKFNVGDDCPVFDGLFEYCSISGGGS 127

Query: 182 IEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIM 240
           +E    +  G  K  +A+    G HHA+   A GFC  +++ +    +L+ +P    R++
Sbjct: 128 MEGAARLNRG--KCDVAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 241 ILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQAGEGKGEGFNCNIT 300
            +D D+HHG+G +++FY  D+V+  S H++  G+++PGT  G+    G GKG+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDVGIGKGKNYAVNVP 237

Query: 301 WPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTH 360
               G+ DA Y   FE V+  +   ++P  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 LR-DGMDDATYRSVFESVISKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMRGHANCVN 296

Query: 361 MLKSLARGNLCVVLEGGYNLDAIARS 386
            +KS     + VV  GGY +  +AR+
Sbjct: 297 FVKSFNI-PMMVVGGGGYTMRNVART 321

>YNL330C Chr14 complement(18001..19302) [1302 bp, 433 aa] {ON}
           RPD3Histone deacetylase; regulates transcription,
           silencing, and other processes by influencing chromatin
           remodeling; forms at least two different complexes which
           have distinct functions and members
          Length = 433

 Score =  123 bits (309), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 86/326 (26%), Positives = 155/326 (47%), Gaps = 28/326 (8%)

Query: 65  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKIPVR 124
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 125 AATSEEILEVHTKEHLEFIESTEKMSREQLLKETEK---GDSVYFNNDSYASARLPCGGA 181
            AT +E+ + HT E+++F+      + E   +E+ K   GD     +  Y    +  GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKRESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 182 IEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIM 240
           +E    +  G  K  +AV    G HHA+   A GFC  +++ +    +L+ +P    R++
Sbjct: 128 MEGAARLNRG--KCDVAVNYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 241 ILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQAGEGKGEGFNCNIT 300
            +D D+HHG+G +++FY  D+V+  S H++  G+++PGT  G+    G G G+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGAGKNYAVNVP 237

Query: 301 WPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTH 360
               G+ DA Y   FE V+  +   ++P  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 LR-DGIDDATYRSVFEPVIKKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMEGHANCVN 296

Query: 361 MLKSLARGNLCVVLEGGYNLDAIARS 386
            +KS     + VV  GGY +  +AR+
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVART 321

>TDEL0A00270 Chr1 complement(44950..46251) [1302 bp, 433 aa] {ON}
           Anc_3.8 YNL330C
          Length = 433

 Score =  122 bits (305), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 87/326 (26%), Positives = 155/326 (47%), Gaps = 28/326 (8%)

Query: 65  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKIPVR 124
           R+ Y        F Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNFSYGQYHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 125 AATSEEILEVHTKEHLEFIESTEKMSREQLLKETEK---GDSVYFNNDSYASARLPCGGA 181
            AT +E+ + HT E+++F+      + E   KE+ K   GD     +  Y    +  GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLELFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 182 IEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIM 240
           +E    +  G  K  +A+    G HHA+   A GFC  +++ +    +L+ +P    R++
Sbjct: 128 MEGAARLNRG--KCDVAINYAGGLHHAKKAEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 241 ILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQAGEGKGEGFNCNIT 300
            +D D+HHG+G +++FY  D+V+  S H++  G+++PGT  G+    G G G+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGSGKYYAVNVP 237

Query: 301 WPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTH 360
               G+ DA +   FE VV  +   ++P  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 L-RDGIDDATFRNVFEPVVGKIMEWYQPAAVVLQCGGDSLSGDRLGCFNLSMRGHANCVN 296

Query: 361 MLKSLARGNLCVVLEGGYNLDAIARS 386
            +KS     + VV  GGY +  +AR+
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVART 321

>NDAI0A05120 Chr1 (1164314..1165840) [1527 bp, 508 aa] {ON}
           Anc_3.362 YPR068C
          Length = 508

 Score = 82.0 bits (201), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 70/248 (28%), Positives = 119/248 (47%), Gaps = 21/248 (8%)

Query: 144 ESTEKMSREQLLKETEKGDSVYFNNDSY--ASARLPCGGAIEACKAVVEGRVKNSLAVVR 201
           ++ ++M RE+L     +GD   F   SY     ++  G  +   K +     + ++AV  
Sbjct: 172 DNEKEMIREKLKGYNLEGDCPIF---SYLPVYCQVIVGATLSLAKHITAVANERTIAVNW 228

Query: 202 PPG-HHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDD 260
             G HHA    A GFC  +++ +  + +  N     +RI  +D+D+HHG+G Q+SF    
Sbjct: 229 DGGRHHALRNKASGFCYINDIVLLIQQLRSN---GYKRITYIDFDLHHGDGVQRSFQYST 285

Query: 261 QVLYVSLHRFEMGKYYPGTIQGQYDQAGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVM 320
            V  +S H FE G ++P T  G   ++  GK      NI   + GV D       E+V++
Sbjct: 286 SVQTISAHMFEPG-FFPCT--GSLKESKMGKNI---VNIPL-LHGVDDMLMNEIVEKVMI 338

Query: 321 PMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVL---EGG 377
           P  + + P++++I  G D   GD   +  +T   +G + ++LK L     C V+    GG
Sbjct: 339 PCVKRYDPEILVIQCGGDGLIGDGYAEWQLT--IHGLVNNILKLLRIFPGCPVVLLGGGG 396

Query: 378 YNLDAIAR 385
           YN   ++R
Sbjct: 397 YNETVMSR 404

>TBLA0B02390 Chr2 (558067..559806) [1740 bp, 579 aa] {ON} Anc_3.362
           YPR068C
          Length = 579

 Score = 80.5 bits (197), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 49/182 (26%), Positives = 93/182 (51%), Gaps = 11/182 (6%)

Query: 205 HHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLY 264
           HH+  + A GFC  +++ +    I K   +  R+I  LD+D+HHG+G +KSF     +  
Sbjct: 299 HHSRKKKASGFCYVNDIVLC---IQKLGEKGFRKITYLDFDLHHGDGVEKSFQYSKHIQT 355

Query: 265 VSLHRFEMGKYYPGTIQGQYDQAGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMGR 324
           +S+H FE G ++P T       + E    GFN      + G+ D    +   +V++P+ +
Sbjct: 356 ISVHLFEPG-FFPCT------GSLEETKHGFNIVNIPTLHGLDDNYLTYLLNRVIIPLIK 408

Query: 325 EFKPDLVIISSGFDAADGDTIGQCHVTPS-CYGHMTHMLKSLARGNLCVVLEGGYNLDAI 383
           + KP+ +++  G D   GD   +  +T S    ++  +L++    ++ ++  GGYN   +
Sbjct: 409 KHKPECLVVQCGGDGLIGDRYKEWQMTISGLTKNIMLVLQNFPECSVVLLGGGGYNERVM 468

Query: 384 AR 385
           +R
Sbjct: 469 SR 470

>Skud_16.353 Chr16 complement(647799..649214) [1416 bp, 471 aa] {ON}
           YPR068C (REAL)
          Length = 471

 Score = 79.3 bits (194), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 50/183 (27%), Positives = 94/183 (51%), Gaps = 13/183 (7%)

Query: 205 HHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLY 264
           HHA  Q A GFC  ++V +  + + K     + +I  +D+D+HHG+G +++F    Q+  
Sbjct: 212 HHAFKQKANGFCYINDVVLLIQRLRK---MKLNKITYVDFDLHHGDGVERAFQYSKQIQT 268

Query: 265 VSLHRFEMGKYYPGTIQGQYDQAGEGKGEGFNCNITWPVGGVGDAEYM-WAFEQVVMPMG 323
           +S+H +E G ++PGT  G  + A +GK       +  P+    D  Y+     +++ P+ 
Sbjct: 269 ISIHLYEPG-FFPGT--GSLNDARKGKSV-----VNIPLKHGCDDSYLDLVASKIISPLI 320

Query: 324 REFKPDLVIISSGFDAADGDTIGQCHVTPSCYGH-MTHMLKSLARGNLCVVLEGGYNLDA 382
           +   PD++II  G D   GD   +  +T       + +++K   R ++ ++  GGYN   
Sbjct: 321 KRHDPDVLIIECGGDGLLGDRFNEWQLTIRGLSRTIVNVMKLYPRAHIFLLGGGGYNDLL 380

Query: 383 IAR 385
           ++R
Sbjct: 381 MSR 383

>Suva_16.396 Chr16 complement(689796..691229) [1434 bp, 477 aa] {ON}
           YPR068C (REAL)
          Length = 477

 Score = 79.0 bits (193), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 94/183 (51%), Gaps = 13/183 (7%)

Query: 205 HHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLY 264
           HHA  Q A GFC  ++V +  + + K     + ++  LD+D+HHG+G +K+F    Q+  
Sbjct: 212 HHAFKQKANGFCYINDVVLLIQRLRK---LKLSKVTYLDFDLHHGDGVEKAFQYSRQIQT 268

Query: 265 VSLHRFEMGKYYPGTIQGQYDQAGEGKGEGFNCNITWPVGGVGDAEYM-WAFEQVVMPMG 323
           +S+H +E G ++PGT  G  + +  GK       +  P+    D  Y+     +++ P+ 
Sbjct: 269 ISVHLYEPG-FFPGT--GSLNDSQNGKNI-----VNIPLKHGCDDNYLNLVASKIIHPLI 320

Query: 324 REFKPDLVIISSGFDAADGDTIGQCHVTPSCYGH-MTHMLKSLARGNLCVVLEGGYNLDA 382
           +   P+++I+  G D   GD   +  +T       + +++KS  + ++ ++  GGYN   
Sbjct: 321 KRHDPEVIIMECGGDGLQGDRFNEWQLTIRGLSRTIVNIMKSYPQAHIFLLGGGGYNDLL 380

Query: 383 IAR 385
           ++R
Sbjct: 381 MSR 383

>TDEL0C05040 Chr3 complement(901798..903162) [1365 bp, 454 aa] {ON}
           Anc_3.362 YPR068C
          Length = 454

 Score = 78.2 bits (191), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 54/209 (25%), Positives = 105/209 (50%), Gaps = 14/209 (6%)

Query: 179 GGAIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNILKNYPESVR 237
           G  +     V++G  + S+ +    G HHA  Q A GFC  +++ +  + + +   +  +
Sbjct: 181 GATLMLADKVIKG--ERSIGINWDGGRHHAFKQKASGFCYVNDIVLLIQKLRR---KGFQ 235

Query: 238 RIMILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQAGEGKGEGFNC 297
           +I  +D+D+HHG+G +K+F     V  +SLH FE+G ++PGT  G   ++ + +      
Sbjct: 236 KISYIDFDLHHGDGVEKAFQFSSNVQTISLHLFEVG-FFPGT--GNLSESDKRRNV---V 289

Query: 298 NITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGH 357
           NI   + G+ D       EQ+V P+    +PD+++I  G D   GD   +  ++      
Sbjct: 290 NIPL-LHGLDDTSLEQLIEQIVKPVIERHEPDVLVIQCGGDGLMGDGFNEWQLSIRGLAK 348

Query: 358 -MTHMLKSLARGNLCVVLEGGYNLDAIAR 385
            +T ++ +     + ++  GGYN+  ++R
Sbjct: 349 CITELINNTKDCPVILLGGGGYNVTLMSR 377

>KLTH0F10582g Chr6 (910298..911722) [1425 bp, 474 aa] {ON} similar
           to uniprot|Q12214 Saccharomyces cerevisiae YPR068C
          Length = 474

 Score = 78.2 bits (191), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 60/228 (26%), Positives = 111/228 (48%), Gaps = 19/228 (8%)

Query: 166 FNNDSYASARLP--CGGAIEACKAVVEG---RVKNSLAVVRPPG-HHAEPQAAGGFCLFS 219
            ++D Y  A LP  C     A  ++V     R + ++++    G HHA    A GFC  +
Sbjct: 176 LSHDCYLFAYLPLYCQVIAGATLSLVRAACLRHERAISINWDGGRHHASRSRASGFCYIN 235

Query: 220 NVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGT 279
           ++A+  + + +     +RRI  +D+D+HH +G +++F     V  +S+H  E G ++PGT
Sbjct: 236 DIALLIQKLRR---RGIRRISYIDFDLHHCDGVERAFQHSQSVQTISVHLHEPG-FFPGT 291

Query: 280 IQGQYDQAGEGKGEGFNCNITWPVG-GVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFD 338
             G   +A  GK       +  PV  G+ D       ++V+MP  R   P++++I  G D
Sbjct: 292 --GSLKEASVGKNV-----VNIPVQHGMDDTFLNQIVQRVIMPCIRSHNPEVLVIQCGGD 344

Query: 339 AADGDTIGQCHVT-PSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIAR 385
              GD   +  +T      ++ ++++     N+ ++  GGYN   ++R
Sbjct: 345 GLMGDKYKEWQLTIKGLVNNIMYIVRGFPATNVVMLGGGGYNERLMSR 392

>NCAS0A11180 Chr1 complement(2216701..2218173) [1473 bp, 490 aa]
           {ON} Anc_3.362 YPR068C
          Length = 490

 Score = 77.0 bits (188), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 54/209 (25%), Positives = 102/209 (48%), Gaps = 14/209 (6%)

Query: 180 GAIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRR 238
           GA  +    ++   + S+A+    G HHA    A GFC  +++ +  + I KN     + 
Sbjct: 189 GATLSLSKFLQPNSERSIAINWDGGRHHAFKNKASGFCYVNDIVLLIQKIRKN---GFKN 245

Query: 239 IMILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQAGEGKGEGFNCN 298
           I  +D+D+HHG+G QK+F     V  VSLH FE G ++P T   Q  +AG       +  
Sbjct: 246 ISYVDFDLHHGDGVQKAFQFSKNVQTVSLHMFEPG-FFPCTGSLQEAKAG-------SSI 297

Query: 299 ITWPVGGVGDAEYMWAFEQ-VVMPMGREFKPDLVIISSGFDAADGDTIGQCHVT-PSCYG 356
           +  P+    D  ++    + +++P+  + +P++++I  G D   GD   +  +T     G
Sbjct: 298 VNIPLLHGLDGTFLKQLTKDIIIPVVEQHEPEVLVIQCGGDGLIGDQYNEWQLTIHDLSG 357

Query: 357 HMTHMLKSLARGNLCVVLEGGYNLDAIAR 385
            +  ++ +    ++ ++  GGYN   ++R
Sbjct: 358 AIMKLINTFPSCSVVLLGGGGYNEKVMSR 386

>Kwal_23.3724 s23 (406773..408194) [1422 bp, 473 aa] {ON} YPR068C
           (HOS1) - Similar to Hda1p, Rpd3p, Hos2p, and Hos3p
           [contig 254] FULL
          Length = 473

 Score = 76.3 bits (186), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 59/228 (25%), Positives = 104/228 (45%), Gaps = 19/228 (8%)

Query: 166 FNNDSYASARLP-----CGGAIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFS 219
            ++D +  A LP       GA          R + +++V    G HHA    A GFC  +
Sbjct: 179 LSHDCHPFAYLPMYCQVVTGATIKLARYASSRQQRTISVNWDGGRHHAFKSKASGFCYVN 238

Query: 220 NVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGT 279
           ++A+  + + +     + +I  LD+D+HHG+G +++F     V  +S+H +E G ++PGT
Sbjct: 239 DIAILIQKLRR---RGIHKISYLDFDLHHGDGVERAFQHSANVQTISIHMYEEG-FFPGT 294

Query: 280 IQGQYDQAGEGKGEGFNCNITWPV-GGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFD 338
             G    A  G+       +  PV  G+ D        +VV+P      P++VII  G D
Sbjct: 295 --GTLKDASSGRNI-----VNIPVLHGMDDTFLNEVVNRVVIPCLHNHNPEVVIIQCGGD 347

Query: 339 AADGDTIGQCHVT-PSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIAR 385
              GD   +  +T       +  +++     N+ ++  GGYN   ++R
Sbjct: 348 GLIGDKYKEWQLTLKGLTDTIMKVVEDFPSSNIVLLGGGGYNEKLMSR 395

>CAGL0D01430g Chr4 (158990..160327) [1338 bp, 445 aa] {ON} similar
           to uniprot|Q12214 Saccharomyces cerevisiae YPR068c HOS1
          Length = 445

 Score = 75.9 bits (185), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 73/278 (26%), Positives = 132/278 (47%), Gaps = 33/278 (11%)

Query: 127 TSEEILEVHTKEHLEFIESTEKMSR-EQLLKETEKGDSVY-------FN--NDSYASARL 176
           T  E+L  + ++H+E  E  +K +  E  L + E GD V        FN  +D      L
Sbjct: 110 TYSELLHYY-RDHIEVSEHNKKRTALEAELSDVESGDEVTRRSTLAKFNLLDDCPIFPYL 168

Query: 177 P------CGGAIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNIL 229
           P       G  +   + ++EG  + ++A+    G HH+    A GFC  +++A+    + 
Sbjct: 169 PLYCYVSTGATLSLAQYILEGS-ERTIAINWDGGRHHSMKTKASGFCYINDIALLIMTLR 227

Query: 230 KNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQAGE 289
           +     V RI  +D+D+HHG+G +K+F    QV  +SLH +E G ++P +  G  +    
Sbjct: 228 RG---GVDRISYVDFDLHHGDGVEKAFKYSKQVQTISLHMYETG-FFPCS--GSLEDNSS 281

Query: 290 GKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCH 349
           GK      NI   + G+ D+      +++++P   + +P++++I  G D   GD   +  
Sbjct: 282 GKS---IVNIPL-LHGLDDSTLQDIAKRIIVPSISKHQPNVIVIQCGGDGLKGDKYSEWQ 337

Query: 350 VTPSCYGHMTHMLKSLARGNLCVVL--EGGYNLDAIAR 385
           +  S  G  + +   + + N  +VL   GGYN   ++R
Sbjct: 338 L--SIKGLTSTITSLIEQFNCHIVLLGGGGYNNLLMSR 373

>YPR068C Chr16 complement(682941..684353) [1413 bp, 470 aa] {ON}
           HOS1Class I histone deacetylase (HDAC) family member
           that deacetylates Smc3p on lysine residues at anaphase
           onset; has sequence similarity to Hda1p, Rpd3p, Hos2p,
           and Hos3p; interacts with the Tup1p-Ssn6p corepressor
           complex
          Length = 470

 Score = 75.5 bits (184), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 50/183 (27%), Positives = 92/183 (50%), Gaps = 13/183 (7%)

Query: 205 HHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLY 264
           HHA  Q A GFC  ++V +  + + K     + +I  +D+D+HHG+G +K+F    Q+  
Sbjct: 210 HHAFKQRASGFCYINDVVLLIQRLRK---AKLNKITYVDFDLHHGDGVEKAFQYSKQIQT 266

Query: 265 VSLHRFEMGKYYPGTIQGQYDQAGEGKGEGFNCNITWPVGGVGDAEYMWAF-EQVVMPMG 323
           +S+H +E G ++PGT  G    + + K       +  P+    D  Y+     ++V P+ 
Sbjct: 267 ISVHLYEPG-FFPGT--GSLSDSRKDKNV-----VNIPLKHGCDDNYLELIASKIVNPLI 318

Query: 324 REFKPDLVIISSGFDAADGDTIGQCHVTPSCYGH-MTHMLKSLARGNLCVVLEGGYNLDA 382
              +P+ +II  G D   GD   +  +T       + +++KS  R ++ ++  GGYN   
Sbjct: 319 ERHEPEALIIECGGDGLLGDRFNEWQLTIRGLSRIIINIMKSYPRAHIFLLGGGGYNDLL 378

Query: 383 IAR 385
           ++R
Sbjct: 379 MSR 381

>Smik_16.309 Chr16 complement(559713..561125) [1413 bp, 470 aa] {ON}
           YPR068C (REAL)
          Length = 470

 Score = 74.7 bits (182), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 50/183 (27%), Positives = 93/183 (50%), Gaps = 13/183 (7%)

Query: 205 HHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLY 264
           HHA  Q A GFC  ++V +  + + K     + +I  LD+D+HHG+G +K+F    Q+  
Sbjct: 210 HHAFKQRASGFCYINDVVLLIQRLRK---IKLNKITYLDFDLHHGDGVEKAFQYSKQIQT 266

Query: 265 VSLHRFEMGKYYPGTIQGQYDQAGEGKGEGFNCNITWPVG-GVGDAEYMWAFEQVVMPMG 323
           +S+H +E G ++PGT  G  D +  GK       +  P+  G  D+       +++ P+ 
Sbjct: 267 ISVHIYEPG-FFPGT--GSLDDSRGGKNV-----VNIPLKHGCDDSYLNLIASKIINPLI 318

Query: 324 REFKPDLVIISSGFDAADGDTIGQCHVTPSCYGH-MTHMLKSLARGNLCVVLEGGYNLDA 382
            +  P+++II  G D   GD   +  +T       + + +K  ++ ++ ++  GGYN   
Sbjct: 319 DKHDPEVLIIECGGDGLLGDRFNEWQLTVRGLSETIINFIKRYSQAHIFLLGGGGYNDLL 378

Query: 383 IAR 385
           ++R
Sbjct: 379 MSR 381

>SAKL0B07854g Chr2 complement(669743..671212) [1470 bp, 489 aa] {ON}
           similar to uniprot|Q12214 Saccharomyces cerevisiae
           YPR068C
          Length = 489

 Score = 74.3 bits (181), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 51/183 (27%), Positives = 88/183 (48%), Gaps = 14/183 (7%)

Query: 205 HHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLY 264
           HH+    A GFC  +++ +A + + +N+      I  +D+D+HHG+G +++F     V  
Sbjct: 242 HHSFKSRASGFCYINDIVLAIQRLRRNFSN----ISYVDFDLHHGDGVERAFQYSKNVQT 297

Query: 265 VSLHRFEMGKYYPGTIQGQYDQAGEGKGEGFNCNITWPV-GGVGDAEYMWAFEQVVMPMG 323
           +SLH  E G ++PGT   +  Q G          I  P+  G  D   M   E VV+P  
Sbjct: 298 ISLHNHEPG-FFPGTGSMESSQDGHSI-------INIPLRHGADDDCLMKITESVVIPCI 349

Query: 324 REFKPDLVIISSGFDAADGDTIGQCHVT-PSCYGHMTHMLKSLARGNLCVVLEGGYNLDA 382
           ++  P +++I  G D   GD   +  +T       +  +L SL   ++ ++  GGYN   
Sbjct: 350 QKHGPQVIVIQCGGDGLIGDKYEEWQLTIRGLTSSILKILSSLPDTHIILLGGGGYNDRV 409

Query: 383 IAR 385
           ++R
Sbjct: 410 MSR 412

>KAFR0H00890 Chr8 (167453..168877) [1425 bp, 474 aa] {ON} Anc_3.362
           YPR068C
          Length = 474

 Score = 72.4 bits (176), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 52/216 (24%), Positives = 99/216 (45%), Gaps = 19/216 (8%)

Query: 175 RLPCGGAIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNILKNYP 233
           ++  G  +   K +V      ++ +    G HHA  + A GFC  +++ +  + + KN  
Sbjct: 188 QVTTGATLSLSKFLVPNSKDRTICINWDGGRHHASKKKASGFCYINDIVLLIQRMRKN-- 245

Query: 234 ESVRRIMILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQAGEGKGE 293
              ++I  LD+D+HHG+G +K+F     +  +SLH FE G ++PGT        G    +
Sbjct: 246 -GFKKITYLDFDLHHGDGVEKAFQFSKSIQTISLHLFETG-FFPGT--------GGLSNK 295

Query: 294 GFNCNITWPVG-GVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTP 352
           G    I  P+  G+ D       +Q+++P       + +++  G D   GD   +  +T 
Sbjct: 296 GSRDLIDIPLSHGLTDDYLFELVKQIIIPAIDLHAAEAIVLQCGGDGLSGDKFNEWQLTI 355

Query: 353 SCYGHMTHMLKSLARGNLCVVL---EGGYNLDAIAR 385
              G    ++  + + + C ++    GGYN   ++R
Sbjct: 356 K--GLTQCIIDVIGKFSDCQIVLLGGGGYNELLVSR 389

>ZYRO0C16390g Chr3 complement(1274651..1275961) [1311 bp, 436 aa]
           {ON} similar to uniprot|Q12214 Saccharomyces cerevisiae
           YPR068C
          Length = 436

 Score = 72.0 bits (175), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 56/195 (28%), Positives = 94/195 (48%), Gaps = 17/195 (8%)

Query: 205 HHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLY 264
           HHA  + A GFC  +++ +    I K   +  +R+  +D+D+HHG+G +++F     V  
Sbjct: 195 HHAMKKRASGFCYVNDIVLL---IQKLRSKGFQRLSYIDFDLHHGDGVERAFQFSSNVQT 251

Query: 265 VSLHRFEMGKYYPGTIQGQYDQAGEGKGEGFNCNITWPVG-GVGDAEYMWAFEQVVMPMG 323
           +S+H FE G ++P +  G  +   +GK      NI  P+  G+ D        QVV+P+ 
Sbjct: 252 ISMHLFECG-FFPTS--GSLEDNKKGKNIA---NI--PLAHGLNDEYLNEIVTQVVIPLT 303

Query: 324 REFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVL---EGGYNL 380
               P ++II  G D   GD   +  +T    G   ++LK + R   C ++    GGYN 
Sbjct: 304 DRHSPQVIIIQCGGDGLMGDEYNEWQLTIK--GLCENILKIVNRYKNCSIVLLGGGGYNP 361

Query: 381 DAIARSALSVAKVLI 395
             ++R    +   LI
Sbjct: 362 TVMSRFYTYLTGKLI 376

>Ecym_8290 Chr8 complement(589795..591924) [2130 bp, 709 aa] {ON}
           similar to Ashbya gossypii ADL265W
          Length = 709

 Score = 71.6 bits (174), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 85/331 (25%), Positives = 133/331 (40%), Gaps = 76/331 (22%)

Query: 128 SEEILEVH----TKEHLEFIE-STEKMSREQL--LKETEKGDSVYFNNDSYASARLPCGG 180
           S  +L+VH     KE L     + EK+ R+Q+    E   GD +Y   ++  + R   G 
Sbjct: 105 SSHVLKVHGSDWPKELLRLCRGAKEKIGRKQVEVPDEWNVGD-IYLCEETVYALRGSIGA 163

Query: 181 AIEACKAVVEGRVKNSLA-----VVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPES 235
                 ++ +G V    A      +RPPGHH+      GFCL +N  +A +     Y   
Sbjct: 164 VEYGVDSIFKGEVNKDTANRAFVAIRPPGHHSHAATPSGFCLLNNAHIAVEYAADTY--G 221

Query: 236 VRRIMILDWDIHHGNGTQ-------------------------KSFYQDDQVLYVSLHRF 270
           V   +ILD+D+HHG+GTQ                         K F +  +V Y S+H  
Sbjct: 222 VTHAVILDFDLHHGDGTQDICWKRAGFKADDIQDAKGEYNEFDKKFAEFPKVGYFSMHDI 281

Query: 271 EMGKYYPGTI----QGQYDQAGEGKGEGFNCNITWPV-----------GGVGDAEYMWAF 315
                +P  +    + +   A     +  + NI W +             +    Y   F
Sbjct: 282 NS---FPTELNYASKDKVKDASTCIMDAHDVNI-WNIHLLPYETEEEFNKLYQTRYRTLF 337

Query: 316 EQ-------VVMPMGREFKP--DLVIISSGFDAADGDTIG-QCH---VTPSCYGHMTHML 362
            +         + M ++ KP   LV++S+GFDA++ + +  Q H   V  S Y   T   
Sbjct: 338 AKADEFFKAAKLSMAKDGKPFKGLVVMSAGFDASEYEQVSMQRHGVNVPTSFYSTFTKDA 397

Query: 363 KSLAR----GNLCVVLEGGYNLDAIARSALS 389
             LA+    G +  +LEGGY+  AIA    S
Sbjct: 398 LKLAQMHTNGKIISLLEGGYSDAAIASGVFS 428

>Kpol_376.15 s376 complement(25558..27114) [1557 bp, 518 aa] {ON}
           complement(25558..27114) [1557 nt, 519 aa]
          Length = 518

 Score = 69.7 bits (169), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 43/183 (23%), Positives = 91/183 (49%), Gaps = 13/183 (7%)

Query: 205 HHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLY 264
           HHA    A GFC  +++ +  + + K   + + ++  +D+D+HHG+G +K+F     +  
Sbjct: 223 HHAIKNKASGFCYINDIVILIQKLRK---KGISKVSYIDFDLHHGDGVEKAFRYSSNIQT 279

Query: 265 VSLHRFEMGKYYPGTIQGQYDQAGEGKGEGFNCNITWPV-GGVGDAEYMWAFEQVVMPMG 323
           +S+H +E G ++P T  G  +    GK       +  P+  GV D        +++ P+ 
Sbjct: 280 ISMHMYEPG-FFPCT--GSLEDTLNGKN-----IVNVPLYHGVDDNYMTEIVNELIKPLI 331

Query: 324 REFKPDLVIISSGFDAADGDTIGQCHVTPS-CYGHMTHMLKSLARGNLCVVLEGGYNLDA 382
               P++++I  G D   GD   +  +T S    ++ ++++   + ++ ++  GGYN   
Sbjct: 332 ERHSPEVLVIQCGGDGLIGDKFEEWQLTISGLTRNIQNLIEWFPKSDIILLGGGGYNELV 391

Query: 383 IAR 385
           ++R
Sbjct: 392 MSR 394

>SAKL0H08338g Chr8 (716414..718486) [2073 bp, 690 aa] {ON} similar
           to uniprot|Q02959 Saccharomyces cerevisiae YPL116W HOS3
           Trichostatin A-insensitive homodimeric histone
           deacetylase (HDAC)
          Length = 690

 Score = 70.1 bits (170), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 85/332 (25%), Positives = 141/332 (42%), Gaps = 79/332 (23%)

Query: 128 SEEILEVH----TKEHLEFI-ESTEKMSREQL--LKETEKGDSVYFNNDSYASARLPCGG 180
           S  +L+VH     KE L+   +S+EK++ +Q+    +   GD +Y +  + A+     G 
Sbjct: 106 SPHVLKVHGTDWPKELLQLCKQSSEKLAHKQVEVPDDWNVGD-IYLSQQTIAALEGSIGA 164

Query: 181 AIEACKAVVEGRVKNSLA-----VVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPES 235
                 ++ +G  +  +A      VRPPGHH+      GFCL +N  +A +     +  +
Sbjct: 165 LETGIDSIFQGSSQEDIANRAFVAVRPPGHHSHTATPSGFCLLNNAHIAIEYAADTF--N 222

Query: 236 VRRIMILDWDIHHGNGTQ------------------------KSFYQDDQVLYVSLHRF- 270
           V   ++LD+D+HHG+GTQ                        K F +  +V Y S+H   
Sbjct: 223 VTHAVVLDFDLHHGDGTQDICWKRAGFNPDEQDDDPAYDEFGKKFAEFPKVGYFSMHDIN 282

Query: 271 ----EMGKYYPGTIQGQYDQAGEGKGEGFNCNITWPVG-----------GVGDAEYMWAF 315
               E+G      I+     A        + NI W V             +  ++Y   F
Sbjct: 283 SFPTELGYATKENIKN----ASTCIMNAHDLNI-WNVHLSHYETEEDFVKLYQSKYRSLF 337

Query: 316 EQV----------VMPMGREFKPDLVIISSGFDAADGDTIG-QCH--VTPSCYGHM-THM 361
            +           +   G++FK  LV+IS+GFDA++ +    Q H    P+C+ +M T  
Sbjct: 338 AKADEFFKNAKKEMASQGKKFK-GLVVISAGFDASEYEQPSMQRHGVNVPTCFYNMFTKD 396

Query: 362 LKSLAR----GNLCVVLEGGYNLDAIARSALS 389
              LA+    G +  V+EGGY+  AI+    S
Sbjct: 397 ALKLAQMHTSGKVLSVMEGGYSDGAISSGVFS 428

>ADL339W Chr4 (110772..112085) [1314 bp, 437 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR068C (HOS1)
          Length = 437

 Score = 68.9 bits (167), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 58/206 (28%), Positives = 96/206 (46%), Gaps = 19/206 (9%)

Query: 179 GGAIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNILKNYPESVR 237
            GA  A    +     ++LAV    G HHA    A GFC  +++A+  + + +   +   
Sbjct: 166 AGATLALAKELSRHRGSALAVNWDGGRHHALKARASGFCYVNDIALLIQTLRR---QGFL 222

Query: 238 RIMILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQAGEGKGEGFNC 297
           R+  +D+D+HHG+G + +F     V   SLH FE G ++PGT        G  K    N 
Sbjct: 223 RVSYVDFDLHHGDGVENAFRYSKNVQTCSLHLFEPG-FFPGT--------GACKNCTDNS 273

Query: 298 NITWP-VGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYG 356
            +  P + GV D+      + +V P  +   P+++II  G D   GD  G+  +  S +G
Sbjct: 274 VLNVPLLHGVDDSTLDHVVDHIVTPAVQRHDPEVLIIQCGGDGLSGDKYGEWQL--SIHG 331

Query: 357 HMTHMLKSLAR---GNLCVVLEGGYN 379
              ++LK +       + ++  GGYN
Sbjct: 332 LTRNILKLVQAHKFKKIALLGGGGYN 357

>KNAG0H00630 Chr8 (105506..106876) [1371 bp, 456 aa] {ON} Anc_3.362
           YPR068C
          Length = 456

 Score = 68.2 bits (165), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 47/188 (25%), Positives = 95/188 (50%), Gaps = 24/188 (12%)

Query: 205 HHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLY 264
           HHA    A GFC  +++ +  + + K   +   ++  LD+D+HHG+G +++F    +V  
Sbjct: 206 HHASKGKASGFCYVNDIVLLIQKLRK---QGTGKVTYLDFDLHHGDGVERAFKFTKKVQT 262

Query: 265 VSLHRFEMGKYYP--GTIQGQYDQAGEGKGEGFNCNITWPVG-GVGDAEYMWAFEQVVMP 321
           +SLH +E G ++P  G+++G           GF+  +  P+  G+ D+      +QVV P
Sbjct: 263 ISLHLYEPG-FFPCTGSLEGS---------SGFD-TVNLPLQHGLTDSFLQGLVDQVVNP 311

Query: 322 MGREFKPDLVIISSGFDAADGDTIGQCHVT----PSCYGHMTHMLKSLARGNLCVVLEGG 377
           + +   P++++I  G D   GDT  +  ++      C   +  ++    + ++ ++  GG
Sbjct: 312 LIQRHGPEVIVIQCGGDGLLGDTFHEWQLSIRGLTKC---ILDVMSHSTQAHVILLGGGG 368

Query: 378 YNLDAIAR 385
           YN   ++R
Sbjct: 369 YNPTLMSR 376

>KLLA0B09394g Chr2 (822629..823954) [1326 bp, 441 aa] {ON} similar
           to uniprot|Q12214 Saccharomyces cerevisiae YPR068C HOS1
           Putative class I histone deacetylase (HDAC) with
           sequence similarity to Hda1p, Rpd3p, Hos2p, and Hos3p;
           deletion results in increased histone acetylation at
           rDNA repeats; interacts with the Tup1p-Ssn6p complex
          Length = 441

 Score = 68.2 bits (165), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 45/183 (24%), Positives = 86/183 (46%), Gaps = 13/183 (7%)

Query: 205 HHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLY 264
           HHA    A GFC  +++ +  +++ +   +  +R+  +D+D+H+G+G  K+F   + V  
Sbjct: 193 HHALKHYASGFCYVNDIVLLIQSLRR---KGWKRVTYIDFDLHYGDGVAKAFRFSENVQT 249

Query: 265 VSLHRFEMGKYYPGTIQGQYDQAGEGKGEGFNCNITWPV-GGVGDAEYMWAFEQVVMPMG 323
           +S+H +E G ++PGT  G  ++    K       +  PV  G+ D   +     V+ P+ 
Sbjct: 250 ISVHLYEPG-FFPGT--GSLEETRNSKQM-----VNLPVLHGMDDKYLLELISSVITPLI 301

Query: 324 REFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVL-EGGYNLDA 382
             F  + ++I  G D   GD   +  ++     H    +  + R     +L  GGYN   
Sbjct: 302 ETFNAECIVIQCGSDGLSGDKYNEWQLSIRGLTHAIISIMDMFRDKQVFLLGGGGYNELL 361

Query: 383 IAR 385
           ++R
Sbjct: 362 VSR 364

>TDEL0A05520 Chr1 complement(970572..972596) [2025 bp, 674 aa] {ON}
           Anc_8.607 YPL116W
          Length = 674

 Score = 67.0 bits (162), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 83/328 (25%), Positives = 132/328 (40%), Gaps = 70/328 (21%)

Query: 128 SEEILEVHTKEHLEFIESTEKMSREQLLK-ETEKGDS-----VYFNNDSYASARLPCGGA 181
           S  +L+VH ++    +    K + E+L K E E  DS     +Y ++ +  + +   G  
Sbjct: 105 SPHVLKVHGRDWPPTLLRLCKHADEKLAKGEIEVPDSWNSGDIYLSSKTIEALQGSIGAL 164

Query: 182 IEACKAVVEG----RVKN-SLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESV 236
                ++ EG     V N +  V+RPPGHH       GFCL +N  V+ +     Y   +
Sbjct: 165 ETGVDSIFEGPSPEHVSNRAFVVIRPPGHHCRAGTPSGFCLLNNAHVSIEYAHDTY--GI 222

Query: 237 RRIMILDWDIHHGNGTQ-------------------------KSFYQDDQVLYVSLHRFE 271
              ++LD+D+HHG+GTQ                         K F +  +V Y S+H   
Sbjct: 223 THAVVLDFDLHHGDGTQDICWKRAGFRPDEQDENTGGYDEFGKKFAEFPRVGYFSMHDIN 282

Query: 272 MGKYYPG-TIQGQYDQAGEGKGEGFNCNITWPV-----------GGVGDAEYMWAFEQV- 318
                 G   +     A      G + NI W V             +  ++Y   F +  
Sbjct: 283 SFPTESGYATKDNIKSASTCIMNGHDLNI-WNVHLSAWETEEDFNKLYQSKYRTLFAKAD 341

Query: 319 ---------VMPMGREFKPDLVIISSGFDAADGDTIG-QCH---VTPSCYGHMTHMLKSL 365
                    +   G++FK  LV+IS+GFDA++ + +  Q H   V  + Y   T     L
Sbjct: 342 EFFKNAKIEMSAKGKKFK-GLVVISAGFDASEFEQVSMQRHGVNVPTNFYTMFTKDALKL 400

Query: 366 AR----GNLCVVLEGGYNLDAIARSALS 389
           A+    G +  VLEGGY+  AI     +
Sbjct: 401 AQMHSEGKVLSVLEGGYSDKAITSGVFA 428

>ADL265W Chr4 (237911..239995) [2085 bp, 694 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL116W (HOS3)
          Length = 694

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 66/249 (26%), Positives = 100/249 (40%), Gaps = 59/249 (23%)

Query: 196 SLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQ-- 253
           +   +RPPGHH+      GFCL +N  +A +     Y   V    ILD+D+HHG+GTQ  
Sbjct: 184 AFVALRPPGHHSHTSTPSGFCLLNNAHIAVEYAASRY--GVTHAAILDFDLHHGDGTQDI 241

Query: 254 -----------------------KSFYQDDQVLYVSLHRF-----EMGKYYPGTIQGQ-- 283
                                  K F +  +V Y SLH       E G  +  +I+    
Sbjct: 242 CWKRAGFKPDDEEDNAAEYDDFGKRFAEFPKVGYFSLHDINSFPTEQGYAHKTSIKDASV 301

Query: 284 -------------YDQAGEGKGEGFN--CNITWPVGGVGDAEYMWAFEQVVMPMGREFKP 328
                        +  A E + E FN      +        E++   ++ +   G+ +K 
Sbjct: 302 CIMDSHDVNIWNIHLTAYETE-EEFNKLYQTKYRAIFAKADEFLRVSQKRMASEGKNYK- 359

Query: 329 DLVIISSGFDAADGDTIGQ----CHVTPSCYGHMTHMLKSLA----RGNLCVVLEGGYNL 380
            L+IIS+GFDA++ + +       HV  S Y   T     LA    +G L  +LEGGY+ 
Sbjct: 360 GLIIISAGFDASEHEQLSMQRHGVHVPTSFYCAFTKDALKLAQMHTQGKLLSLLEGGYSD 419

Query: 381 DAIARSALS 389
            A+     S
Sbjct: 420 AALVSGVFS 428

>Ecym_3465 Chr3 (874618..875955) [1338 bp, 445 aa] {ON} similar to
           Ashbya gossypii ADL339W
          Length = 445

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 57/234 (24%), Positives = 98/234 (41%), Gaps = 28/234 (11%)

Query: 205 HHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLY 264
           HHA    A GFC  +++ +  + + KN      R+  +D+D+HHG+  + +F     V  
Sbjct: 195 HHAFKSRASGFCYINDIVLLIQELRKN---GYSRVSYVDFDLHHGDAVESAFQYSRNVQT 251

Query: 265 VSLHRFEMGKYYPGTIQGQYDQAGEGKGEGFNCNITWPVG-----GVGDAEYMWAFEQVV 319
            SLH FE G ++PGT            G   NC  T  V      G+ D       + ++
Sbjct: 252 CSLHLFEAG-FFPGT------------GSFKNCRETNVVNIPLFHGLDDESLDEIVDNIL 298

Query: 320 MPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSL---ARGNLCVVLEG 376
           +P   +  P++++I  G D   GD   +  +T   +G   ++LK +   +   + ++  G
Sbjct: 299 IPCVNKHDPEVLVIQCGADGLSGDKYKEWQLT--IHGLTRNILKLVDIHSYKKVVLLGGG 356

Query: 377 GYNLDAIARSALSVAKVLIGXXXXXXXXXXXXXXXXVIE--MIDKVIRLQSKYW 428
           GYN    +R    V   L+                 +IE  +ID   +   K+W
Sbjct: 357 GYNPTLQSRFYTYVTVCLLKYHKGIPSLISDSEDEHIIEHHLIDFYRKEAYKFW 410

>KLLA0F00858g Chr6 complement(78519..80666) [2148 bp, 715 aa] {ON}
           similar to uniprot|Q02959 Saccharomyces cerevisiae
           YPL116W HOS3 Trichostatin A-insensitive homodimeric
           histone deacetylase (HDAC)
          Length = 715

 Score = 65.9 bits (159), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 69/262 (26%), Positives = 101/262 (38%), Gaps = 63/262 (24%)

Query: 189 VEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHH 248
           VE     +   +RPPGHH+      GFCL +N  +A +   + Y   V   +ILD+D+HH
Sbjct: 176 VEQTANRAFIAIRPPGHHSHASTPSGFCLLNNAHIAIEYAFEKY--DVTHAVILDFDLHH 233

Query: 249 GNGTQ---------------------------------KSFYQDDQVLYVSLHRF----- 270
           G+GTQ                                 KSF +  +V Y SLH       
Sbjct: 234 GDGTQDICWKRAGFRPDEFSTDAEHGASEDDNKYDEFGKSFAEFPKVGYFSLHDINSFPT 293

Query: 271 EMGKYYPGTIQGQ---------------YDQAGEGKGEGFNCNITWPVGGVGDAEYMWAF 315
           E+G      I+                 + Q+ + + E      T        A+  +  
Sbjct: 294 ELGYATKENIRNASTCIMDAHDINIWNVHLQSYKDEEEFVKLYQTKYRSIFAKADEFFKN 353

Query: 316 EQVVMPMGREFKPDLVIISSGFDAADGDTIG-QCH---VTPSCYGHMTHMLKSLAR---- 367
            ++ M  G      LV+IS+GFDA++ +    Q H   V  S Y   T     LA+    
Sbjct: 354 AKLEMKQGGFRFKGLVVISAGFDASEYEQQSMQRHNVNVPTSFYNLFTKDALKLAQMHSN 413

Query: 368 GNLCVVLEGGYNLDAIARSALS 389
           G +  V+EGGY+  AIA    S
Sbjct: 414 GKIISVMEGGYSDGAIASGVFS 435

>TPHA0A01120 Chr1 (216522..218618) [2097 bp, 698 aa] {ON} Anc_8.607
           YPL116W
          Length = 698

 Score = 65.5 bits (158), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 70/252 (27%), Positives = 98/252 (38%), Gaps = 61/252 (24%)

Query: 196 SLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQ-- 253
           +   +RPPGHH       GFCL +N  +A +   + Y   V   +ILD+D+HHG+GTQ  
Sbjct: 186 AFVAIRPPGHHCHVSTPSGFCLLNNAQIAIEYAYEKY--GVSHAVILDFDLHHGDGTQDI 243

Query: 254 ----KSFYQDD-----------------------QVLYVSLHRFEMGKYYPG-TIQGQYD 285
                 F  DD                       +V Y S+H         G   +    
Sbjct: 244 CWKRAGFKPDDGNVQDDEDKNEYDDFGKKMADFPKVGYFSMHDINSFPTESGYATKDNIK 303

Query: 286 QAGEGKGEGFNCNI------TWPV----GGVGDAEYMWAFEQV----------VMPMGRE 325
            A     +  + NI      TW        +   +Y   F +           +  M + 
Sbjct: 304 NASTCVMDAHDLNIWNVHLQTWATEEDFNKLYQTKYRTLFAKADEFFKNAKNQMQEMNKP 363

Query: 326 FKPDLVIISSGFDAADGD-TIGQCH---VTPSCYGHMTHMLKSLAR----GNLCVVLEGG 377
           FK  LV+IS+GFDA++ + T  Q H   V  S Y   T     LA+    G +  VLEGG
Sbjct: 364 FK-GLVVISAGFDASEFEQTSMQRHSVNVPTSFYTTFTKDALKLAQLHCNGKVLSVLEGG 422

Query: 378 YNLDAIARSALS 389
           Y+  AIA    S
Sbjct: 423 YSDKAIASGVFS 434

>KLTH0D09592g Chr4 complement(792708..794825) [2118 bp, 705 aa] {ON}
           similar to uniprot|Q02959 Saccharomyces cerevisiae
           YPL116W HOS3 Trichostatin A-insensitive homodimeric
           histone deacetylase (HDAC)
          Length = 705

 Score = 65.1 bits (157), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 71/256 (27%), Positives = 101/256 (39%), Gaps = 69/256 (26%)

Query: 189 VEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHH 248
           VE     +   +RPPGHH+      GFCL +N  +A +     Y   V   ++LD+D+HH
Sbjct: 178 VEQTSNRAFVALRPPGHHSHASTPSGFCLLNNAHIAIEYAADTY--GVTHAVVLDFDLHH 235

Query: 249 GNGTQ-------------------------KSFYQDDQVLYVSLHRF-----EMGKYYPG 278
           G+GTQ                         K F +  +V Y SLH       E+G     
Sbjct: 236 GDGTQDICWKRAGFKPDGCDDGGSEYNEFGKKFAEFPKVGYFSLHDINSFPTELGYATKE 295

Query: 279 TIQGQYDQAGEGKGEGFNCNITWPVG----------------------GVGDAEYMWAFE 316
            ++     A     +  + NI W V                          D EY    +
Sbjct: 296 NVRN----AATCIMDAHDVNI-WNVHLQSYDSDEAFTKLYQTKYRTLFAKAD-EYFRTAK 349

Query: 317 QVVMPMGREFKPDLVIISSGFDAADGDTIG-QCH---VTPSCYGHMTHMLKSLAR----G 368
           Q +  +G+ FK  LV+IS+GFDA++ +    Q H   V    Y   T     LA+    G
Sbjct: 350 QNMRALGKPFK-GLVVISAGFDASEYEQPSMQRHAVNVPTFFYNLFTKDALKLAQMHSHG 408

Query: 369 NLCVVLEGGYNLDAIA 384
            L  VLEGGY+  AI+
Sbjct: 409 KLLSVLEGGYSDGAIS 424

>TBLA0E04080 Chr5 complement(1026669..1028753) [2085 bp, 694 aa]
           {ON} Anc_8.607 YPL116W
          Length = 694

 Score = 62.0 bits (149), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 64/243 (26%), Positives = 98/243 (40%), Gaps = 57/243 (23%)

Query: 196 SLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQ-- 253
           +   +RPPGHH +     GFCL +N  ++ +    +Y   +   +ILD+D+HHG+GTQ  
Sbjct: 187 AFVAIRPPGHHCKVATPSGFCLLNNAHISIEYAADHY--GITHAVILDFDLHHGDGTQDI 244

Query: 254 -----------------------KSFYQDDQVLYVSLHRFEMGKYYPG-TIQGQYDQAGE 289
                                  K F +  +V Y S+H         G   +     A  
Sbjct: 245 CWKRAGFRSEDEPEGSEGYDDFGKKFAEFPKVGYFSMHDINSFPTETGYATKVNIRNAST 304

Query: 290 GKGEGFNCNITW-----PVGGVGDAEYMWA-------------FEQVVMPMGREFKP--D 329
              +G + NI W     P     D + ++              F      M +E KP   
Sbjct: 305 CIMDGHDLNI-WNIHLSPWNTEEDFQKLYQSKYRTLFAKADDYFRNAKYQMAQEGKPFKG 363

Query: 330 LVIISSGFDAADGD-TIGQCH---VTPSCYGHMTHMLKSLA----RGNLCVVLEGGYNLD 381
           LV+IS+GFDA++ + T  Q H   V  + Y   T     LA    +G +  +LEGGY+  
Sbjct: 364 LVVISAGFDASEYEQTSMQRHNVNVPTNFYTMFTKDALKLAQIHCQGKVLSLLEGGYSDK 423

Query: 382 AIA 384
           A+ 
Sbjct: 424 ALT 426

>Smik_6.315 Chr6 complement(492590..494683) [2094 bp, 697 aa] {ON}
           YPL116W (REAL)
          Length = 697

 Score = 62.0 bits (149), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 84/318 (26%), Positives = 130/318 (40%), Gaps = 69/318 (21%)

Query: 131 ILEVHTKE-HLEFIESTEKMSREQLLK-ETEKGDS-----VYFNNDSYASARLPCGGAIE 183
           +L+VH      E IE  + M+  +LLK E E  D+     +Y ++ +  + +   G    
Sbjct: 110 VLKVHGSHWPAELIELCQ-MADAKLLKGEIEVPDTWNSGDIYLSSKTIKALQGTIGAIET 168

Query: 184 ACKAVVEG----RVKN-SLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRR 238
              ++ EG     + N +   +RPPGHH       GFCL +N  VA +     Y  +V  
Sbjct: 169 GVDSIFEGPSAEHISNRAFVAIRPPGHHCHYATPSGFCLLNNAHVAIEYAYDTY--NVTH 226

Query: 239 IMILDWDIHHGNGTQ------------------------KSFYQDDQVLYVSLHRFEMGK 274
           +++LD+D+HHG+GTQ                        K F +  +V Y S+H      
Sbjct: 227 VVVLDFDLHHGDGTQDICWKRAGFKPEEEPENSSYDEFDKKFAEFPKVGYFSMHDINSFP 286

Query: 275 YYPG-TIQGQYDQAGEGKGEGFNCNITWPV---GGVGDAEY----------MWA-----F 315
              G   +     A        + NI W V       + E+          ++A     F
Sbjct: 287 TESGFATKENIKNASTCIMNSHDLNI-WNVHLSKWTTEEEFNILYRTKYRTLFAKADEFF 345

Query: 316 EQVVMPMGREFKP--DLVIISSGFDAADGD-TIGQCH---VTPSCYGHMTHMLKSLAR-- 367
                 M +  KP   LV+IS+GFDA++ + T  Q H   V  S Y   T     LA+  
Sbjct: 346 RSAKQEMNQNEKPFKGLVVISAGFDASEFEQTSMQRHSVNVPTSFYTTFTKDALKLAQMH 405

Query: 368 --GNLCVVLEGGYNLDAI 383
             G +  ++EGGY+  AI
Sbjct: 406 CHGKVLSLMEGGYSDKAI 423

>CAGL0J06974g Chr10 (667811..669847) [2037 bp, 678 aa] {ON} highly
           similar to uniprot|Q02959 Saccharomyces cerevisiae
           YPL116w HOS3
          Length = 678

 Score = 61.6 bits (148), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 66/247 (26%), Positives = 95/247 (38%), Gaps = 58/247 (23%)

Query: 197 LAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQ--- 253
              +RPPGHH       GFCL +N  +  +     Y   V   +ILD+D+HHG+GTQ   
Sbjct: 183 FVAIRPPGHHCHYATPSGFCLLNNAHIGIEYAADKY--GVTHAVILDFDLHHGDGTQDLC 240

Query: 254 ---------------------KSFYQDDQVLYVSLHRFEMGKYYPG-TIQGQYDQAGEGK 291
                                K F +  +V Y S+H         G   +     A    
Sbjct: 241 WKRAGFKPDEHTEEDGYDEFGKKFAEFPKVGYFSMHDINSFPTESGFATKENIKNASTCI 300

Query: 292 GEGFNCNITWPV-----------GGVGDAEYMWAFEQV----------VMPMGREFKPDL 330
               + NI W V             +  ++Y   F +           +  +G+ FK  L
Sbjct: 301 MNSHDLNI-WNVHLSRWSTEEEFAKIYKSKYRTLFAKADEFFKNSKNEMNELGKPFK-GL 358

Query: 331 VIISSGFDAADGD-TIGQCH---VTPSCYGHMTHMLKSLA----RGNLCVVLEGGYNLDA 382
           V+IS+GFDA++ + T  Q H   V  S Y   T     LA    +G +  +LEGGY+  A
Sbjct: 359 VVISAGFDASEFEQTSMQRHSVNVPTSFYTMFTKDALKLAQMHCQGKVLSLLEGGYSDKA 418

Query: 383 IARSALS 389
           I     S
Sbjct: 419 ITSGVFS 425

>YPL116W Chr16 (329606..331699) [2094 bp, 697 aa] {ON}
           HOS3Trichostatin A-insensitive homodimeric histone
           deacetylase (HDAC) with specificity in vitro for
           histones H3, H4, H2A, and H2B; similar to Hda1p, Rpd3p,
           Hos1p, and Hos2p; deletion results in increased histone
           acetylation at rDNA repeats
          Length = 697

 Score = 61.6 bits (148), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 82/317 (25%), Positives = 128/317 (40%), Gaps = 67/317 (21%)

Query: 131 ILEVH-TKEHLEFIESTEKMSREQLLKETEKGDSVYFNNDSYASARL--PCGGAIEACKA 187
           +L+VH +    E IE  + M+  +LLK   +    + + D Y S++      G I A + 
Sbjct: 110 VLKVHGSSWPAELIELCQ-MADAKLLKGEIEVPDTWNSGDIYLSSKTIKALQGTIGAIET 168

Query: 188 VVEGRVK---------NSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRR 238
            V+   K          +   +RPPGHH       GFCL +N  VA +     Y  +V  
Sbjct: 169 GVDSIFKGPSAEHISNRAFVAIRPPGHHCHYGTPSGFCLLNNAHVAIEYAYDTY--NVTH 226

Query: 239 IMILDWDIHHGNGTQ------------------------KSFYQDDQVLYVSLHRFEMGK 274
           +++LD+D+HHG+GTQ                        K F +  +V Y S+H      
Sbjct: 227 VVVLDFDLHHGDGTQDICWKRAGFKPEEEPEDSSYDDFGKKFAEFPKVGYFSMHDINSFP 286

Query: 275 YYPG-TIQGQYDQAGEGKGEGFNCNI------TWPVGGVGDAEY------MWA-----FE 316
              G   +     A        + NI       W      +  Y      ++A     F 
Sbjct: 287 TESGFATKENIKNASTCIMNSHDLNIWNIHLSKWTTEEEFNVLYRTKYRTLFAKADEFFR 346

Query: 317 QVVMPMGREFKP--DLVIISSGFDAADGD-TIGQCH---VTPSCYGHMTHMLKSLAR--- 367
              + M ++ +P   LV+IS+GFDA++ + T  Q H   V  S Y   T     LA+   
Sbjct: 347 SAKLEMNQQGRPFKGLVVISAGFDASEFEQTSMQRHSVNVPTSFYTTFTKDALKLAQMHC 406

Query: 368 -GNLCVVLEGGYNLDAI 383
            G +  ++EGGY+  AI
Sbjct: 407 HGKVLSLMEGGYSDKAI 423

>Kwal_26.8505 s26 complement(815901..818027) [2127 bp, 708 aa] {ON}
           YPL116W (HOS3) - sequence similar to the histone
           deacetylase Hda1p [contig 61] FULL
          Length = 708

 Score = 60.8 bits (146), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 66/246 (26%), Positives = 100/246 (40%), Gaps = 66/246 (26%)

Query: 196 SLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQ-- 253
           +   +RPPGHH+      GFCL +N  +A +     Y  +V   ++LD+D+HHG+GTQ  
Sbjct: 187 AFVALRPPGHHSHASTPSGFCLLNNAHIAIEYAADTY--NVTHAVVLDFDLHHGDGTQDI 244

Query: 254 ----------------------KSFYQDDQVLYVSLHRF-----EMGKYYPGTIQGQYDQ 286
                                 K F +  +V Y S+H       E+G      I+     
Sbjct: 245 CWKRAGFKPDECADSGEFDEFGKKFAEYPKVGYFSVHDINSFPTELGYATKENIRN---- 300

Query: 287 AGEGKGEGFNCNITWPV-----------GGVGDAEYMWAF----------EQVVMPMGRE 325
           A     +  + NI W V             +   +Y   F          +Q +  +G+ 
Sbjct: 301 AATCIMDAHDVNI-WNVHLQPYDSEEAFTKLYQTKYRTLFAKADEFFRISKQTMKALGKP 359

Query: 326 FKPDLVIISSGFDAADGDTIG-QCH---VTPSCYGHMTHMLKSLAR----GNLCVVLEGG 377
           FK  LV+IS+GFDA++ +    Q H   V    Y   T     LA+    G +  V+EGG
Sbjct: 360 FK-GLVVISAGFDASEYEQPSMQRHAVNVPTFFYNTFTKDALKLAQMHSHGKVLSVMEGG 418

Query: 378 YNLDAI 383
           Y+  AI
Sbjct: 419 YSDGAI 424

>Suva_16.194 Chr16 (339127..341226) [2100 bp, 699 aa] {ON} YPL116W
           (REAL)
          Length = 699

 Score = 60.5 bits (145), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 80/317 (25%), Positives = 120/317 (37%), Gaps = 67/317 (21%)

Query: 131 ILEVHTKE-HLEFIESTEKMSREQLLKETEKGDSVYFNNDSYASARL--PCGGAIEACKA 187
           +L+VH      E IE  + M+  +LLK   +    + + D Y S++      G I A + 
Sbjct: 110 VLKVHGSHWPTELIELCQ-MADAKLLKGEIEVPDTWNSGDIYLSSKTIQALQGTIGAIET 168

Query: 188 VVEGRVK---------NSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRR 238
            V+   K          +   +RPPGHH       GFCL +N  VA +     Y   V  
Sbjct: 169 GVDSIFKGPSPEHISNRAFVAIRPPGHHCHYATPSGFCLLNNAHVAIEYAFDTY--DVTH 226

Query: 239 IMILDWDIHHGNGTQ------------------------KSFYQDDQVLYVSLHRFEMGK 274
           +++LD+D+HHG+GTQ                        K F +  +V Y S+H      
Sbjct: 227 VVVLDFDLHHGDGTQDICWKRAGFKPEEESENSSYDNFGKKFAEFPKVGYFSMHDINSFP 286

Query: 275 YYPG-TIQGQYDQAGEGKGEGFNCNI------TWPVGGVGDAEYMWAFEQVVMPMGREFK 327
              G   +     A        + NI       W      +  Y   +  +       FK
Sbjct: 287 TESGFATKENIKNASTCIMNSHDLNIWNVHLSKWTTEEDFNILYRTKYRTLFAKADEFFK 346

Query: 328 -------------PDLVIISSGFDAADGD-TIGQCH---VTPSCYGHMTHMLKSLAR--- 367
                          LV+IS+GFDA++ + T  Q H   V  S Y   T     LA+   
Sbjct: 347 TAKLEMNQQEKTFKGLVVISAGFDASEFEQTSMQRHSVNVPTSFYTTFTKDALKLAQMHC 406

Query: 368 -GNLCVVLEGGYNLDAI 383
            G +  ++EGGY+  AI
Sbjct: 407 HGKVLSLMEGGYSDKAI 423

>Kpol_479.6 s479 complement(10892..12958) [2067 bp, 688 aa] {ON}
           complement(10892..12958) [2067 nt, 689 aa]
          Length = 688

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 59/250 (23%), Positives = 90/250 (36%), Gaps = 61/250 (24%)

Query: 196 SLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQ-- 253
           +   +RPPGHH       GFCL +N  +A +     Y   +   +ILD+D+HHG+GTQ  
Sbjct: 185 AFVAIRPPGHHCHVDTPSGFCLLNNAHIAIEYASDTY--GITHAVILDFDLHHGDGTQDI 242

Query: 254 -----------------------KSFYQDDQVLYVSLH---RFEMGKYYPGTIQGQYDQA 287
                                  K F +  +V Y S+H    F     Y    +     A
Sbjct: 243 CWKRAGFRTEAEPETTEGYDEFGKKFAEFPKVGYFSMHDINSFPTESQY--ATKENIRNA 300

Query: 288 GEGKGEGFNCNI------TWPVGGVGDAEYMWAFEQVVM--------------PMGREFK 327
                   + NI       W      D  Y   +  +                 +G+ F+
Sbjct: 301 STCVMNAHDVNIWNIHLSPWETEQDFDKLYQTKYRTLFAKADEFFRNAKEEMDALGKPFQ 360

Query: 328 PDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLA--------RGNLCVVLEGGYN 379
             LV+IS+GFDA++ +       + +   H   M    A         G +  ++EGGY+
Sbjct: 361 -GLVVISAGFDASEFEQTSMQRHSVNVPTHFYTMFTKDALKLSQIHCHGKVLSIMEGGYS 419

Query: 380 LDAIARSALS 389
             AIA    S
Sbjct: 420 DKAIASGVFS 429

>NCAS0C01760 Chr3 (324446..326548) [2103 bp, 700 aa] {ON} Anc_8.607
           YPL116W
          Length = 700

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 37/137 (27%), Positives = 68/137 (49%), Gaps = 13/137 (9%)

Query: 128 SEEILEVHTKEHLEFI-----ESTEKMSREQL-LKETEKGDSVYFNNDSYASARLPCGGA 181
           S  + +VH KE  + +     E+ EK+++ ++ + E+     +Y ++ +  + +   G  
Sbjct: 105 SPHVYKVHGKEWPKEVIQLCKEADEKLAKGEIEVPESWNAGDIYLSSKTIQALQGTIGAL 164

Query: 182 IEACKAVVEG----RVKN-SLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESV 236
                ++ +G     + N +   +RPPGHH       GFCL +N  VA +     Y   V
Sbjct: 165 ETGVDSIFKGPSADHISNRAFVAIRPPGHHCHFATPSGFCLLNNAHVAIEYAADTY--GV 222

Query: 237 RRIMILDWDIHHGNGTQ 253
             + +LD+D+HHG+GTQ
Sbjct: 223 THVAVLDFDLHHGDGTQ 239

>TPHA0M01590 Chr13 complement(332934..334418) [1485 bp, 494 aa] {ON}
           Anc_3.362 YPR068C
          Length = 494

 Score = 58.9 bits (141), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 71/293 (24%), Positives = 122/293 (41%), Gaps = 41/293 (13%)

Query: 205 HHAEPQAAGGFCLFSNVAVAAKNILKNYPESV---RRIMILDWDIHHGNGTQKSFYQDDQ 261
           HHA    A GFC  +++ V+  N L+  P      R++  +D D+HHG+G + +F     
Sbjct: 206 HHAMKSRANGFCYINDI-VSLINELRKTPGQQGHKRKLTYIDLDLHHGDGVENAFNYSKD 264

Query: 262 VLYVSLHRFEMGKYYPGTIQGQYDQAGEGKGEGFNCNITWPVG-GVGDAEYMWAFEQVVM 320
           +  +S+H FE G +YP T   ++     GK +  N  I  PV  G+ ++        +++
Sbjct: 265 IQIISIHLFEPG-FYPCTGGLKF-----GKPKSNNI-INLPVKHGLSNSNMFELVTNIII 317

Query: 321 PMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLAR----------GNL 370
           P+    + D ++I  G D  + D   +  +T    G    ++K +A            N+
Sbjct: 318 PLIELHQSDDIVILCGGDGLNNDYYNEWQLT--IIGLTRCIIKIIAAFVGPHQPGSCKNV 375

Query: 371 CVVLEGGYNLDAIARSALSVA-KV--LIGXXXXXXXXXXXXXXXXVIEMIDKVIRLQS-- 425
            ++  GGYN    +R    +  KV  L G                 I+  DK + ++   
Sbjct: 376 VLLGGGGYNELLASRFYTYLTYKVLQLAGRIPPAATTLAAEVPHGTIDDKDKELLIKDHE 435

Query: 426 ----------KYWNCFRRRHANSGCNFNEPINDSIVSKNFPLQKAIRQQQQHY 468
                     KYW C+   +   G +F   IN +  +K  P  K I + + HY
Sbjct: 436 HIDEYEKEYYKYW-CYEIENGLDGLSFKRQINYN-DTKQKPFTKYIAELRAHY 486

>KNAG0J01300 Chr10 (232784..234817) [2034 bp, 677 aa] {ON} Anc_8.607
           YPL116W
          Length = 677

 Score = 58.9 bits (141), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 36/114 (31%), Positives = 55/114 (48%), Gaps = 10/114 (8%)

Query: 147 EKMSREQL--LKETEKGDSVYFNNDSYASARLPCGGAIEACKAVVEGRVKNSLA-----V 199
           EK++R ++   KE   GD +Y ++ +  + R   G        +  G     ++     V
Sbjct: 128 EKLARGEIEVPKEWNAGD-IYLSSATLTALRGTIGALETGVDTIFTGASPEHISNRVFVV 186

Query: 200 VRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQ 253
           VRPPGHH       GFCL +N  ++ +     Y   V    ILD+D+HHG+GTQ
Sbjct: 187 VRPPGHHCHVTGPSGFCLLNNAHISIEYAADTY--GVTHAAILDFDLHHGDGTQ 238

>KAFR0H02790 Chr8 complement(531813..533966) [2154 bp, 717 aa] {ON}
           Anc_8.607 YPL116W
          Length = 717

 Score = 58.5 bits (140), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 54/116 (46%), Gaps = 8/116 (6%)

Query: 144 ESTEKMSREQL-LKETEKGDSVYFNNDSYASARLPCGGAIEACKAVVEGR-----VKNSL 197
           E+  K+   +L + E+     +Y N+D+  + +   G       ++  G         + 
Sbjct: 127 EADSKLREGKLEVPESWNAGDIYLNSDTIMALKGSIGAIETGVDSIFNGPSPEHICNRAF 186

Query: 198 AVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQ 253
             +RPPGHH       GFCL +N  +  +     Y   V  +++LD+D+HHG+GTQ
Sbjct: 187 VAIRPPGHHCHVGMPSGFCLLNNANITIEYAANTY--GVTHVVVLDFDLHHGDGTQ 240

 Score = 35.4 bits (80), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 44/88 (50%), Gaps = 9/88 (10%)

Query: 310 EYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIG----QCHVTPSCYGHMTHMLKSL 365
           E+  A +  +  MG+ +K  LV+ISSGFDA++ + +       +V  + Y   T     L
Sbjct: 346 EFFKAAKLEMASMGKPYK-GLVLISSGFDASEFEQVSMQRHSVNVPTTFYTMFTKDALKL 404

Query: 366 AR----GNLCVVLEGGYNLDAIARSALS 389
           A+    G +  ++EGGY+  AI     +
Sbjct: 405 AQMHCHGKVISIMEGGYSDKAITSGVFA 432

>NDAI0E02480 Chr5 (512966..515020) [2055 bp, 684 aa] {ON} Anc_8.607
           YPL116W
          Length = 684

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 51/98 (52%), Gaps = 8/98 (8%)

Query: 161 GDSVYFNNDSYASARLPCGGAIEACKAVVEG----RVKN-SLAVVRPPGHHAEPQAAGGF 215
           GD +Y ++ +  + +   G    A  ++ +G     + N +   +RPPGHH       GF
Sbjct: 145 GD-IYLSSKTVQALQGSIGALETAVDSIFKGPSPEHISNRAFVAIRPPGHHCHFATPSGF 203

Query: 216 CLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQ 253
           C+ +N  VA +    +Y   V  + +LD+D+HHG+GTQ
Sbjct: 204 CVLNNAHVAIEYAADSY--DVTHVAVLDFDLHHGDGTQ 239

>Skud_16.164 Chr16 (301141..303234) [2094 bp, 697 aa] {ON} YPL116W
           (REAL)
          Length = 697

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 35/58 (60%), Gaps = 2/58 (3%)

Query: 196 SLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQ 253
           +   +RPPGHH       GFCL +N  VA +     Y  +V  +++LD+D+HHG+GTQ
Sbjct: 186 AFVAIRPPGHHCHYATPSGFCLLNNAHVAIEYAHDAY--NVTHVVVLDFDLHHGDGTQ 241

>ZYRO0F10780g Chr6 complement(879680..881686) [2007 bp, 668 aa] {ON}
           similar to uniprot|Q02959 Saccharomyces cerevisiae
           YPL116W HOS3 Trichostatin A-insensitive homodimeric
           histone deacetylase (HDAC)
          Length = 668

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 80/322 (24%), Positives = 128/322 (39%), Gaps = 70/322 (21%)

Query: 128 SEEILEVHTKE-HLEFIESTEKMSREQLLKETE------KGDSVYFNNDSYASARLPCGG 180
           S  +L+VH K+   + +   ++   +   KE E       GD +Y ++ +  + +   G 
Sbjct: 103 SPHVLKVHGKDWPPQLLRLCKEADAKLAAKEVEVPASWNAGD-IYLSSKTVEALQGSIGA 161

Query: 181 AIEACKAVVEG----RVKN-SLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPES 235
              A  ++ +G     + N +   +RPPGHH       GFCL +N  VA +     +   
Sbjct: 162 LETAVDSIFDGPSPEHISNRAFVAIRPPGHHCHVATPSGFCLLNNAHVAIEYAKDRF--G 219

Query: 236 VRRIMILDWDIHHGNGTQ-------------------------KSFYQDDQVLYVSLHRF 270
           V    ILD+D+HHG+GTQ                         K F +  +V Y S+H  
Sbjct: 220 VTHAAILDFDLHHGDGTQDICWKRAGFRPDEEDEDSPGYDSFGKKFAEYPRVGYFSMHDI 279

Query: 271 EMGKYYPG-TIQGQYDQAGEGKGEGFNCNITWPV-----------GGVGDAEYMWAF--- 315
                  G   +     A        + NI W +             +   +Y   F   
Sbjct: 280 NSFPTESGYATKENVKNASTCIMNAHDVNI-WNIHLSPWETEEDFAKLYHTKYRSLFVKA 338

Query: 316 ----EQVVMPMGREFKP--DLVIISSGFDAADGD-TIGQCHVT--PS-CYGHMTHMLKSL 365
               +Q  + M  + KP   LV+ISSGFDA++ + T  Q H T  P+  Y   T     L
Sbjct: 339 DEFFKQGKIEMAAQNKPFKGLVVISSGFDASEFEQTSMQRHGTNVPTYFYTAFTKDALKL 398

Query: 366 AR----GNLCVVLEGGYNLDAI 383
           ++    G +  ++EGGY+  AI
Sbjct: 399 SQMHCHGKVLSIMEGGYSDKAI 420

>Kwal_55.20650 s55 (505162..505776) [615 bp, 204 aa] {ON} YLL033W -
           Hypothetical ORF [contig 142] FULL
          Length = 204

 Score = 31.2 bits (69), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 52/110 (47%), Gaps = 5/110 (4%)

Query: 123 VRAATSEEILEVHTKEHLEFIESTEKMSREQLLKETEKGDSVY-FNNDSYASARLPCGGA 181
           +R   S+++L +  +    F+  T  +SR  ++++T      Y F N++Y   RL  G A
Sbjct: 35  IREYPSDDVLRMCYRR---FMRLTPLISRRSMIRQTYVHYVRYKFKNENYEEKRLASGLA 91

Query: 182 IEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKN 231
           +   K  +  +V NSL        + +  + G   +   + + +KNILKN
Sbjct: 92  VLEAKPCILQQVVNSLNFCLEAVVYVKKGSPGEQAVAEEIRL-SKNILKN 140

>AFR659W Chr6 (1640624..1641445) [822 bp, 273 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YGL128C (CWC23)
          Length = 273

 Score = 31.2 bits (69), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 34/71 (47%)

Query: 98  AENGLINDPTLSGVDDLGDLMLKIPVRAATSEEILEVHTKEHLEFIESTEKMSREQLLKE 157
            EN L+    +  VD + DL+    V+   SE IL+V  + H ++      +S ++ + E
Sbjct: 202 TENDLVLYAVMPDVDTMLDLLNNWAVKPPLSEHILQVQPRVHTDYFHFKTDISLDKTITE 261

Query: 158 TEKGDSVYFNN 168
               D+ Y ++
Sbjct: 262 AIDADNQYMSS 272

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.137    0.416 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 79,065,194
Number of extensions: 3611888
Number of successful extensions: 10415
Number of sequences better than 10.0: 111
Number of HSP's gapped: 10421
Number of HSP's successfully gapped: 124
Length of query: 706
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 589
Effective length of database: 40,065,477
Effective search space: 23598565953
Effective search space used: 23598565953
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)