Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_14.3092.286ON49049023710.0
Skud_14.3072.286ON49049022490.0
YNL022C2.286ON49048922280.0
Suva_14.3252.286ON49049022210.0
NDAI0G006602.286ON49649718230.0
Kpol_1003.382.286ON49649617740.0
KAFR0H033102.286ON48849117500.0
NCAS0G037902.286ON49249617160.0
TPHA0C034002.286ON49449317050.0
TDEL0G021702.286ON48449216750.0
KNAG0H020002.286ON49849616740.0
TBLA0B069602.286ON50850616590.0
SAKL0E07678g2.286ON47749016460.0
CAGL0M06941g2.286ON49249616260.0
KLLA0E08361g2.286ON49149615850.0
Ecym_33252.286ON49649115760.0
Kwal_27.115322.286ON47949215600.0
ZYRO0A01892g2.286ON46549115530.0
KLTH0G10362g2.286ON52948915300.0
ADL215W2.286ON48449314830.0
ZYRO0A01562g2.247ON6172031591e-10
SAKL0E08624g2.247ON6112031572e-10
ADL254W2.247ON6031991572e-10
CAGL0J10032g2.247ON6192051535e-10
AFR179C8.171ON7002951535e-10
Kpol_1003.152.247ON6332701528e-10
KAFR0J009702.247ON6102031528e-10
KLLA0F03399g2.247ON6192031501e-09
TPHA0C031502.247ON6082031482e-09
TBLA0E038502.247ON6322031482e-09
Ecym_23538.171ON6902951473e-09
NDAI0D010502.247ON6252051473e-09
KNAG0I018702.247ON6292051473e-09
Ecym_32842.247ON6062031446e-09
Kwal_23.48412.247ON6272771446e-09
KLTH0G09460g2.247ON6372031447e-09
NCAS0G030302.247ON4902051437e-09
Suva_14.2802.247ON6202791431e-08
YNL061W (NOP2)2.247ON6182121431e-08
Smik_14.2662.247ON6182121421e-08
Skud_14.2712.247ON6192051421e-08
TDEL0C041502.247ON6142031402e-08
KNAG0D020508.171ON6822981375e-08
SAKL0H19448g8.171ON6912961376e-08
ZYRO0G08998g8.171ON6832981351e-07
TBLA0A087408.171ON6863041351e-07
TPHA0H001508.171ON6493071341e-07
Kpol_1002.1098.171ON6703021331e-07
KNAG0G015108.171ON6662961332e-07
TPHA0C028708.171ON6742991332e-07
NDAI0B018308.171ON6862971322e-07
NCAS0B043908.171ON6712981313e-07
KAFR0B022208.171ON6862991303e-07
TDEL0B043908.171ON6733021295e-07
Suva_2.978.171ON6702981261e-06
KLTH0H08096g8.171ON6882961242e-06
Smik_2.928.171ON6742981224e-06
Skud_2.818.171ON6812981206e-06
YBL024W (NCL1)8.171ON6842981171e-05
CAGL0K01991g8.171ON6722921143e-05
NCAS0B056408.171ON6592981134e-05
KLLA0F12562g8.171ON7042991072e-04
NDAI0B029808.171ON6792991045e-04
Kwal_14.20818.171ON272123850.054
Ecym_30036.1ON31974780.44
YNL023C (FAP1)2.288ON96560780.66
KNAG0L024406.1ON31781750.98
SAKL0E00660g6.1ON32274731.7
KNAG0M00120singletonON88164713.8
TBLA0A070806.1ON32174704.0
TPHA0J002006.1ON31974704.0
Kpol_449.126.1ON31977704.1
ZYRO0F00308g6.1ON31974705.0
Smik_6.4746.1ON31874705.0
CAGL0L07678g6.1ON31774695.6
YAR007C (RFA1)4.120ON621116705.9
KLTH0C11704g6.1ON32274687.5
Kwal_56.223176.1ON36274688.4
Suva_16.396.1ON31874688.4
KAFR0B064506.1ON31877688.5
YPL266W (DIM1)6.1ON31874688.6
TPHA0D015302.288ON96240689.1
Skud_16.116.1ON31874679.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_14.309
         (490 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_14.309 Chr14 complement(553805..555277) [1473 bp, 490 aa] {...   917   0.0  
Skud_14.307 Chr14 complement(562104..563576) [1473 bp, 490 aa] {...   870   0.0  
YNL022C Chr14 complement(591427..592899) [1473 bp, 490 aa] {ON} ...   862   0.0  
Suva_14.325 Chr14 complement(574309..575781) [1473 bp, 490 aa] {...   860   0.0  
NDAI0G00660 Chr7 (144471..145961) [1491 bp, 496 aa] {ON} Anc_2.2...   706   0.0  
Kpol_1003.38 s1003 (94479..95969) [1491 bp, 496 aa] {ON} (94479....   687   0.0  
KAFR0H03310 Chr8 complement(630597..632063) [1467 bp, 488 aa] {O...   678   0.0  
NCAS0G03790 Chr7 complement(699962..701440) [1479 bp, 492 aa] {O...   665   0.0  
TPHA0C03400 Chr3 (747016..748500) [1485 bp, 494 aa] {ON} Anc_2.2...   661   0.0  
TDEL0G02170 Chr7 (427274..428728) [1455 bp, 484 aa] {ON} Anc_2.2...   649   0.0  
KNAG0H02000 Chr8 complement(353074..354570) [1497 bp, 498 aa] {O...   649   0.0  
TBLA0B06960 Chr2 (1646966..1648492) [1527 bp, 508 aa] {ON} Anc_2...   643   0.0  
SAKL0E07678g Chr5 complement(621183..622616) [1434 bp, 477 aa] {...   638   0.0  
CAGL0M06941g Chr13 complement(706878..708356) [1479 bp, 492 aa] ...   630   0.0  
KLLA0E08361g Chr5 complement(751889..753364) [1476 bp, 491 aa] {...   615   0.0  
Ecym_3325 Chr3 (623214..624704) [1491 bp, 496 aa] {ON} similar t...   611   0.0  
Kwal_27.11532 s27 complement(837572..839011) [1440 bp, 479 aa] {...   605   0.0  
ZYRO0A01892g Chr1 (156967..158364) [1398 bp, 465 aa] {ON} simila...   602   0.0  
KLTH0G10362g Chr7 (876756..878345) [1590 bp, 529 aa] {ON} highly...   593   0.0  
ADL215W Chr4 (326584..328038) [1455 bp, 484 aa] {ON} Syntenic ho...   575   0.0  
ZYRO0A01562g Chr1 (128145..129998) [1854 bp, 617 aa] {ON} simila...    66   1e-10
SAKL0E08624g Chr5 complement(704579..706414) [1836 bp, 611 aa] {...    65   2e-10
ADL254W Chr4 (253602..255413) [1812 bp, 603 aa] {ON} Syntenic ho...    65   2e-10
CAGL0J10032g Chr10 (983405..985264) [1860 bp, 619 aa] {ON} highl...    64   5e-10
AFR179C Chr6 complement(766458..768560) [2103 bp, 700 aa] {ON} S...    64   5e-10
Kpol_1003.15 s1003 (41683..43584) [1902 bp, 633 aa] {ON} (41683....    63   8e-10
KAFR0J00970 Chr10 (174873..176705) [1833 bp, 610 aa] {ON} Anc_2....    63   8e-10
KLLA0F03399g Chr6 (319007..320866) [1860 bp, 619 aa] {ON} simila...    62   1e-09
TPHA0C03150 Chr3 (697508..699334) [1827 bp, 608 aa] {ON} Anc_2.2...    62   2e-09
TBLA0E03850 Chr5 (967569..969467) [1899 bp, 632 aa] {ON} Anc_2.2...    62   2e-09
Ecym_2353 Chr2 complement(691422..693494) [2073 bp, 690 aa] {ON}...    61   3e-09
NDAI0D01050 Chr4 (236435..238312) [1878 bp, 625 aa] {ON} Anc_2.2...    61   3e-09
KNAG0I01870 Chr9 complement(366800..368689) [1890 bp, 629 aa] {O...    61   3e-09
Ecym_3284 Chr3 (537227..539047) [1821 bp, 606 aa] {ON} similar t...    60   6e-09
Kwal_23.4841 s23 (890138..892021) [1884 bp, 627 aa] {ON} YNL061W...    60   6e-09
KLTH0G09460g Chr7 (787197..789110) [1914 bp, 637 aa] {ON} simila...    60   7e-09
NCAS0G03030 Chr7 (556908..558380) [1473 bp, 490 aa] {ON} Anc_2.2...    60   7e-09
Suva_14.280 Chr14 (509488..511350) [1863 bp, 620 aa] {ON} YNL061...    60   1e-08
YNL061W Chr14 (510540..512396) [1857 bp, 618 aa] {ON}  NOP2Proba...    60   1e-08
Smik_14.266 Chr14 (490908..492764) [1857 bp, 618 aa] {ON} YNL061...    59   1e-08
Skud_14.271 Chr14 (500809..502668) [1860 bp, 619 aa] {ON} YNL061...    59   1e-08
TDEL0C04150 Chr3 complement(734914..736758) [1845 bp, 614 aa] {O...    59   2e-08
KNAG0D02050 Chr4 (339873..341921) [2049 bp, 682 aa] {ON} Anc_8.1...    57   5e-08
SAKL0H19448g Chr8 (1713663..1715738) [2076 bp, 691 aa] {ON} high...    57   6e-08
ZYRO0G08998g Chr7 complement(726070..728121) [2052 bp, 683 aa] {...    57   1e-07
TBLA0A08740 Chr1 (2141750..2143810) [2061 bp, 686 aa] {ON} Anc_8...    57   1e-07
TPHA0H00150 Chr8 (15977..17926) [1950 bp, 649 aa] {ON} Anc_8.171...    56   1e-07
Kpol_1002.109 s1002 (272892..274904) [2013 bp, 670 aa] {ON} (272...    56   1e-07
KNAG0G01510 Chr7 complement(341469..343469) [2001 bp, 666 aa] {O...    56   2e-07
TPHA0C02870 Chr3 (620913..622937) [2025 bp, 674 aa] {ON} Anc_8.1...    56   2e-07
NDAI0B01830 Chr2 (436254..438314) [2061 bp, 686 aa] {ON} Anc_8.1...    55   2e-07
NCAS0B04390 Chr2 complement(795633..797648) [2016 bp, 671 aa] {O...    55   3e-07
KAFR0B02220 Chr2 complement(438809..440869) [2061 bp, 686 aa] {O...    55   3e-07
TDEL0B04390 Chr2 (769749..771770) [2022 bp, 673 aa] {ON} Anc_8.1...    54   5e-07
Suva_2.97 Chr2 (172667..174679) [2013 bp, 670 aa] {ON} YBL024W (...    53   1e-06
KLTH0H08096g Chr8 (706261..708327) [2067 bp, 688 aa] {ON} simila...    52   2e-06
Smik_2.92 Chr2 (166201..168225) [2025 bp, 674 aa] {ON} YBL024W (...    52   4e-06
Skud_2.81 Chr2 (156273..158318) [2046 bp, 681 aa] {ON} YBL024W (...    51   6e-06
YBL024W Chr2 (172534..174588) [2055 bp, 684 aa] {ON}  NCL1S-aden...    50   1e-05
CAGL0K01991g Chr11 (173969..175987) [2019 bp, 672 aa] {ON} highl...    49   3e-05
NCAS0B05640 Chr2 complement(1068983..1070962) [1980 bp, 659 aa] ...    48   4e-05
KLLA0F12562g Chr6 (1163366..1165480) [2115 bp, 704 aa] {ON} high...    46   2e-04
NDAI0B02980 Chr2 complement(757926..759965) [2040 bp, 679 aa] {O...    45   5e-04
Kwal_14.2081 s14 (598648..599463) [816 bp, 272 aa] {ON} YBL024W ...    37   0.054
Ecym_3003 Chr3 complement(6934..7893) [960 bp, 319 aa] {ON} simi...    35   0.44 
YNL023C Chr14 complement(588263..591160) [2898 bp, 965 aa] {ON} ...    35   0.66 
KNAG0L02440 Chr12 (434232..435185) [954 bp, 317 aa] {ON} Anc_6.1...    33   0.98 
SAKL0E00660g Chr5 complement(42779..43747) [969 bp, 322 aa] {ON}...    33   1.7  
KNAG0M00120 Chr13 complement(12320..14965) [2646 bp, 881 aa] {ON}      32   3.8  
TBLA0A07080 Chr1 complement(1748948..1749913) [966 bp, 321 aa] {...    32   4.0  
TPHA0J00200 Chr10 complement(47344..48303) [960 bp, 319 aa] {ON}...    32   4.0  
Kpol_449.12 s449 complement(42834..43793) [960 bp, 319 aa] {ON} ...    32   4.1  
ZYRO0F00308g Chr6 complement(32198..33157) [960 bp, 319 aa] {ON}...    32   5.0  
Smik_6.474 Chr6 complement(781184..782140) [957 bp, 318 aa] {ON}...    32   5.0  
CAGL0L07678g Chr12 complement(846285..847238) [954 bp, 317 aa] {...    31   5.6  
YAR007C Chr1 complement(156754..158619) [1866 bp, 621 aa] {ON}  ...    32   5.9  
KLTH0C11704g Chr3 (966706..967674) [969 bp, 322 aa] {ON} highly ...    31   7.5  
Kwal_56.22317 s56 complement(43543..44631) [1089 bp, 362 aa] {ON...    31   8.4  
Suva_16.39 Chr16 (54705..55661) [957 bp, 318 aa] {ON} YPL266W (R...    31   8.4  
KAFR0B06450 Chr2 complement(1337903..1338859) [957 bp, 318 aa] {...    31   8.5  
YPL266W Chr16 (39121..40077) [957 bp, 318 aa] {ON}  DIM1Essentia...    31   8.6  
TPHA0D01530 Chr4 complement(313063..315951) [2889 bp, 962 aa] {O...    31   9.1  
Skud_16.11 Chr16 (18214..19170) [957 bp, 318 aa] {ON} YPL266W (R...    30   9.5  

>Smik_14.309 Chr14 complement(553805..555277) [1473 bp, 490 aa] {ON}
           YNL022C (REAL)
          Length = 490

 Score =  917 bits (2371), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 461/490 (94%), Positives = 461/490 (94%)

Query: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLKSCKRYKLKSNPKHVYAVLDSCWKYKPY 60
           MNFYRDATWVLEDIEKEAAKERISGSMQTLVLKSCKRYKLKSNPKHVYAVLDSCWKYKPY
Sbjct: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLKSCKRYKLKSNPKHVYAVLDSCWKYKPY 60

Query: 61  LEKVMKKARILEDIPKKKGKPLFSRXXXXXXXXXXXISKQKRIQMGKHPIKDYVLKFKSP 120
           LEKVMKKARILEDIPKKKGKPLFSR           ISKQKRIQMGKHPIKDYVLKFKSP
Sbjct: 61  LEKVMKKARILEDIPKKKGKPLFSRLTLLLLCHDLLISKQKRIQMGKHPIKDYVLKFKSP 120

Query: 121 LHSEMVXXXXXXXVRNLSELVLSEDIANDLPPVRWIRINPLKCYPNGKTEPVLAELRKKF 180
           LHSEMV       VRNLSELVLSEDIANDLPPVRWIRINPLKCYPNGKTEPVLAELRKKF
Sbjct: 121 LHSEMVKLKLKLKVRNLSELVLSEDIANDLPPVRWIRINPLKCYPNGKTEPVLAELRKKF 180

Query: 181 TLKVEKWSELVPESIYYDEYIPNLFGIHPSDKITAHELYKNGKIIIQDRASCFPAHILNP 240
           TLKVEKWSELVPESIYYDEYIPNLFGIHPSDKITAHELYKNGKIIIQDRASCFPAHILNP
Sbjct: 181 TLKVEKWSELVPESIYYDEYIPNLFGIHPSDKITAHELYKNGKIIIQDRASCFPAHILNP 240

Query: 241 GPNDIVIDACSAPGNKTTHTASYICSEPPKDSRTRIYAFEKDPERAKILQKMIKIAGCSS 300
           GPNDIVIDACSAPGNKTTHTASYICSEPPKDSRTRIYAFEKDPERAKILQKMIKIAGCSS
Sbjct: 241 GPNDIVIDACSAPGNKTTHTASYICSEPPKDSRTRIYAFEKDPERAKILQKMIKIAGCSS 300

Query: 301 NIDVSVGDFTKLATPEKFKDATGFIVDPSCSGSGIFGRKFFDSLNRXXXXXXXXXXXIVP 360
           NIDVSVGDFTKLATPEKFKDATGFIVDPSCSGSGIFGRKFFDSLNR           IVP
Sbjct: 301 NIDVSVGDFTKLATPEKFKDATGFIVDPSCSGSGIFGRKFFDSLNRKKMDDKDDDNDIVP 360

Query: 361 DEQEEFMAKEELQTRLAKLSSFQFQMVKHAMSFPVAKKIVYSTCSIHAEENERVVIDLLL 420
           DEQEEFMAKEELQTRLAKLSSFQFQMVKHAMSFPVAKKIVYSTCSIHAEENERVVIDLLL
Sbjct: 361 DEQEEFMAKEELQTRLAKLSSFQFQMVKHAMSFPVAKKIVYSTCSIHAEENERVVIDLLL 420

Query: 421 DKAVQEWGWRVAPRSEVIPFWPRRGKVEEFEEVFREGAAHDPQELAEGCIRALPKDDGGI 480
           DKAVQEWGWRVAPRSEVIPFWPRRGKVEEFEEVFREGAAHDPQELAEGCIRALPKDDGGI
Sbjct: 421 DKAVQEWGWRVAPRSEVIPFWPRRGKVEEFEEVFREGAAHDPQELAEGCIRALPKDDGGI 480

Query: 481 GFFAVCFERK 490
           GFFAVCFERK
Sbjct: 481 GFFAVCFERK 490

>Skud_14.307 Chr14 complement(562104..563576) [1473 bp, 490 aa] {ON}
           YNL022C (REAL)
          Length = 490

 Score =  870 bits (2249), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/490 (85%), Positives = 446/490 (91%)

Query: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLKSCKRYKLKSNPKHVYAVLDSCWKYKPY 60
           MNFYRDATWVLEDIEKEAAKERISGSMQTLVL+SCK+YKLKSNPKH+YAVLDSCWKYKPY
Sbjct: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLRSCKKYKLKSNPKHIYAVLDSCWKYKPY 60

Query: 61  LEKVMKKARILEDIPKKKGKPLFSRXXXXXXXXXXXISKQKRIQMGKHPIKDYVLKFKSP 120
           LEKVMKKARILEDIPKKKGKPLFSR           +SKQKRIQMGKHPIKDYVLKFKSP
Sbjct: 61  LEKVMKKARILEDIPKKKGKPLFSRLTLLLLCHDLLLSKQKRIQMGKHPIKDYVLKFKSP 120

Query: 121 LHSEMVXXXXXXXVRNLSELVLSEDIANDLPPVRWIRINPLKCYPNGKTEPVLAELRKKF 180
           LHSEMV       VR+LSE+VLSEDI NDLPPVRWIRINPLKC+PNG TEPVLAELRKKF
Sbjct: 121 LHSEMVKLKLKLKVRDLSEVVLSEDITNDLPPVRWIRINPLKCHPNGDTEPVLAELRKKF 180

Query: 181 TLKVEKWSELVPESIYYDEYIPNLFGIHPSDKITAHELYKNGKIIIQDRASCFPAHILNP 240
           TLKV KWS+LVP SIYYDEYIPNLFGIHP+DKITAHELYK+GKIIIQDRASCFPAHIL+P
Sbjct: 181 TLKVNKWSDLVPGSIYYDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAHILHP 240

Query: 241 GPNDIVIDACSAPGNKTTHTASYICSEPPKDSRTRIYAFEKDPERAKILQKMIKIAGCSS 300
           G +DIVIDACSAPGNKTTHTASYICS PPKD+  RIYAFEKDPERAKILQKM+K+AGCSS
Sbjct: 241 GADDIVIDACSAPGNKTTHTASYICSGPPKDNIIRIYAFEKDPERAKILQKMVKVAGCSS 300

Query: 301 NIDVSVGDFTKLATPEKFKDATGFIVDPSCSGSGIFGRKFFDSLNRXXXXXXXXXXXIVP 360
           NIDV VGDFTKLATP+K K ATGFIVDPSCSGSGIFGRKFFDSLN+           ++P
Sbjct: 301 NIDVKVGDFTKLATPDKCKGATGFIVDPSCSGSGIFGRKFFDSLNKRKMDEKDDDNDVIP 360

Query: 361 DEQEEFMAKEELQTRLAKLSSFQFQMVKHAMSFPVAKKIVYSTCSIHAEENERVVIDLLL 420
           DEQEEFMAKEELQTRLAKLSSFQFQMVKHAMSFP AKKIVYSTCSIHAEENERVVIDLLL
Sbjct: 361 DEQEEFMAKEELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENERVVIDLLL 420

Query: 421 DKAVQEWGWRVAPRSEVIPFWPRRGKVEEFEEVFREGAAHDPQELAEGCIRALPKDDGGI 480
           DKAVQEWGW+VAPR+EVIP WPRRGKVEEF EVFR+G AH+P++LAEGCIRALPK+DGGI
Sbjct: 421 DKAVQEWGWKVAPRTEVIPSWPRRGKVEEFGEVFRDGTAHNPRQLAEGCIRALPKEDGGI 480

Query: 481 GFFAVCFERK 490
           GFFAVCFERK
Sbjct: 481 GFFAVCFERK 490

>YNL022C Chr14 complement(591427..592899) [1473 bp, 490 aa] {ON}
           Putative cytosine 5-methyltransferase, contains seven
           beta-strand methyltransferase motif similar to
           NOP2/YNL061W; green fluorescent protein (GFP)-fusion
           protein localizes to the nucleus; predicted to be
           involved in ribosome biogenesis
          Length = 490

 Score =  862 bits (2228), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/489 (86%), Positives = 443/489 (90%)

Query: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLKSCKRYKLKSNPKHVYAVLDSCWKYKPY 60
           MNFYRDATWVLEDIEKEAAKERISGSMQTLVLKSCKRYKLKSNPKH+YAVLDSCWKYKPY
Sbjct: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKPY 60

Query: 61  LEKVMKKARILEDIPKKKGKPLFSRXXXXXXXXXXXISKQKRIQMGKHPIKDYVLKFKSP 120
           LEKVMKKA ILEDIPKKKGKPLFSR           +SKQKRIQMGKHPIKDYVLKFKSP
Sbjct: 61  LEKVMKKAHILEDIPKKKGKPLFSRLTLLLLCHDLLLSKQKRIQMGKHPIKDYVLKFKSP 120

Query: 121 LHSEMVXXXXXXXVRNLSELVLSEDIANDLPPVRWIRINPLKCYPNGKTEPVLAELRKKF 180
           LHSEMV       VR LSELVLSEDI+NDLPPVRWIRINPLKC+PNG+TEPVLAELRKKF
Sbjct: 121 LHSEMVKLKLKLKVRELSELVLSEDISNDLPPVRWIRINPLKCHPNGETEPVLAELRKKF 180

Query: 181 TLKVEKWSELVPESIYYDEYIPNLFGIHPSDKITAHELYKNGKIIIQDRASCFPAHILNP 240
           TLKV+KWSELVP SIYYDE+IPNLFGIHPSDKITAHELYK+GKIIIQDRASCFPAHILNP
Sbjct: 181 TLKVDKWSELVPGSIYYDEFIPNLFGIHPSDKITAHELYKHGKIIIQDRASCFPAHILNP 240

Query: 241 GPNDIVIDACSAPGNKTTHTASYICSEPPKDSRTRIYAFEKDPERAKILQKMIKIAGCSS 300
           GP+DIVID+CSAPGNKTTHTASYI  EPPKD+ TRIYAFEKDPERAK+LQKMIKIAGCS 
Sbjct: 241 GPSDIVIDSCSAPGNKTTHTASYIYPEPPKDNNTRIYAFEKDPERAKVLQKMIKIAGCSP 300

Query: 301 NIDVSVGDFTKLATPEKFKDATGFIVDPSCSGSGIFGRKFFDSLNRXXXXXXXXXXXIVP 360
           NI V+VGDFTKLATPEK+KD T FIVDPSCSGSGIFGRKFFDS NR           IVP
Sbjct: 301 NISVNVGDFTKLATPEKYKDVTCFIVDPSCSGSGIFGRKFFDSFNRRKIDDKDDDGGIVP 360

Query: 361 DEQEEFMAKEELQTRLAKLSSFQFQMVKHAMSFPVAKKIVYSTCSIHAEENERVVIDLLL 420
           DEQEEF+AKEELQTRLAKLSSFQFQMVKHAMSFP AKKIVYSTCSIHAEENERVVIDLLL
Sbjct: 361 DEQEEFIAKEELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENERVVIDLLL 420

Query: 421 DKAVQEWGWRVAPRSEVIPFWPRRGKVEEFEEVFREGAAHDPQELAEGCIRALPKDDGGI 480
           DK+V+EWGW+VAP+ EVIP WPRRGKVEEFEEVFR+G  +DPQ+LAEGCIRALPK DGGI
Sbjct: 421 DKSVREWGWKVAPKREVIPSWPRRGKVEEFEEVFRDGVTYDPQQLAEGCIRALPKSDGGI 480

Query: 481 GFFAVCFER 489
           GFFAVCFER
Sbjct: 481 GFFAVCFER 489

>Suva_14.325 Chr14 complement(574309..575781) [1473 bp, 490 aa] {ON}
           YNL022C (REAL)
          Length = 490

 Score =  860 bits (2221), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/490 (85%), Positives = 443/490 (90%)

Query: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLKSCKRYKLKSNPKHVYAVLDSCWKYKPY 60
           MNFYRDATWVLEDIEKEAAK RISGSMQTLVLKSCKRYKLKSNPKH+YAVLDSCWKYKPY
Sbjct: 1   MNFYRDATWVLEDIEKEAAKVRISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKPY 60

Query: 61  LEKVMKKARILEDIPKKKGKPLFSRXXXXXXXXXXXISKQKRIQMGKHPIKDYVLKFKSP 120
           LEKVMKKARILE+IPKKKGKPLF+R           +SKQKRIQMGKHPIK+YVLKFKSP
Sbjct: 61  LEKVMKKARILEEIPKKKGKPLFARLTLLLLCHDLLLSKQKRIQMGKHPIKEYVLKFKSP 120

Query: 121 LHSEMVXXXXXXXVRNLSELVLSEDIANDLPPVRWIRINPLKCYPNGKTEPVLAELRKKF 180
           LHSEMV       VR+LSELVLSEDI NDLPPVRWIRINPLKC+P+G TEPVLAEL+KKF
Sbjct: 121 LHSEMVKLKLKLKVRDLSELVLSEDIVNDLPPVRWIRINPLKCHPDGNTEPVLAELKKKF 180

Query: 181 TLKVEKWSELVPESIYYDEYIPNLFGIHPSDKITAHELYKNGKIIIQDRASCFPAHILNP 240
           T KV+ WSELVP SIY+DEYIPNLFGIHP+DKITAHELYK+GKIIIQDRASCFPAHIL+P
Sbjct: 181 TQKVDNWSELVPGSIYHDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAHILHP 240

Query: 241 GPNDIVIDACSAPGNKTTHTASYICSEPPKDSRTRIYAFEKDPERAKILQKMIKIAGCSS 300
           G NDIVIDACSAPGNKTTHTASYI SEPPKD + +IYAFEKDPERAKILQKMIK+AGCS+
Sbjct: 241 GSNDIVIDACSAPGNKTTHTASYIFSEPPKDKKIQIYAFEKDPERAKILQKMIKVAGCSA 300

Query: 301 NIDVSVGDFTKLATPEKFKDATGFIVDPSCSGSGIFGRKFFDSLNRXXXXXXXXXXXIVP 360
           NIDV+VGDFTKLATPEK K  TGFIVDPSCSGSGIFGRKFFDSLNR            VP
Sbjct: 301 NIDVNVGDFTKLATPEKCKGVTGFIVDPSCSGSGIFGRKFFDSLNRRKIDEKDDEDDAVP 360

Query: 361 DEQEEFMAKEELQTRLAKLSSFQFQMVKHAMSFPVAKKIVYSTCSIHAEENERVVIDLLL 420
           DEQEEFMAKEELQTRLAKLSSFQFQMVKHAMSFP AKKIVYSTCSIHAEENERVVIDLLL
Sbjct: 361 DEQEEFMAKEELQTRLAKLSSFQFQMVKHAMSFPGAKKIVYSTCSIHAEENERVVIDLLL 420

Query: 421 DKAVQEWGWRVAPRSEVIPFWPRRGKVEEFEEVFREGAAHDPQELAEGCIRALPKDDGGI 480
           DKAVQEWGW+VA R+EV+P WPRRGKVEEFEEVFR+G+AHDPQ+LAEGCIRALPK+DGGI
Sbjct: 421 DKAVQEWGWKVASRTEVVPSWPRRGKVEEFEEVFRDGSAHDPQQLAEGCIRALPKEDGGI 480

Query: 481 GFFAVCFERK 490
           GFFAVCF RK
Sbjct: 481 GFFAVCFVRK 490

>NDAI0G00660 Chr7 (144471..145961) [1491 bp, 496 aa] {ON} Anc_2.286
           YNL022C
          Length = 496

 Score =  706 bits (1823), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/497 (69%), Positives = 398/497 (80%), Gaps = 9/497 (1%)

Query: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLKSCKRYKLKSNPKHVYAVLDSCWKYKPY 60
           MNFYRDATWVLE +E++ AK RISGS+QTLVL+SC +YKLK NPKHVYAV+DSCWKYKPY
Sbjct: 1   MNFYRDATWVLEYVEQQEAKGRISGSLQTLVLQSCTKYKLKCNPKHVYAVIDSCWKYKPY 60

Query: 61  LEKVMKKARILEDIPKKKGKPLFSRXXXXXXXXXXXISKQKRIQMGKHPIKDYVLKFKSP 120
           LEKVMKK+ IL+DIPKKKGKP++SR            SK KRIQMGKHPIK+YVLK KS 
Sbjct: 61  LEKVMKKSGILDDIPKKKGKPMYSRLTLMLLCHDLLFSKSKRIQMGKHPIKEYVLKHKSR 120

Query: 121 LHSEMVXXXXXXXVRNLSELVLSEDIANDLPPVRWIRINPLKCYPNGKTEPVLAELRKKF 180
           LHSE+V       V+NLSE+V + D   D+ PVRWIRINPL+CY       VL EL KKF
Sbjct: 121 LHSELVRLKLKLKVKNLSEIVDNNDSTEDVTPVRWIRINPLRCYQGRDVNAVLEELGKKF 180

Query: 181 TLKVEKWSELVPESIYYDEYIPNLFGIHPSDKITAHELYKNGKIIIQDRASCFPAHILNP 240
             +VE W+++VP SIYYDEYIP+L+GIHP DKIT+HELYK GKIIIQDRASCFPAHILNP
Sbjct: 181 PKRVENWNDIVPGSIYYDEYIPHLYGIHPQDKITSHELYKQGKIIIQDRASCFPAHILNP 240

Query: 241 GPNDIVIDACSAPGNKTTHTASYICSEPPK-DSRTRIYAFEKDPERAKILQKMIKIAGCS 299
             +DI+IDAC+APGNKTTH ASY+  +  + D   +IYAFEKDPERAKIL+KMIK+AGCS
Sbjct: 241 SKDDIIIDACAAPGNKTTHVASYMFGDAKQEDPHVQIYAFEKDPERAKILEKMIKVAGCS 300

Query: 300 SNIDVSVGDFTKLATPEKFKDATGFIVDPSCSGSGIFGRKFFDSLNRXXXXXXXXXXXI- 358
            NI V+VGDFTK ATP+KFKD TGFIVDPSCSGSGIFGRK+ DSLNR             
Sbjct: 301 KNIQVTVGDFTKAATPDKFKDVTGFIVDPSCSGSGIFGRKYVDSLNRQRNNDTTDKDKKS 360

Query: 359 ------VPDEQEEFMAKEELQTRLAKLSSFQFQMVKHAMSFPVAKKIVYSTCSIHAEENE 412
                 VPDEQE++  KE+L+TRLAKLSSFQFQ++KHAMSFP AKKIVYSTCSIHAEENE
Sbjct: 361 TEEDDEVPDEQEDYNKKEDLKTRLAKLSSFQFQVIKHAMSFPTAKKIVYSTCSIHAEENE 420

Query: 413 RVVIDLLLDKAVQEWGWRVAPRSEVIPFWPRRGKVEEFEEVFREGAAHDPQELAEGCIRA 472
           RVV+DLLLD  V++WGW+VA +  VIP WPRRGK+EEFEEVFR+  A   Q LA+GCIRA
Sbjct: 421 RVVLDLLLDSKVKQWGWKVAAKESVIPTWPRRGKIEEFEEVFRDDPAK-CQALADGCIRA 479

Query: 473 LPKDDGGIGFFAVCFER 489
           LP+DDGGIGFFAVCFER
Sbjct: 480 LPRDDGGIGFFAVCFER 496

>Kpol_1003.38 s1003 (94479..95969) [1491 bp, 496 aa] {ON}
           (94479..95969) [1491 nt, 497 aa]
          Length = 496

 Score =  687 bits (1774), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/496 (67%), Positives = 396/496 (79%), Gaps = 8/496 (1%)

Query: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLKSCKRYKLKSNPKHVYAVLDSCWKYKPY 60
           M+FYRD+TWVLE +EKE AK++ISGS+Q LVLKSCK+YK+KSNP+HVYA + SCWK KPY
Sbjct: 1   MDFYRDSTWVLEYLEKENAKDKISGSLQGLVLKSCKKYKVKSNPRHVYAAVSSCWKVKPY 60

Query: 61  LEKVMKKARILEDIPKKKGKPLFSRXXXXXXXXXXXISKQKRIQMGKHPIKDYVLKFKSP 120
           LEKVMK++ IL+DIP KKGKP F R           +SK KRIQMGKHPIK Y+LK+K+ 
Sbjct: 61  LEKVMKRSGILDDIPNKKGKPQFERLTLLLLCHDLLLSKSKRIQMGKHPIKTYILKYKTR 120

Query: 121 LHSEMVXXXXXXXVRNLSELVLSEDIANDLPPVRWIRINPLKCYPNGKTEPVLAELRKKF 180
           LHSE+V       VR+LSEL+  E+  +D+ PVRWIRINP++   +   EP++ EL KKF
Sbjct: 121 LHSELVKLKLKLKVRDLSELIEDENSNDDITPVRWIRINPIRAQYDKGLEPIMNELNKKF 180

Query: 181 TLKVEKWSELVPESIYYDEYIPNLFGIHPSDKITAHELYKNGKIIIQDRASCFPAHILNP 240
             +V  WS++VP +IY+D+YIPNLFG+H  DKIT+HELYK GK+IIQDRASCFPAHILNP
Sbjct: 181 PTRVNHWSDIVPGTIYHDDYIPNLFGVHTKDKITSHELYKTGKVIIQDRASCFPAHILNP 240

Query: 241 GPNDIVIDACSAPGNKTTHTASYICSEPPKDSRTRIYAFEKDPERAKILQKMIKIAGCSS 300
           G NDIVIDAC+APGNKTTHTASYI   P KD  T+IYAFEKDPERAKILQ MIK+AGCS+
Sbjct: 241 GKNDIVIDACAAPGNKTTHTASYILGGPKKDQTTQIYAFEKDPERAKILQHMIKVAGCSN 300

Query: 301 NIDVSVGDFTKLATPEKFKDATGFIVDPSCSGSGIFGRKFFDSLNRXXXXXX-----XXX 355
            I V+VGDFTK+ATPEKF++ TGFIVDPSCSGSGIFGRK+ DS+N+              
Sbjct: 301 TIQVNVGDFTKIATPEKFRNVTGFIVDPSCSGSGIFGRKYVDSINKKKQESSGDNGNQDD 360

Query: 356 XXIVPDEQEE--FMAKEELQTRLAKLSSFQFQMVKHAMSFPVAKKIVYSTCSIHAEENER 413
              VPDEQEE   + +++L+TRL+KL+SFQFQ+VKHAMSFP AKKIVYSTCSIHAEENE 
Sbjct: 361 EDAVPDEQEEEFDLKRDDLKTRLSKLASFQFQVVKHAMSFPKAKKIVYSTCSIHAEENEG 420

Query: 414 VVIDLLLDKAVQEWGWRVAPRSEVIPFWPRRGKVEEFEEVFREGAAHDPQELAEGCIRAL 473
           VVIDLLLDK VQEWGW+VAPRSEVIP WPRRG   EF +VFR+      QELA+GCIR L
Sbjct: 421 VVIDLLLDKKVQEWGWKVAPRSEVIPTWPRRGFQAEFSKVFRD-EDEKCQELADGCIRVL 479

Query: 474 PKDDGGIGFFAVCFER 489
           PK+DGGIGFFAVCFER
Sbjct: 480 PKEDGGIGFFAVCFER 495

>KAFR0H03310 Chr8 complement(630597..632063) [1467 bp, 488 aa] {ON}
           Anc_2.286 YNL022C
          Length = 488

 Score =  678 bits (1750), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/491 (67%), Positives = 390/491 (79%), Gaps = 7/491 (1%)

Query: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLKSCKRYKLKSNPKHVYAVLDSCWKYKPY 60
           M FYRDATWVLE IE++ +K RISGS+Q+LVLKSC++YKLK+NPKH+YAVLDSCWKYKP+
Sbjct: 1   MEFYRDATWVLEYIEQQDSKGRISGSLQSLVLKSCQKYKLKTNPKHIYAVLDSCWKYKPF 60

Query: 61  LEKVMKKARILEDIPKKKGKPLFSRXXXXXXXXXXXISKQKRIQMGKHPIKDYVLKFKSP 120
           LEKVM K+ IL+DIPKKKGKP+++R           +SKQKRIQMGKHPIK +VL++KS 
Sbjct: 61  LEKVMSKSGILKDIPKKKGKPVYTRLTLLLLIHDLLLSKQKRIQMGKHPIKLFVLRYKSR 120

Query: 121 LHSEMVXXXXXXXVRNLSELVLSEDIANDLPPVRWIRINPLKCYPNGKTEPVLAELRKKF 180
           LHSE+V       VR+LSELV + D +ND+ PVRW RINPL+C P+     V+ EL KKF
Sbjct: 121 LHSELVKLKLKAKVRDLSELVDTGDSSNDITPVRWFRINPLRC-PDASA--VMKELEKKF 177

Query: 181 TLKVEKWSELVPESIYYDEYIPNLFGIHPSDKITAHELYKNGKIIIQDRASCFPAHILNP 240
             +VE W  +VP SIY+DE+IP LFGIHP DKIT+HELYK G+IIIQDRASCFPAHILNP
Sbjct: 178 PQRVESWEGIVPGSIYHDEFIPYLFGIHPQDKITSHELYKQGRIIIQDRASCFPAHILNP 237

Query: 241 GPNDIVIDACSAPGNKTTHTASYICSEPPKDSRTRIYAFEKDPERAKILQKMIKIAGCSS 300
              D +IDACSAPGNKTTH ASY+      D   RI+AFEKDPERAK+LQKMIK+AGCS 
Sbjct: 238 TLEDKIIDACSAPGNKTTHVASYMFGNGLVDD-VRIFAFEKDPERAKVLQKMIKVAGCSK 296

Query: 301 NIDVSVGDFTKLATPEKFKDATGFIVDPSCSGSGIFGRKFFDSLNRXXXXXXXXXXXIVP 360
            I V+VGDFTKLATP KF D TGFIVDPSCSGSGIFGRK+ DSLNR            VP
Sbjct: 297 QISVNVGDFTKLATPSKFPDVTGFIVDPSCSGSGIFGRKYIDSLNRQKKTQDIVDNG-VP 355

Query: 361 DEQEEFMAKE--ELQTRLAKLSSFQFQMVKHAMSFPVAKKIVYSTCSIHAEENERVVIDL 418
           DEQEE   KE   LQ RL+KLSSFQFQ+VKHAMSFP AK+IVYSTCSIHAEENERV +DL
Sbjct: 356 DEQEEMAEKENGNLQERLSKLSSFQFQVVKHAMSFPKAKRIVYSTCSIHAEENERVALDL 415

Query: 419 LLDKAVQEWGWRVAPRSEVIPFWPRRGKVEEFEEVFREGAAHDPQELAEGCIRALPKDDG 478
           LLD+ V++WGW++A R  VIP WPRRG V EF+E+FR+  A + QE+A+GCIRALP++DG
Sbjct: 416 LLDEKVKQWGWKIAKRESVIPQWPRRGFVSEFQEIFRDKTASECQEMADGCIRALPREDG 475

Query: 479 GIGFFAVCFER 489
           GIGFFA+CFER
Sbjct: 476 GIGFFAICFER 486

>NCAS0G03790 Chr7 complement(699962..701440) [1479 bp, 492 aa] {ON}
           Anc_2.286 YNL022C
          Length = 492

 Score =  665 bits (1716), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/496 (69%), Positives = 391/496 (78%), Gaps = 11/496 (2%)

Query: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLKSCKRYKLKSNPKHVYAVLDSCWKYKPY 60
           M FYRDATWVLE +E+E AK RISGS+QTLV +SCKRYKLK NPKHVYAVLDSCWKYKPY
Sbjct: 1   MEFYRDATWVLEFVEQEDAKGRISGSLQTLVFQSCKRYKLKCNPKHVYAVLDSCWKYKPY 60

Query: 61  LEKVMKKARILEDIPKKKGKPLFSRXXXXXXXXXXXISKQKRIQMGKHPIKDYVLKFKSP 120
           LEKVMKK+ IL++IPK+KGKP++SR            SK KRIQMGK PIK YVLK KS 
Sbjct: 61  LEKVMKKSGILDEIPKRKGKPMYSRLTLMLMCHDLLFSKAKRIQMGKLPIKTYVLKHKSR 120

Query: 121 LHSEMVXXXXXXXVRNLSELVLSEDIANDLPPVRWIRINPLKCYPNGKTEPVLAELRKKF 180
           LHSE+V       V+NLSELV + D  ND+ PVRWIRINPL+C      E    E++KKF
Sbjct: 121 LHSELVKLKLKLKVKNLSELVSNADSENDMTPVRWIRINPLRC----DVEATKLEIQKKF 176

Query: 181 TLKVEKWSELVPESIYYDEYIPNLFGIHPSDKITAHELYKNGKIIIQDRASCFPAHILNP 240
             +VE WS++VP SIYYDEYIPNLFGIHP DKIT+H LYK GKIIIQDRASCFPAHIL+P
Sbjct: 177 PTRVENWSDIVPGSIYYDEYIPNLFGIHPQDKITSHNLYKQGKIIIQDRASCFPAHILHP 236

Query: 241 GPNDIVIDACSAPGNKTTHTASYICSEPPKDSRTRIYAFEKDPERAKILQKMIKIAGCSS 300
             ND+VID C+APGNKTTHTASY+  EP KD + +IYAFEK+PERAKIL KMIK+AGCS 
Sbjct: 237 DENDVVIDGCAAPGNKTTHTASYMIKEPSKDPKIQIYAFEKNPERAKILDKMIKVAGCSK 296

Query: 301 NIDVSVGDFTKLATPEKFKDATGFIVDPSCSGSGIFGRKFFDSLNRXXXXXXXX------ 354
           NI ++VGDFTK+A PEK+KD TGFIVDPSCSGSGIFGRKF DSLNR              
Sbjct: 297 NIKINVGDFTKIALPEKYKDVTGFIVDPSCSGSGIFGRKFIDSLNRKKMNKDEADKKEGD 356

Query: 355 XXXIVPDEQEEFMAKEELQTRLAKLSSFQFQMVKHAMSFPVAKKIVYSTCSIHAEENERV 414
               VPDEQEE+  +E+L+TRL+KLSSFQFQ+VKHAMSFP AKKIVYSTCSIHAEENERV
Sbjct: 357 EEEEVPDEQEEYNKREDLKTRLSKLSSFQFQVVKHAMSFPNAKKIVYSTCSIHAEENERV 416

Query: 415 VIDLLLDKAVQEWGWRVAPRSEVIPFWPRRGK-VEEFEEVFREGAAHDPQELAEGCIRAL 473
           VIDL+LD  V++WGW+VAPRS+VIP WPRRGK  E  E    +G +   +ELA GCIRAL
Sbjct: 417 VIDLMLDSKVKQWGWKVAPRSKVIPTWPRRGKVEEFEEVFREDGNSSKCEELAGGCIRAL 476

Query: 474 PKDDGGIGFFAVCFER 489
           P+ DGGIGFFAVCFER
Sbjct: 477 PRSDGGIGFFAVCFER 492

>TPHA0C03400 Chr3 (747016..748500) [1485 bp, 494 aa] {ON} Anc_2.286
           YNL022C
          Length = 494

 Score =  661 bits (1705), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/493 (64%), Positives = 391/493 (79%), Gaps = 5/493 (1%)

Query: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLKSCKRYKLKSNPKHVYAVLDSCWKYKPY 60
           MNFYRDATWVLE +EKE AK +ISGSMQ++VLKSCK YK++SNPKH+YAV+ SCWKYKPY
Sbjct: 1   MNFYRDATWVLEFLEKEDAKGKISGSMQSIVLKSCKIYKVQSNPKHIYAVMASCWKYKPY 60

Query: 61  LEKVMKKARILEDIPKKKGKPLFSRXXXXXXXXXXXISKQKRIQMGKHPIKDYVLKFKSP 120
           LE +MKK+ IL +IPKK GKP F R            SK KRIQMGKHP+K+YVLK+K+ 
Sbjct: 61  LETIMKKSGILNNIPKKNGKPRFERLTILLLCHDLLFSKSKRIQMGKHPLKEYVLKYKTS 120

Query: 121 LHSEMVXXXXXXXVRNLSELVLSEDIANDLPPVRWIRINPLKCYPNGKTEPVLAELRKKF 180
           L SEMV       +++  +L+ S+D AND+ PVRW RINP++   +   E +L EL KKF
Sbjct: 121 LRSEMVKLQVKMKLKSWGDLISSQDDANDITPVRWFRINPIRTPLSKGVEGILEELEKKF 180

Query: 181 TLKVEKWSELVPESIYYDEYIPNLFGIHPSDKITAHELYKNGKIIIQDRASCFPAHILNP 240
             +V+ WS++   +IY+DE+IPNLFG+H  DKIT+HELYK GKIIIQDRASCFPAH+LNP
Sbjct: 181 PTRVDHWSKIEQGTIYHDEFIPNLFGVHTKDKITSHELYKQGKIIIQDRASCFPAHVLNP 240

Query: 241 GPNDIVIDACSAPGNKTTHTASYICSEPPKDSRTRIYAFEKDPERAKILQKMIKIAGCSS 300
           G +DIVID+C+APGNKTTHTA+YI   P KD + +I+AFEKDPERAK+LQKM++ AGC+ 
Sbjct: 241 GKDDIVIDSCAAPGNKTTHTAAYILGGPSKDQKIQIHAFEKDPERAKVLQKMVRTAGCAR 300

Query: 301 NIDVSVGDFTKLATPEKFKDATGFIVDPSCSGSGIFGRKFFDSLNRXXX---XXXXXXXX 357
            I+V+VGDFTK+ATPEKFK+ TGFIVDPSCSGSGIFGRKF D+LN+              
Sbjct: 301 TIEVNVGDFTKIATPEKFKNVTGFIVDPSCSGSGIFGRKFIDTLNKKKEGEDVDEDDESE 360

Query: 358 IVPDEQ-EEFMAKEELQTRLAKLSSFQFQMVKHAMSFPVAKKIVYSTCSIHAEENERVVI 416
            +P EQ EEF  K++L+TRL+KL+SFQFQ+VKHAM+FP A+K+VYSTCSIHAEENERVVI
Sbjct: 361 SIPVEQDEEFSKKDDLKTRLSKLASFQFQVVKHAMTFPKARKLVYSTCSIHAEENERVVI 420

Query: 417 DLLLDKAVQEWGWRVAPRSEVIPFWPRRGKVEEFEEVFREGAAHDPQELAEGCIRALPKD 476
           DLLLD+ +++ GWRVA R +VIP WPRRG V+EF+EVFR+      +E+A GCIRALPK+
Sbjct: 421 DLLLDETIKKAGWRVANREKVIPTWPRRGWVDEFKEVFRDD-EEKCKEIAGGCIRALPKE 479

Query: 477 DGGIGFFAVCFER 489
           DGGIGFFAVCFER
Sbjct: 480 DGGIGFFAVCFER 492

>TDEL0G02170 Chr7 (427274..428728) [1455 bp, 484 aa] {ON} Anc_2.286
           YNL022C
          Length = 484

 Score =  649 bits (1675), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/492 (64%), Positives = 387/492 (78%), Gaps = 11/492 (2%)

Query: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLKSCKRYKLKSNPKHVYAVLDSCWKYKPY 60
           MNFYRDATWVLE +E+E  K R+SGSMQTLVLKSC+RYKLKS+PKH+YAV+DSCW+YK  
Sbjct: 1   MNFYRDATWVLEYVEQEDEKGRLSGSMQTLVLKSCQRYKLKSDPKHLYAVVDSCWRYKAL 60

Query: 61  LEKVMKKARILEDIPKKKGKPLFSRXXXXXXXXXXXISKQKRIQMGKHPIKDYVLKFKSP 120
           LEK+MK+++I +DIPKKKGKP++SR           ISKQKRIQMGK PIK+YVLK K+ 
Sbjct: 61  LEKIMKRSKIYDDIPKKKGKPIYSRLTLLLMCHDLLISKQKRIQMGKLPIKEYVLKHKTR 120

Query: 121 LHSEMVXXXXXXXVRNLSELVLSEDIANDLPPVRWIRINPLKCYPNGKTEPVLAELRKKF 180
           L+SE+V       V++LSE+V  ED +ND+ PVRWIRINPL+C P    EPVL EL KKF
Sbjct: 121 LNSELVKLKLKLKVKSLSEIVDKEDSSNDVTPVRWIRINPLRC-PKNDVEPVLKELIKKF 179

Query: 181 TLKVEKWSELVPESIYYDEYIPNLFGIHPSDKITAHELYKNGKIIIQDRASCFPAHILNP 240
             +V  WS++   ++YYDE++PNLFG+HP DKIT+HELY+ GKIIIQDR+SCFPAHILNP
Sbjct: 180 PQRVSHWSDITSGTLYYDEFVPNLFGVHPRDKITSHELYRQGKIIIQDRSSCFPAHILNP 239

Query: 241 GPNDIVIDACSAPGNKTTHTASYICSEPPKDSRTRIYAFEKDPERAKILQKMIKIAGCSS 300
           G ND+VIDAC+APGNKTTH A++I  E  ++   +IYAFEKDP RA IL+KM  +AGC  
Sbjct: 240 GKNDVVIDACAAPGNKTTHVAAHILPEYTREQTPKIYAFEKDPARANILKKMTSVAGCGQ 299

Query: 301 NIDVSVGDFTKLATPEKFKDATGFIVDPSCSGSGIFGRKFFDSLNRXXXXXXXXXXXIVP 360
            +++ VGDFTKLA P  FKD TG IVDPSCSGSGIFGRK  DS N             +P
Sbjct: 300 TVEIHVGDFTKLAVPANFKDVTGLIVDPSCSGSGIFGRKSVDSHNVAKKKTETDSE--IP 357

Query: 361 DEQEEFMAKEELQTRLAKLSSFQFQMVKHAMSFPVAKKIVYSTCSIHAEENERVVIDLLL 420
           DE+E+ M  +++  RL+KL+SFQFQ+VKHAMS P AKKIVYSTCSIHAEENERVVIDLLL
Sbjct: 358 DEEEK-MVGDDVANRLSKLASFQFQVVKHAMSMPNAKKIVYSTCSIHAEENERVVIDLLL 416

Query: 421 DKAVQEWGWRVAPRSEVIPFWPRRGKVEEFEEVFREGAAHDP---QELAEGCIRALPKDD 477
           D+ ++EWGW+VA R EVIP WPRRGKV+EFE+VFR+    DP    ELA+GCIRALP++D
Sbjct: 417 DRNIKEWGWKVASREEVIPKWPRRGKVKEFEQVFRD----DPVKCNELADGCIRALPQED 472

Query: 478 GGIGFFAVCFER 489
           GGIGFFAVCF+R
Sbjct: 473 GGIGFFAVCFKR 484

>KNAG0H02000 Chr8 complement(353074..354570) [1497 bp, 498 aa] {ON}
           Anc_2.286 YNL022C
          Length = 498

 Score =  649 bits (1674), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/496 (63%), Positives = 390/496 (78%), Gaps = 7/496 (1%)

Query: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLKSCKRYKLKSNPKHVYAVLDSCWKYKPY 60
           M+FYRDATWVLE IE + AK ++SGS+QTLVL SCKR+K+K+NPKH+YAV+ SCW+YKP+
Sbjct: 1   MDFYRDATWVLESIENQDAKGKLSGSLQTLVLNSCKRFKVKTNPKHIYAVVSSCWRYKPF 60

Query: 61  LEKVMKKARILEDIPKKKGKPLFSRXXXXXXXXXXXISKQKRIQMGKHPIKDYVLKFKSP 120
           LEKVMKK++IL+++P+KKG P+F R           +SK KRIQMGKHPIK +VLK+K+ 
Sbjct: 61  LEKVMKKSKILDEVPQKKGAPVFQRLTLLLLCHDLLLSKSKRIQMGKHPIKMFVLKYKTR 120

Query: 121 LHSEMVXXXXXXXVRNLSELVLSEDIANDLPPVRWIRINPLKCYPNGKTEPVLAELRKKF 180
           L++E+        V++LS+L  S+D+ ND+ PVRW R+NPL+C      + V+ ELRKKF
Sbjct: 121 LNAELAKMKVKLKVKDLSQLTDSDDLTNDITPVRWFRVNPLRCTAEKPVQSVVTELRKKF 180

Query: 181 TLKVEKWSELVPESIYYDEYIPNLFGIHPSDKITAHELYKNGKIIIQDRASCFPAHILNP 240
           T KV+ W ++VP SIYYDEYIPNLF +HP DKIT+HELYK GKIIIQDRASCFPAHILNP
Sbjct: 181 TEKVDSWKDVVPGSIYYDEYIPNLFCVHPQDKITSHELYKQGKIIIQDRASCFPAHILNP 240

Query: 241 GPNDIVIDACSAPGNKTTHTASYICSEPPKDS--RTRIYAFEKDPERAKILQKMIKIAGC 298
             +DIVIDAC+APGNKTTH A+++  +   D   + +IYAFEKDPERA++L KMIKIAGC
Sbjct: 241 KSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPKVQIYAFEKDPERAQVLNKMIKIAGC 300

Query: 299 SSNIDVSVGDFTKLATPEKFKDATGFIVDPSCSGSGIFGRKFFDSLNRXXXXXXXXXXXI 358
           S  I+V VGDFTKLATP+   +  G IVDPSCSGSGIFGRK+ DS+N             
Sbjct: 301 SKEIEVIVGDFTKLATPQACPNVNGLIVDPSCSGSGIFGRKYIDSINHKKTDEEKEEEER 360

Query: 359 ----VPDEQEEFMAKEELQTRLAKLSSFQFQMVKHAMSFPVAKKIVYSTCSIHAEENERV 414
               VP+EQEE    + L+TRL+KLSSFQFQ+VK+A+SFP A K+VYSTCSIHAEENERV
Sbjct: 361 ELDAVPEEQEEQELDDNLKTRLSKLSSFQFQIVKYALSFPQATKVVYSTCSIHAEENERV 420

Query: 415 VIDLLLDKAVQEWGWRVAPRSEVIPFWPRRGKVEEFEEVFREGA-AHDPQELAEGCIRAL 473
           VIDLLLDK V+E GWRVAPRS+VIP W RRG V+EF++VFRE + + + QE+A+GCIRAL
Sbjct: 421 VIDLLLDKKVKESGWRVAPRSKVIPTWERRGLVDEFQQVFREDSESSNCQEMADGCIRAL 480

Query: 474 PKDDGGIGFFAVCFER 489
           P++DGGIGFFAVCFER
Sbjct: 481 PREDGGIGFFAVCFER 496

>TBLA0B06960 Chr2 (1646966..1648492) [1527 bp, 508 aa] {ON}
           Anc_2.286 YNL022C
          Length = 508

 Score =  643 bits (1659), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/506 (61%), Positives = 385/506 (76%), Gaps = 17/506 (3%)

Query: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLKSCKRYKLKSNPKHVYAVLDSCWKYKPY 60
           MNFYRDATWVLE +E +  K R+SGS+ +LV+KSCK++K++SNPKHVYAV++S WK+KP+
Sbjct: 1   MNFYRDATWVLEHLEAQDKKGRVSGSLLSLVVKSCKQFKIQSNPKHVYAVVESAWKFKPF 60

Query: 61  LEKVMKKARILEDIPKKKGKPLFSRXXXXXXXXXXXISKQKRIQMGKHPIKDYVLKFKSP 120
           +E++M K+ IL+DIPKKKGKP++ R            SK +RIQMGKHPIK +VL +K+ 
Sbjct: 61  IERIMAKSGILDDIPKKKGKPIYQRLTLLLLIHDLMFSKSRRIQMGKHPIKTFVLGYKTR 120

Query: 121 LHSEMVXXXXXXXVRNLSELVL----SEDIANDLPPVRWIRINPLKCYPNGKTEPVLAEL 176
           LHSE+V       V NL++++     S D  +D+ PVRWIRINP++      ++ ++ EL
Sbjct: 121 LHSELVKLKLKLKVTNLNDMINANSNSNDSTDDITPVRWIRINPIRIPKQKSSDDIILEL 180

Query: 177 RKKFTLKVEKWSELVPESIYYDEYIPNLFGIHPSDKITAHELYKNGKIIIQDRASCFPAH 236
           RKKFT KV+ WS++ P  IYYDEYIPNLFGI P+DKIT+HELYKNGKIIIQDRASCFPAH
Sbjct: 181 RKKFTTKVDHWSKIKPGCIYYDEYIPNLFGISPTDKITSHELYKNGKIIIQDRASCFPAH 240

Query: 237 ILNPGPNDIVIDACSAPGNKTTHTASYICSEPPKD----SRTRIYAFEKDPERAKILQKM 292
           ILN  P+D +IDAC+APGNKTTH ASYI S          + R++AFEKDPER+KIL KM
Sbjct: 241 ILNATPDDYIIDACAAPGNKTTHVASYIMSLNNDTHINFDKKRVFAFEKDPERSKILDKM 300

Query: 293 IKIAGCSSNIDVSVGDFTKLATPEKFKDATGFIVDPSCSGSGIFGRKFFDSLNRXXXXXX 352
           +KIAGC   ++++ GDFTK+ATPEK+ + TGFIVDPSCSGSGIFGRKF D++N       
Sbjct: 301 VKIAGCKKLVEINTGDFTKIATPEKYPNVTGFIVDPSCSGSGIFGRKFIDNINSNKKLTE 360

Query: 353 XXXXXIVPDEQE---------EFMAKEELQTRLAKLSSFQFQMVKHAMSFPVAKKIVYST 403
                   DEQ+         E  AK++L+TRL+KLSSFQFQ+VKHAMSFP AKKIVYST
Sbjct: 361 KVKDEGEDDEQDIPLEQETLAEAKAKDDLETRLSKLSSFQFQVVKHAMSFPSAKKIVYST 420

Query: 404 CSIHAEENERVVIDLLLDKAVQEWGWRVAPRSEVIPFWPRRGKVEEFEEVFREGAAHDPQ 463
           CSIHAEENERVVIDLLLDK V+EWGW+V PRS  IP W RRG V EFE+VF+   A DP+
Sbjct: 421 CSIHAEENERVVIDLLLDKKVKEWGWKVTPRSLSIPTWERRGLVSEFEDVFKNDPAMDPK 480

Query: 464 ELAEGCIRALPKDDGGIGFFAVCFER 489
           +LAEGCIR LPK+DGGIGFFAVCFER
Sbjct: 481 QLAEGCIRTLPKEDGGIGFFAVCFER 506

>SAKL0E07678g Chr5 complement(621183..622616) [1434 bp, 477 aa] {ON}
           highly similar to uniprot|P53972 Saccharomyces
           cerevisiae YNL022C
          Length = 477

 Score =  638 bits (1646), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/490 (63%), Positives = 382/490 (77%), Gaps = 15/490 (3%)

Query: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLKSCKRYKLKSNPKHVYAVLDSCWKYKPY 60
           MN YRDATWV E +E+E +K +I+GS+QTLVL SCKRYKLK+NPKH+YA++ SCWKYKP+
Sbjct: 1   MNLYRDATWVFEYVEQEESKGKIAGSLQTLVLNSCKRYKLKTNPKHLYAIVHSCWKYKPF 60

Query: 61  LEKVMKKARILEDIPKKKGKPLFSRXXXXXXXXXXXISKQKRIQMGKHPIKDYVLKFKSP 120
           LEK++KK+ IL+DIPKKKG+P FS            +SK KRIQMGKHPIK++VLK K  
Sbjct: 61  LEKILKKSGILKDIPKKKGQPAFSNTTILLLVHDLLLSKNKRIQMGKHPIKEFVLKHKVR 120

Query: 121 LHSEMVXXXXXXXVRNLSELVLSEDIANDLPPVRWIRINPLKCYPNGKTEPVLAELRKKF 180
           L +E+        V NLS+LV  +D +ND+ PVRWIRINP++C  NGK + V  EL+KKF
Sbjct: 121 LQAELAKLKVKLRVTNLSQLV--KDDSNDMTPVRWIRINPVRC--NGKVDDVKGELQKKF 176

Query: 181 TLKVEKWSELVPESIYYDEYIPNLFGIHPSDKITAHELYKNGKIIIQDRASCFPAHILNP 240
             KV  WSE+VP +IY+DE+IPNLFG+HP+DKIT+HELYK GKIIIQDRASCFPAHILNP
Sbjct: 177 PTKVSNWSEIVPGTIYHDEFIPNLFGVHPADKITSHELYKRGKIIIQDRASCFPAHILNP 236

Query: 241 GPNDIVIDACSAPGNKTTHTASYICSEPPKDSRTRIYAFEKDPERAKILQKMIKIAGCSS 300
            P D++ID+CSAPGNKTTH A+++        + +I+AFEKDPERAK LQKMI++AGC  
Sbjct: 237 TPEDVIIDSCSAPGNKTTHVAAHMFDPEFVPKQKQIHAFEKDPERAKTLQKMIQVAGCDK 296

Query: 301 NIDVSVGDFTKLATPEKFKDATGFIVDPSCSGSGIFGRKFFDSLNRXXXXXXXXXXXIVP 360
           +I+V VGDFTKLA P+KF   TGFIVDPSCSGSGIFGRK  D  N            ++P
Sbjct: 297 SIEVHVGDFTKLAKPDKFSQVTGFIVDPSCSGSGIFGRKIIDDTNN--------KNEVLP 348

Query: 361 DEQEEFMA-KEELQTRLAKLSSFQFQMVKHAMSFPVAKKIVYSTCSIHAEENERVVIDLL 419
           +E++E     ++L+TRL KLSSFQFQ++KHAMSFP AKK+VYSTCSIHAEENERVVIDLL
Sbjct: 349 EEEQEKEEMDQDLKTRLTKLSSFQFQILKHAMSFPNAKKLVYSTCSIHAEENERVVIDLL 408

Query: 420 LDKAVQEWGWRVAPRSEVIPFWPRRGKVEEFEEVFREGAAHDPQELAEGCIRALPKDDGG 479
           LD  VQ+WGWRV  R+ VIP W RRG VEEF++V+++      QELA+GCIRALPK+DGG
Sbjct: 409 LDDKVQQWGWRVRKRAGVIPTWSRRGFVEEFQQVYQD--KQQAQELADGCIRALPKEDGG 466

Query: 480 IGFFAVCFER 489
           IGFFAVCFER
Sbjct: 467 IGFFAVCFER 476

>CAGL0M06941g Chr13 complement(706878..708356) [1479 bp, 492 aa]
           {ON} similar to uniprot|P53972 Saccharomyces cerevisiae
           YNL022c
          Length = 492

 Score =  630 bits (1626), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/496 (62%), Positives = 384/496 (77%), Gaps = 12/496 (2%)

Query: 1   MNFYRDATWVLEDIEKEAAKE-RISGSMQTLVLKSCKRYKLKSNPKHVYAVLDSCWKYKP 59
           M FYRD+TWVLE +E +  K  R+SGS+QT+VL+ CK+Y++K+NPKH+YA++ SCWKYKP
Sbjct: 1   MEFYRDSTWVLEYLEGQIEKTGRVSGSLQTIVLRCCKQYRIKTNPKHIYAIVSSCWKYKP 60

Query: 60  YLEKVMKKARILEDIPKKKGKPLFSRXXXXXXXXXXXISKQKRIQMGKHPIKDYVLKFKS 119
           YL+K+MKK+ +L+ IP+KKGKP FS+           +SK KRIQMGKHPIK+YVLK+K+
Sbjct: 61  YLDKIMKKSGLLDAIPRKKGKPAFSKLTLLLLCHDLLLSKAKRIQMGKHPIKNYVLKYKN 120

Query: 120 PLHSEMVXXXXXXXVRNLSELVLSEDIANDLPPVRWIRINPLKCYPNGKTEPVLAELRKK 179
            L++E V       + +LS++V  +D A+D+ PVRWIRINPL+   N  T+ VL EL+KK
Sbjct: 121 ALNAEFVKLKIKLKITDLSQVVDKDDAADDMTPVRWIRINPLRI-SNHDTDQVLNELKKK 179

Query: 180 FTLKVEKWSELVPESIYYDEYIPNLFGIHPSDKITAHELYKNGKIIIQDRASCFPAHILN 239
           F  +V  W +++P SIYYDE+IPNL+GIH SDKIT+HELYK GKIIIQDRASCFPAHILN
Sbjct: 180 FPTRVNTWKDIIPGSIYYDEFIPNLYGIHISDKITSHELYKQGKIIIQDRASCFPAHILN 239

Query: 240 PGPNDIVIDACSAPGNKTTHTASYICSEP--PKDSRTRIYAFEKDPERAKILQKMIKIAG 297
           P  +D+VIDACSAPGNKTTH A++I  +P  P++   +IYAFEKDPERA+ILQKMIK AG
Sbjct: 240 PSADDVVIDACSAPGNKTTHVAAHIFGDPENPRNDNVQIYAFEKDPERAQILQKMIKTAG 299

Query: 298 CSSNIDVSVGDFTKLATPEKFKDATGFIVDPSCSGSGIFGRKFFDSLNRXXXXXXXXXXX 357
           C  NIDV+VGDFT++ATP K+ D TGFI+DPSCSGSGIFGRK  D LN            
Sbjct: 300 CHKNIDVNVGDFTQIATPSKYSDVTGFILDPSCSGSGIFGRKSVDILNNHGKKSNDE--- 356

Query: 358 IVPDEQ--EEFM--AKEELQTRLAKLSSFQFQMVKHAMSFPVAKKIVYSTCSIHAEENER 413
            VPDE   EE      E+L+ RL+KL+SFQFQ+V+HAMSFP AKKIVYSTCSIHAEENER
Sbjct: 357 -VPDENDAEETTDSKNEQLKERLSKLASFQFQIVRHAMSFPNAKKIVYSTCSIHAEENER 415

Query: 414 VVIDLLLDKAVQEWGWRVAPRSEVIPFWPRRGKVEEFEEVFREGAAHDPQELAEGCIRAL 473
           VVIDLLLDK VQ WGWRVA +  V+P W RRG  EEF+EVF +    + QELA+GC+RAL
Sbjct: 416 VVIDLLLDKKVQSWGWRVAKKELVLPTWYRRGFKEEFQEVFTDKTEQECQELADGCVRAL 475

Query: 474 PKDDGGIGFFAVCFER 489
           PK+DGGIGFFAVCF R
Sbjct: 476 PKEDGGIGFFAVCFVR 491

>KLLA0E08361g Chr5 complement(751889..753364) [1476 bp, 491 aa] {ON}
           similar to uniprot|P53972 Saccharomyces cerevisiae
           YNL022C
          Length = 491

 Score =  615 bits (1585), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/496 (61%), Positives = 372/496 (75%), Gaps = 13/496 (2%)

Query: 1   MNFYRDATWVLEDIEKEAAKE-RISGSMQTLVLKSCKRYKLKSNPKHVYAVLDSCWKYKP 59
           M FYRDATWVLE +E+E +K+ R++GS+QTLVL SCKRYKLK+NP+H+YA++ S W+Y+ 
Sbjct: 1   MEFYRDATWVLEFVEQELSKDKRVAGSLQTLVLTSCKRYKLKTNPRHIYAIVSSTWQYRE 60

Query: 60  YLEKVMKKARILEDIPKKKGKPLFSRXXXXXXXXXXXISKQKRIQMGKHPIKDYVLKFKS 119
           YL+K++KK+ ILED+PKKKGKPLF++           +SK KRIQMGKHPIK ++LK ++
Sbjct: 61  YLDKIIKKSGILEDVPKKKGKPLFNKDTIRLLVHDLLLSKSKRIQMGKHPIKTFILKHQT 120

Query: 120 PLHSEMVXXXXXXXVRNLSELVLSEDIANDLPPVRWIRINPLKCYPNGKTEPVLAELRKK 179
            L +E+        V +LS+L+ ++D   D+ PVRWIRINP+      + + VLAEL KK
Sbjct: 121 RLKAELTKLKVKLKVTSLSQLIKTDD-GEDVTPVRWIRINPI--LVKERYDDVLAELNKK 177

Query: 180 FTLKVEKWSELVPESIYYDEYIPNLFGIHPSDKITAHELYKNGKIIIQDRASCFPAHILN 239
           F  +V  W ++VP SIYYDEYIPNLFGIHP DKIT+HE YK GKIIIQDRASCFPAHILN
Sbjct: 178 FPQRVNSWKQIVPGSIYYDEYIPNLFGIHPGDKITSHEQYKRGKIIIQDRASCFPAHILN 237

Query: 240 PGPNDIVIDACSAPGNKTTHTASYICSE-PPKDSRTRIYAFEKDPERAKILQKMIKIAGC 298
           P   D+VIDAC+APGNKTTH A++I  +   K    +I+AFEKDPERAK LQ M+  AGC
Sbjct: 238 PNSTDVVIDACAAPGNKTTHVAAHIFGDVDTKVDSVKIHAFEKDPERAKTLQMMVATAGC 297

Query: 299 SSNIDVSVGDFTKLATPEKFKDATGFIVDPSCSGSGIFGRKFFDSLNRXXXXXXXX---X 355
           +  + + VGDFTKL  PE F++ TGFIVDPSCSGSGIFGRK  D +N             
Sbjct: 298 AKGVKIHVGDFTKLGKPELFQNVTGFIVDPSCSGSGIFGRKAIDKVNLSKTGSSNTDEDQ 357

Query: 356 XXIVPDEQEE--FMAKEELQTRLAKLSSFQFQMVKHAMSFPVAKKIVYSTCSIHAEENER 413
             + P EQE+  F  +++L+ RLAKLSSFQ+Q+VKHAMSFP AKKI YSTCSIHAEENER
Sbjct: 358 TSVEPVEQEKELFEKEQDLKNRLAKLSSFQYQIVKHAMSFPSAKKICYSTCSIHAEENER 417

Query: 414 VVIDLLLDKAVQEWGWRVAPRSEVIPFWPRRGKVEEFEEVFREGAAHDPQELAEGCIRAL 473
           VVIDLLLD  V+EWGW+V  R+ VIP WPRRG   EFEEVF +  A   +ELAEGCIRAL
Sbjct: 418 VVIDLLLDSKVKEWGWKVRKRTGVIPTWPRRGWTSEFEEVFPKEEA---KELAEGCIRAL 474

Query: 474 PKDDGGIGFFAVCFER 489
           PK+DGGIGFFAVCFER
Sbjct: 475 PKEDGGIGFFAVCFER 490

>Ecym_3325 Chr3 (623214..624704) [1491 bp, 496 aa] {ON} similar to
           Ashbya gossypii ADL215W
          Length = 496

 Score =  611 bits (1576), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/491 (62%), Positives = 372/491 (75%), Gaps = 9/491 (1%)

Query: 1   MNFYRDATWVLEDIEKEAAKE-RISGSMQTLVLKSCKRYKLKSNPKHVYAVLDSCWKYKP 59
           M FYRD++WVLE IE+E +K  RISGS+QTLVL+SCKRYKLK+NPKH+YA++ SCWKYK 
Sbjct: 14  MEFYRDSSWVLEYIEQEFSKNSRISGSLQTLVLRSCKRYKLKTNPKHIYAIVSSCWKYKM 73

Query: 60  YLEKVMKKARILEDIPKKKGKPLFSRXXXXXXXXXXXISKQKRIQMGKHPIKDYVLKFKS 119
           YLEK++K + +L D+P KKG+P+FS+           +SK KRI MGKHPIK +VLK + 
Sbjct: 74  YLEKIIKNSGLLADVPLKKGEPVFSKTTIMLLVHDLLLSKNKRIHMGKHPIKAFVLKRQV 133

Query: 120 PLHSEMVXXXXXXXVRNLSELVLSEDIANDLPPVRWIRINPLKCYPNGKTEPVLAELRKK 179
            L  E         V++LSELV  ED   D+ PVRWIRINP +C   GK + VL ELRKK
Sbjct: 134 RLSGEFKKMLVKLKVKSLSELV--EDNDADMSPVRWIRINPFRC--QGKVDDVLKELRKK 189

Query: 180 FTLKVEKWSELVPESIYYDEYIPNLFGIHPSDKITAHELYKNGKIIIQDRASCFPAHILN 239
           F  +V+ W+++VP SIY DEYIPNL+G+HPSDKIT+HELYK GKIIIQDRASCFPA+ILN
Sbjct: 190 FPKQVDDWTQIVPGSIYRDEYIPNLYGVHPSDKITSHELYKRGKIIIQDRASCFPAYILN 249

Query: 240 PGPNDIVIDACSAPGNKTTHTASYICSEPPKDSRTRIYAFEKDPERAKILQKMIKIAGCS 299
           P P+D+VIDACSAPGNKTTH A++I  +    S  +IYAFE+D +RA+IL+KM+  AGC 
Sbjct: 250 PTPHDVVIDACSAPGNKTTHIAAHIFPDG-NASDVKIYAFERDAKRAEILEKMVTSAGCE 308

Query: 300 SNIDVSVGDFTKLATPEKFKDATGFIVDPSCSGSGIFGRKFFDSLNRXXXXXXXXXXXIV 359
           S I +SVGDFT+LA P+ FKD TGFI+DPSCSGSGIFGR+  D  N+             
Sbjct: 309 SCIQISVGDFTQLAKPQMFKDVTGFILDPSCSGSGIFGRQSVDLANKSKLAEKVPNEVFE 368

Query: 360 PDEQEEFMAKEELQTRLAKLSSFQFQMVKHAMSFPVAKKIVYSTCSIHAEENERVVIDLL 419
             + +E    E  +TRLAKLSSFQFQ+VKHAMSFP AKK+VYSTCSIHAEENERVVIDLL
Sbjct: 369 EQDPKEMEQNELYKTRLAKLSSFQFQIVKHAMSFPNAKKLVYSTCSIHAEENERVVIDLL 428

Query: 420 LDKAVQEWGWRVAPRSEVIPFWPRRGKVEEFEEVFREGAAHDPQELAEGCIRALPKDDGG 479
           LD+ ++++GW+VA R  VIP W RRG + EFEEVF    A   QELA+GCIRALPK+DGG
Sbjct: 429 LDQNIKQYGWKVAKRDSVIPAWQRRGILSEFEEVFPHEQA---QELADGCIRALPKEDGG 485

Query: 480 IGFFAVCFERK 490
           IGFFAVCFER+
Sbjct: 486 IGFFAVCFERE 496

>Kwal_27.11532 s27 complement(837572..839011) [1440 bp, 479 aa] {ON}
           YNL022C - Non-essential protein with similarity to S.
           pombe hypothetical protein E349594 [contig 27] FULL
          Length = 479

 Score =  605 bits (1560), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/492 (59%), Positives = 373/492 (75%), Gaps = 17/492 (3%)

Query: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLKSCKRYKLKSNPKHVYAVLDSCWKYKPY 60
           MNFYRDATWVLE +EK  +  R++GS+QTLVL SCK+Y LK+NPKH+YA + SCW+Y  +
Sbjct: 1   MNFYRDATWVLEYVEKAESSGRVAGSLQTLVLNSCKKYNLKTNPKHLYAAVYSCWRYNEF 60

Query: 61  LEKVMKKARILEDIPKKKGKPLFSRXXXXXXXXXXXISKQKRIQMGKHPIKDYVLKFKSP 120
           LEK++KK+ IL+D+PKKKGK +F+             +K KRIQMGKHP+K++VLK K+ 
Sbjct: 61  LEKLLKKSEILKDVPKKKGKEIFNPTTIKLLVHDLLFTKNKRIQMGKHPLKEFVLKHKTR 120

Query: 121 LHSEMVXXXXXXXVRNLSELVLSEDIANDLPPVRWIRINPLKCYPNGKTEPVLAELRKKF 180
           L+SE+V       V +L +L+  +D  ND+ PVRW RINP++C+  GK E V+AEL KKF
Sbjct: 121 LNSELVRLKIKLKVTDLHQLL--KDDRNDMTPVRWFRINPVRCH--GKHEEVMAELAKKF 176

Query: 181 TLKVEKWSELVPESIYYDEYIPNLFGIHPSDKITAHELYKNGKIIIQDRASCFPAHILNP 240
             +V+ W ++VP SIY+DEYIPNLFG+HP DKIT+HELYK GKIIIQDRASCFPAHILNP
Sbjct: 177 PTRVDSWKDVVPGSIYHDEYIPNLFGVHPGDKITSHELYKTGKIIIQDRASCFPAHILNP 236

Query: 241 GPNDIVIDACSAPGNKTTHTASYI-CSEPPKDSRTRIYAFEKDPERAKILQKMIKIAGCS 299
            P+D++IDAC+APGNKTTH A+++  ++ P++    I+AFEKDPERAK L+ M+K AGCS
Sbjct: 237 SPSDVIIDACAAPGNKTTHVAAHMFLNDQPQEP--LIHAFEKDPERAKTLRTMVKTAGCS 294

Query: 300 SNIDVSVGDFTKLATPEKFKDATGFIVDPSCSGSGIFGRKFFDSLNRXXXXXXXXXXXIV 359
             I++ VGDFTKLA P  F + +GFIVDPSCSGSGIFGR+  D  N+            +
Sbjct: 295 KGINIHVGDFTKLAKPSLFPNVSGFIVDPSCSGSGIFGRQIIDDHNKSREEGA------L 348

Query: 360 PDEQEEFMAKE--ELQTRLAKLSSFQFQMVKHAMSFPVAKKIVYSTCSIHAEENERVVID 417
           P ++EE    E  +++ RLAKL+SFQF++VK+A+SFP AKK+VYSTCSIHAEENER+VID
Sbjct: 349 PTQEEERQEIEGKDIKNRLAKLASFQFEIVKYALSFPSAKKLVYSTCSIHAEENERIVID 408

Query: 418 LLLDKAVQEWGWRVAPRSEVIPFWPRRGKVEEFEEVFREGAAHDPQELAEGCIRALPKDD 477
           LLLD  V+EWGWRV  R+  IP WPRRG   EFE+VFREG     +ELAE CIR  PK+D
Sbjct: 409 LLLDSKVKEWGWRVRKRAGAIPTWPRRGFYHEFEDVFREGDT--AKELAEACIRVAPKED 466

Query: 478 GGIGFFAVCFER 489
           GGIGFFAVCFER
Sbjct: 467 GGIGFFAVCFER 478

>ZYRO0A01892g Chr1 (156967..158364) [1398 bp, 465 aa] {ON} similar
           to uniprot|P53972 Saccharomyces cerevisiae YNL022C
          Length = 465

 Score =  602 bits (1553), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/491 (60%), Positives = 369/491 (75%), Gaps = 28/491 (5%)

Query: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLKSCKRYKLKSNPKHVYAVLDSCWKYKPY 60
           M+FYRD+TW+LE +E E  K ++SGS+Q+ VLK+C +YK+K+NPKH+YAV+ SCWKY+ Y
Sbjct: 1   MDFYRDSTWILEYLEAEEKKGKLSGSLQSNVLKTCTKYKVKNNPKHIYAVVASCWKYRMY 60

Query: 61  LEKVMKKARILEDIPKKKGKPLFSRXXXXXXXXXXXISKQKRIQMGKHPIKDYVLKFKSP 120
           LE++M K+ IL+ IP+KKGKP FSR           ISKQKRIQMGKHPIKDYVLK+K+ 
Sbjct: 61  LERIMHKSGILKTIPQKKGKPAFSRLTIMLLCHDLLISKQKRIQMGKHPIKDYVLKYKTR 120

Query: 121 LHSEMVXXXXXXXVRNLSELVLSEDIANDLPPVRWIRINPLKCYPNGKTEPVLAELRKKF 180
           LH+E+V       V+ LSELV  +D  +D  PVRWIRINPLKC        V+ +L KKF
Sbjct: 121 LHAELVKLKVKLKVKELSELV-DQDDGDDATPVRWIRINPLKC----DIPVVVEQLNKKF 175

Query: 181 TLKVEKWSELVPESIYYDEYIPNLFGIHPSDKITAHELYKNGKIIIQDRASCFPAHILNP 240
             +V+ W +L P SIYYDEY+PNLFGIHPS+KIT+H+LYK GK+IIQDRASC PAHILNP
Sbjct: 176 PHRVDHWDQLSPGSIYYDEYVPNLFGIHPSEKITSHDLYKQGKVIIQDRASCLPAHILNP 235

Query: 241 GPNDIVIDACSAPGNKTTHTASYICSEP--PKDSRTRIYAFEKDPERAKILQKMIKIAGC 298
           G  D+V+DAC+APGNKTTH A++I S        + +I+AFEK+P RAK+LQKM   AGC
Sbjct: 236 GKEDVVMDACAAPGNKTTHLAAHIISAAGDSNGGQAQIHAFEKEPARAKVLQKMTSQAGC 295

Query: 299 SSNIDVSVGDFTKLATPEKFKDATGFIVDPSCSGSGIFGRKFFDSLNRXXXXXXXXXXXI 358
            S + + VGDFT+LA P++F+D T  +VDPSCSGSGIFGRK  +S N             
Sbjct: 296 GSLVKIHVGDFTRLAVPDQFEDVTAALVDPSCSGSGIFGRKSLESSN------------- 342

Query: 359 VPDEQEEFMAKEELQTRLAKLSSFQFQMVKHAMSFPVAKKIVYSTCSIHAEENERVVIDL 418
             D Q+     ++LQ RL+KLSSFQFQ+VKHAMS P A+KIVYSTCS+HAEENERVVIDL
Sbjct: 343 --DSQD-----QKLQDRLSKLSSFQFQVVKHAMSMPNARKIVYSTCSVHAEENERVVIDL 395

Query: 419 LLDKAVQEWGWRVAPRSEVIPFWPRRGKVEEFEEVFREGAAHDPQELAEGCIRALPKDDG 478
           LLD  V+EWGW+++PRSEV+P WPRRG  EEFEEVFR+      Q LAE CIRALP++DG
Sbjct: 396 LLDSKVKEWGWQLSPRSEVVPTWPRRGIAEEFEEVFRDDKP-KCQLLAESCIRALPREDG 454

Query: 479 GIGFFAVCFER 489
           GIGFFAVCF+R
Sbjct: 455 GIGFFAVCFQR 465

>KLTH0G10362g Chr7 (876756..878345) [1590 bp, 529 aa] {ON} highly
           similar to uniprot|P53972 Saccharomyces cerevisiae
           YNL022C
          Length = 529

 Score =  593 bits (1530), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/489 (58%), Positives = 362/489 (74%), Gaps = 7/489 (1%)

Query: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLKSCKRYKLKSNPKHVYAVLDSCWKYKPY 60
           MNFYRDATWVLE +E      R++GS+QTLVL SCK+Y+LK+NPKH+YA + SCW+Y  +
Sbjct: 47  MNFYRDATWVLEYVESAEKGGRVAGSLQTLVLNSCKKYQLKTNPKHIYAAVYSCWRYNEF 106

Query: 61  LEKVMKKARILEDIPKKKGKPLFSRXXXXXXXXXXXISKQKRIQMGKHPIKDYVLKFKSP 120
           L+K++K++ IL+DIPKKKGK +F+             SK KRIQMGKHP+K++VLK+K+ 
Sbjct: 107 LDKLLKRSGILKDIPKKKGKEVFNPTTIKLLVHDLLFSKNKRIQMGKHPLKEFVLKYKAR 166

Query: 121 LHSEMVXXXXXXXVRNLSELVLSEDIANDLPPVRWIRINPLKCYPNGKTEPVLAELRKKF 180
           L SE+V       V +L +L+  +D  ND+ PVRW R+NP++C    K+E +L EL KKF
Sbjct: 167 LSSELVRLKIKLKVTDLQQLL--KDDRNDMTPVRWFRLNPIRC--GAKSEDILQELSKKF 222

Query: 181 TLKVEKWSELVPESIYYDEYIPNLFGIHPSDKITAHELYKNGKIIIQDRASCFPAHILNP 240
             +V  W+ + P  IY+DEYIP LFG+HP+DKIT+HELYK GK+IIQDRASCFPAHILN 
Sbjct: 223 PTRVNSWTNIAPGCIYHDEYIPGLFGVHPADKITSHELYKTGKVIIQDRASCFPAHILNA 282

Query: 241 GPNDIVIDACSAPGNKTTHTASYICSEPPKDSRTRIYAFEKDPERAKILQKMIKIAGCSS 300
              D++IDAC+APGNKTTH A++I  +   +S  RI+AFEKDPERAK L+ MI  AGC+ 
Sbjct: 283 SSEDLIIDACAAPGNKTTHVAAHIFQDQAVES-VRIHAFEKDPERAKTLRTMINTAGCTK 341

Query: 301 NIDVSVGDFTKLATPEKFKDATGFIVDPSCSGSGIFGRKFFDSLNRXXXXXXXXXXXIVP 360
            I+V VGDFT+LA P KF D TGFI+DPSCSGSGIFGRK  D  N+              
Sbjct: 342 GIEVHVGDFTQLAKPGKFPDVTGFILDPSCSGSGIFGRKMIDDRNKSKADGASPVEEEEK 401

Query: 361 DEQEEFMAKEELQTRLAKLSSFQFQMVKHAMSFPVAKKIVYSTCSIHAEENERVVIDLLL 420
           +E+ E ++ ++L+ RL KL+SFQF++VKHAMSFP AKK+VYSTCS+HAEENER+V+DLLL
Sbjct: 402 EEEREDISDKDLKNRLEKLASFQFEIVKHAMSFPSAKKLVYSTCSVHAEENERIVVDLLL 461

Query: 421 DKAVQEWGWRVAPRSEVIPFWPRRGKVEEFEEVFREGAAHDPQELAEGCIRALPKDDGGI 480
           D  V+EWGWRV  R+ VIP W RRG  +EFEEVFR+      +ELAE CIR  PK+DGGI
Sbjct: 462 DSKVKEWGWRVRKRAGVIPTWSRRGFYKEFEEVFRD--EDTAKELAEACIRVAPKEDGGI 519

Query: 481 GFFAVCFER 489
           GFFAVCFER
Sbjct: 520 GFFAVCFER 528

>ADL215W Chr4 (326584..328038) [1455 bp, 484 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL022C
          Length = 484

 Score =  575 bits (1483), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/493 (58%), Positives = 361/493 (73%), Gaps = 12/493 (2%)

Query: 1   MNFYRDATWVLEDIEKE-AAKERISGSMQTLVLKSCKRYKLKSNPKHVYAVLDSCWKYKP 59
           M FYRDA+WVLE IE+E A K +++GS+ +LVL+S K+YKLKS+ +HVYA++ S WKYK 
Sbjct: 1   MEFYRDASWVLEYIEQEFARKSKVAGSLHSLVLQSHKKYKLKSDVRHVYAIVASFWKYKA 60

Query: 60  YLEKVMKKARILEDIPKKKGKPLFSRXXXXXXXXXXXISKQKRIQMGKHPIKDYVLKFKS 119
           YL+++++K+ +L+D+P+KKG+P F R           +SK+KRI MGKHP+K +VLK ++
Sbjct: 61  YLDRIIEKSGLLKDVPRKKGEPAFKRSTLGLVVHDLLLSKKKRIHMGKHPLKAFVLKHQT 120

Query: 120 PLHSEMVXXXXXXXVRNLSELVLSEDIANDLPPVRWIRINPLKCYPNGKTEPVLAELRKK 179
            L  E         V +LS  VL +D   D  PVRWIR+NP +    G+ E VL EL+KK
Sbjct: 121 RLRGEYAKQLVKLGVADLS--VLVQDEREDATPVRWIRLNPFRI--RGQREEVLQELQKK 176

Query: 180 FTLKVEKWSELVPESIYYDEYIPNLFGIHPSDKITAHELYKNGKIIIQDRASCFPAHILN 239
           F  +V  W EL P SIY DEY+  L+G+HP+DKIT+HELYK GKIIIQDRASCFPA IL 
Sbjct: 177 FPRRVADWRELTPGSIYEDEYVAGLYGVHPADKITSHELYKRGKIIIQDRASCFPAQILA 236

Query: 240 PGPNDIVIDACSAPGNKTTHTASYICSEPPKDSRTRIYAFEKDPERAKILQKMIKIAGCS 299
           PG +D++IDAC+APGNKTTH A++I  E   D   +I+AFE+DP+RAK L+KMI  AGC 
Sbjct: 237 PGRSDVIIDACAAPGNKTTHVAAHIFPEGGAD-HAQIHAFERDPQRAKTLRKMIATAGCD 295

Query: 300 SNIDVSVGDFTKLATPEKFKDATGFIVDPSCSGSGIFGRKFFDSLNRXXXXXXXXXXXIV 359
           + I+V VGDFT+ A PE FK+ TGFIVDPSCSGSGIFGR+  D+               V
Sbjct: 296 NAIEVHVGDFTRDAQPEIFKNVTGFIVDPSCSGSGIFGRQLVDATQETQKGTETDPSADV 355

Query: 360 PDEQ--EEFMAKEELQTRLAKLSSFQFQMVKHAMSFPVAKKIVYSTCSIHAEENERVVID 417
           P+E+  E   +  EL+ RLAKLSSFQFQ+VKHAMSFP AKK++YSTCS+HAEENERVVID
Sbjct: 356 PEEETFEATKSAVELKNRLAKLSSFQFQIVKHAMSFPSAKKLIYSTCSVHAEENERVVID 415

Query: 418 LLLDKAVQEWGWRVAPRSEVIPFWPRRGKVEEFEEVFREGAAHDPQELAEGCIRALPKDD 477
           LLLD  VQ+ GW+VA RS+VIP WPRRG   EFEEVF + A    +ELA GCIR LPK+D
Sbjct: 416 LLLDSKVQKGGWKVASRSKVIPAWPRRGHQAEFEEVFPDQA----EELAGGCIRVLPKED 471

Query: 478 GGIGFFAVCFERK 490
           GGIGFFAVCFER+
Sbjct: 472 GGIGFFAVCFERE 484

>ZYRO0A01562g Chr1 (128145..129998) [1854 bp, 617 aa] {ON} similar
           to uniprot|P40991 Saccharomyces cerevisiae YNL061W NOP2
           Probable RNA m(5)C methyltransferase essential for
           processing and maturation of 27S pre-rRNA and large
           ribosomal subunit biogenesis localized to the nucleolus
          Length = 617

 Score = 65.9 bits (159), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 55/203 (27%), Positives = 93/203 (45%), Gaps = 29/203 (14%)

Query: 213 ITAHELYKNGKIIIQDRASCFPAHILNPGPNDIVIDACSAPGNKTTHTASYICSEPPKDS 272
           I A   Y  G  I+Q  +S  P   L+P  N+ ++D  +APG KTT+ ++ +       +
Sbjct: 317 IGATPEYLAGNYILQAASSFLPVIALDPQENERILDMAAAPGGKTTYISALM------KN 370

Query: 273 RTRIYAFEKDPERAKILQKMIKIAGCSSNIDVSVGDFTKLATPEKFKDATGFIVDPSCSG 332
              ++A + +  R K L   I   GC++ I   V ++     P         ++D  CSG
Sbjct: 371 TGCVFANDANKSRTKSLVANIHRLGCTNTI---VCNYDAREFPRVIGGFDRILLDAPCSG 427

Query: 333 SGIFGRKFFDSLNRXXXXXXXXXXXIVPDEQEEFMAKEELQTRLAKLSSFQFQMVKHAMS 392
           +G+ G+     ++R                +++FM    LQ +L  L S    +  H+ +
Sbjct: 428 TGVIGKDQSVKVSRT---------------EKDFMQIPHLQKQL--LLSAIDSVDSHSKT 470

Query: 393 FPVAKKIVYSTCSIHAEENERVV 415
             +   IVYSTCS+  EE+E+VV
Sbjct: 471 GGI---IVYSTCSVAVEEDEQVV 490

>SAKL0E08624g Chr5 complement(704579..706414) [1836 bp, 611 aa] {ON}
           similar to uniprot|P40991 Saccharomyces cerevisiae
           YNL061W NOP2 Probable RNA m(5)C methyltransferase
           essential for processing and maturation of 27S pre-rRNA
           and large ribosomal subunit biogenesis localized to the
           nucleolus
          Length = 611

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 57/203 (28%), Positives = 93/203 (45%), Gaps = 29/203 (14%)

Query: 213 ITAHELYKNGKIIIQDRASCFPAHILNPGPNDIVIDACSAPGNKTTHTASYICSEPPKDS 272
           I A   Y  G  I+Q  +S  P   L+P  N+ ++D  +APG KTT+ ++ +       +
Sbjct: 310 IGATPEYLAGHYILQAASSFLPVIALDPQENERILDMAAAPGGKTTYISALM------KN 363

Query: 273 RTRIYAFEKDPERAKILQKMIKIAGCSSNIDVSVGDFTKLATPEKFKDATGFIVDPSCSG 332
              ++A + +  R K L   I   GC + I   V ++     P+        ++D  CSG
Sbjct: 364 TGCVFANDANKARTKSLIANIHRLGCHNTI---VCNYDAREFPKVIGGFDRILLDAPCSG 420

Query: 333 SGIFGRKFFDSLNRXXXXXXXXXXXIVPDEQEEFMAKEELQTRLAKLSSFQFQMVKHAMS 392
           +G+ G+     ++R                +++FM    LQ +L  LS+    +  H+ +
Sbjct: 421 TGVIGKDQSVKVSRT---------------EKDFMQIPHLQKQLI-LSAID-SVDAHSKT 463

Query: 393 FPVAKKIVYSTCSIHAEENERVV 415
             V   IVYSTCS+  EENE VV
Sbjct: 464 GGV---IVYSTCSVAVEENEAVV 483

>ADL254W Chr4 (253602..255413) [1812 bp, 603 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL061W (NOP2)
          Length = 603

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 56/199 (28%), Positives = 89/199 (44%), Gaps = 33/199 (16%)

Query: 219 YKNGKIIIQDRASCFPAHILNPGPNDIVIDACSAPGNKTTHTASYICSEPPKDSRTRIYA 278
           Y  G  I+Q  +S  P   L+P  N+ ++D  +APG KTT+ ++ +       +   ++A
Sbjct: 309 YLAGHYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMM------KNTGCVFA 362

Query: 279 FEKDPERAKILQKMIKIAGCSSNIDVSVGDFTKLATPEKFKDATGFIVDPSCSGSGIFGR 338
            + +  R K L   I   GC++ I   V ++     P+        ++D  CSG+G+ G+
Sbjct: 363 NDANKARTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVIGK 419

Query: 339 KFFDSLNRXXXXXXXXXXXIVPDEQEEFMAKEELQTRLAKLSSFQF--QMVKHAMSFPVA 396
                +NR                +++FM    LQ +L  LS+        KH       
Sbjct: 420 DQSVKVNRT---------------EKDFMQIPHLQKQLI-LSAIDSVDSNSKHGGV---- 459

Query: 397 KKIVYSTCSIHAEENERVV 415
             IVYSTCS+  EENE VV
Sbjct: 460 --IVYSTCSVAVEENEAVV 476

>CAGL0J10032g Chr10 (983405..985264) [1860 bp, 619 aa] {ON} highly
           similar to uniprot|P40991 Saccharomyces cerevisiae
           YNL061w NOP2
          Length = 619

 Score = 63.5 bits (153), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 55/205 (26%), Positives = 92/205 (44%), Gaps = 33/205 (16%)

Query: 213 ITAHELYKNGKIIIQDRASCFPAHILNPGPNDIVIDACSAPGNKTTHTASYICSEPPKDS 272
           I A   Y  G  I+Q  +S  P   L+P  N+ V+D  SAPG KTT+ ++ +       +
Sbjct: 319 IGATPEYLAGNYILQAASSFLPVVALDPQENERVLDMASAPGGKTTYISALM------KN 372

Query: 273 RTRIYAFEKDPERAKILQKMIKIAGCSSNIDVSVGDFTKLATPEKFKDATGFIVDPSCSG 332
              ++A + + +R K L   I   GC++ I   V ++     P+        ++D  CSG
Sbjct: 373 TGCVFANDANKKRTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRVLLDAPCSG 429

Query: 333 SGIFGRKFFDSLNRXXXXXXXXXXXIVPDEQEEFMAKEELQTR--LAKLSSFQFQMVKHA 390
           +G+ G+     ++R                +++F+    LQ +  L+ + S      K  
Sbjct: 430 TGVIGKDQSVKVSRT---------------EKDFIQIPHLQKQLLLSAIDSVDANSKKGG 474

Query: 391 MSFPVAKKIVYSTCSIHAEENERVV 415
           +       IVYSTCS+  EE+E VV
Sbjct: 475 V-------IVYSTCSVAVEEDEAVV 492

>AFR179C Chr6 complement(766458..768560) [2103 bp, 700 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBL024W
           (NCL1)
          Length = 700

 Score = 63.5 bits (153), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 75/295 (25%), Positives = 118/295 (40%), Gaps = 59/295 (20%)

Query: 222 GKIIIQDRASCFPAHILNPGPNDIVIDACSAPGNKTTHTASYICSEPPKDSRTRIYAFEK 281
           G I  Q+  S  P ++L   P+  V+D C+APG+KT      + +  P+ S   + A + 
Sbjct: 146 GNISRQEAVSMIPPNVLGVEPHHSVLDMCAAPGSKTAQLVEALHANGPEPS-GFVVANDA 204

Query: 282 DPERAKILQKMIKIAGCSSNIDVSVGD---FTKLATPEKFKDATGF---IVDPSCSGSGI 335
           D  R+ +L   +K    S+N+ V   D   F ++ T E  KD   F   + D  CSG G 
Sbjct: 205 DYRRSHMLVHQLKRLN-SANLIVVNHDAQFFPRIKTAEGSKDFLKFDRVLCDVPCSGDGT 263

Query: 336 FGRKFFDSLNRXXXXXXXXXXXIVPDEQEEFMAKEELQTRLAKLSSFQFQMVKHAMS-FP 394
             RK  +                        + K+        L + Q  ++   ++   
Sbjct: 264 M-RKNIN------------------------VWKDWGTGSGLGLHTVQLNILNRGLTLLK 298

Query: 395 VAKKIVYSTCSIHAEENERVVIDLLLDKAVQEWGWRVA-----------PRSEVIPFWPR 443
              ++VYSTCS++  ENE VV       A+++WG ++             RS  I  WP 
Sbjct: 299 NGGRLVYSTCSLNPIENEAVVA-----AALRKWGAKIKLVNCDDQLLGLVRSTGISSWPV 353

Query: 444 RGKVEEFEEVFREG--------AAHDPQELA-EGCIRALPKDDGGIGFFAVCFER 489
             K  E +    +G        +  + +E   E CIR  P      GFF   FE+
Sbjct: 354 LDKNYEEKNKGDDGTIATWFPPSEEEAKEFNLENCIRVYPHQQNTGGFFISVFEK 408

>Kpol_1003.15 s1003 (41683..43584) [1902 bp, 633 aa] {ON}
           (41683..43584) [1902 nt, 634 aa]
          Length = 633

 Score = 63.2 bits (152), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 69/270 (25%), Positives = 120/270 (44%), Gaps = 45/270 (16%)

Query: 147 ANDLPPVRWIRINPLKCYPNGKTEPVLAELRKKFTLK-VEKWSELVPESIYYDEYIPNLF 205
           AN++P    IR N LK     + +   A + K   L+ +  W+++  +   +D  +P   
Sbjct: 279 ANEVPRPISIRTNTLKTR---RRDLAQALVNKGVNLQPIGAWTKVGLQ--IFDSQVP--- 330

Query: 206 GIHPSDKITAHELYKNGKIIIQDRASCFPAHILNPGPNDIVIDACSAPGNKTTHTASYIC 265
                  I A   Y  G+ I+Q  +S  P   L+P  N+ V+D  +APG KTT+ ++ + 
Sbjct: 331 -------IGATSEYLAGQYILQAASSFLPVVALDPQENERVLDMAAAPGGKTTYISALM- 382

Query: 266 SEPPKDSRTRIYAFEKDPERAKILQKMIKIAGCSSNIDVSVGDFTKLATPEKFKDATGFI 325
                 +   ++A + +  R K L   I   GC++ I   V ++     P+        +
Sbjct: 383 -----KNTGCVFANDANKARTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRIL 434

Query: 326 VDPSCSGSGIFGRKFFDSLNRXXXXXXXXXXXIVPDEQEEFMAKEELQTRLAKLSSFQFQ 385
           +D  CSG+G+ G+      +R                +++F+    LQ +L  L S    
Sbjct: 435 LDAPCSGTGVIGKDQSVKSSRT---------------EKDFIQIPHLQKQL--LLSAIDS 477

Query: 386 MVKHAMSFPVAKKIVYSTCSIHAEENERVV 415
           +  ++ +  V   IVYSTCS+  EE+E VV
Sbjct: 478 VDANSKTGGV---IVYSTCSVAVEEDEAVV 504

>KAFR0J00970 Chr10 (174873..176705) [1833 bp, 610 aa] {ON} Anc_2.247
           YNL061W
          Length = 610

 Score = 63.2 bits (152), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 57/203 (28%), Positives = 96/203 (47%), Gaps = 29/203 (14%)

Query: 213 ITAHELYKNGKIIIQDRASCFPAHILNPGPNDIVIDACSAPGNKTTHTASYICSEPPKDS 272
           I A   Y  G+ I+Q  +S  P   L+P  N+ ++D  SAPG KTT+ ++ +     K++
Sbjct: 311 IGATPEYLAGQYILQAASSFLPVIALDPQENERILDMASAPGGKTTYISALM-----KNT 365

Query: 273 RTRIYAFEKDPERAKILQKMIKIAGCSSNIDVSVGDFTKLATPEKFKDATGFIVDPSCSG 332
              ++A + +  R K L   I   GC++ I   V ++     P+        ++D  CSG
Sbjct: 366 GC-VFANDANKNRTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSG 421

Query: 333 SGIFGRKFFDSLNRXXXXXXXXXXXIVPDEQEEFMAKEELQTRLAKLSSFQFQMVKHAMS 392
           +G+ G+     ++R                +++F+    LQ +L  L S    +  ++ S
Sbjct: 422 TGVIGKDQSVKVSRT---------------EKDFIQIPHLQKQL--LLSAIDSVDANSKS 464

Query: 393 FPVAKKIVYSTCSIHAEENERVV 415
             V   IVYSTCS+  EE+E VV
Sbjct: 465 GGV---IVYSTCSVAVEEDEAVV 484

>KLLA0F03399g Chr6 (319007..320866) [1860 bp, 619 aa] {ON} similar
           to uniprot|P40991 Saccharomyces cerevisiae YNL061W NOP2
           Probable RNA m(5)C methyltransferase essential for
           processing and maturation of 27S pre-rRNA and large
           ribosomal subunit biogenesis localized to the nucleolus
          Length = 619

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 55/203 (27%), Positives = 93/203 (45%), Gaps = 29/203 (14%)

Query: 213 ITAHELYKNGKIIIQDRASCFPAHILNPGPNDIVIDACSAPGNKTTHTASYICSEPPKDS 272
           I A   Y  G  I+Q  +S  P   L+P  N+ ++D  +APG KTT+ ++ +       +
Sbjct: 313 IGATPEYLAGHYILQAASSFLPVIALDPQENERILDMAAAPGGKTTYISAMM------KN 366

Query: 273 RTRIYAFEKDPERAKILQKMIKIAGCSSNIDVSVGDFTKLATPEKFKDATGFIVDPSCSG 332
              ++A + +  R K L   I   GC++ I   V ++     P+        ++D  CSG
Sbjct: 367 TGCVFANDANKARTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSG 423

Query: 333 SGIFGRKFFDSLNRXXXXXXXXXXXIVPDEQEEFMAKEELQTRLAKLSSFQFQMVKHAMS 392
           +G+ G+     ++R                +++FM    LQ +L  L S    +  ++ +
Sbjct: 424 TGVIGKDQSVKVSRT---------------EKDFMQIPHLQKQL--LLSAIDSVDSNSKT 466

Query: 393 FPVAKKIVYSTCSIHAEENERVV 415
             V   IVYSTCS+  +ENE VV
Sbjct: 467 GGV---IVYSTCSVAVDENEAVV 486

>TPHA0C03150 Chr3 (697508..699334) [1827 bp, 608 aa] {ON} Anc_2.247
           YNL061W
          Length = 608

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 53/203 (26%), Positives = 89/203 (43%), Gaps = 29/203 (14%)

Query: 213 ITAHELYKNGKIIIQDRASCFPAHILNPGPNDIVIDACSAPGNKTTHTASYICSEPPKDS 272
           I A   Y  G+ I+Q  +S  P   L+P  N+ V+D  +APG KTT+ ++ +       +
Sbjct: 311 IGATSEYLAGQYILQAASSFLPVVALDPQLNERVLDMAAAPGGKTTYISALM------KN 364

Query: 273 RTRIYAFEKDPERAKILQKMIKIAGCSSNIDVSVGDFTKLATPEKFKDATGFIVDPSCSG 332
              ++A + +  R K L   I   GC++ I   V ++     P+        ++D  CSG
Sbjct: 365 TGCVFANDANKARTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSG 421

Query: 333 SGIFGRKFFDSLNRXXXXXXXXXXXIVPDEQEEFMAKEELQTRLAKLSSFQFQMVKHAMS 392
           +G+ G+     ++R                +++F+    LQ +L   +            
Sbjct: 422 TGVIGKDQSVKVSRT---------------EKDFIQIPHLQKQLLLSAIDSVDANSKTGG 466

Query: 393 FPVAKKIVYSTCSIHAEENERVV 415
           F     IVYSTCS+  EE+E VV
Sbjct: 467 F-----IVYSTCSVAVEEDEAVV 484

>TBLA0E03850 Chr5 (967569..969467) [1899 bp, 632 aa] {ON} Anc_2.247
           YNL061W
          Length = 632

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 56/203 (27%), Positives = 94/203 (46%), Gaps = 29/203 (14%)

Query: 213 ITAHELYKNGKIIIQDRASCFPAHILNPGPNDIVIDACSAPGNKTTHTASYICSEPPKDS 272
           I A   Y  G  I+Q  +S  P   L+P  N+ V+D  SAPG KTT+ ++ +       +
Sbjct: 330 IGATPEYLAGNYILQAASSFLPVIALDPQENERVLDMASAPGGKTTYISALM------KN 383

Query: 273 RTRIYAFEKDPERAKILQKMIKIAGCSSNIDVSVGDFTKLATPEKFKDATGFIVDPSCSG 332
              I+A + +  R K L   I   GC++ I   V ++     P+        ++D  CSG
Sbjct: 384 TGCIFANDANKARTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSG 440

Query: 333 SGIFGRKFFDSLNRXXXXXXXXXXXIVPDEQEEFMAKEELQTRLAKLSSFQFQMVKHAMS 392
           +G+ G+     ++R                +++F+    LQ +L  LS+    +  ++ +
Sbjct: 441 TGVIGKDQSVKVSRT---------------EKDFIQIPHLQKQLI-LSAID-SLDSNSKN 483

Query: 393 FPVAKKIVYSTCSIHAEENERVV 415
             V   +VYSTCS+  EE+E VV
Sbjct: 484 GGV---LVYSTCSVAVEEDEAVV 503

>Ecym_2353 Chr2 complement(691422..693494) [2073 bp, 690 aa] {ON}
           similar to Ashbya gossypii AFR179C
          Length = 690

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 76/295 (25%), Positives = 121/295 (41%), Gaps = 59/295 (20%)

Query: 222 GKIIIQDRASCFPAHILNPGPNDIVIDACSAPGNKTTHTASYICSEPPKDSRTRIYAFEK 281
           G I  Q+  S  P  +L   P   V+D C+APG+KT      + ++ P+ S   + A + 
Sbjct: 145 GNISRQEAVSMIPPLLLEVEPQHTVLDMCAAPGSKTAQLIEALHAKGPEPS-GFVVANDA 203

Query: 282 DPERAKILQKMIKIAGCSSNIDVSVGD---FTKLATPEKFKDATGF---IVDPSCSGSGI 335
           D  R+ +L   +K    S+N+ V   D   F ++ T E  KD   F   + D  CSG G 
Sbjct: 204 DYRRSHMLVHQLKRLN-SANLIVVNHDAQFFPRIKTSEGSKDFLRFDRVLCDVPCSGDGT 262

Query: 336 FGRKFFDSLNRXXXXXXXXXXXIVPDEQEEFMAKEELQTRLAKLSSFQFQMVKHAMS-FP 394
             RK  +                        + K+        L + Q  ++   ++   
Sbjct: 263 M-RKNIN------------------------VWKDWATASGLGLHTVQVNILNRGLNLLK 297

Query: 395 VAKKIVYSTCSIHAEENERVVIDLLLDKAVQEWGWRVAP-----------RSEVIPFWPR 443
              ++VYSTCS++  ENE VV       A+++WG ++             RS+ I  WP 
Sbjct: 298 DGGRLVYSTCSLNPIENEAVVA-----AALRKWGDKIKLVECGDKLPGLIRSQGISQWPV 352

Query: 444 RGKVEEFEEVFREG--AAHDP---QELA----EGCIRALPKDDGGIGFFAVCFER 489
             K    ++   EG  A+  P   +E++    E C+R  P      GFF   FE+
Sbjct: 353 YDKGFNAKQRSDEGVDASWFPPTDEEISKFHLESCVRVYPHQQNTGGFFIAVFEK 407

>NDAI0D01050 Chr4 (236435..238312) [1878 bp, 625 aa] {ON} Anc_2.247
           YNL061W
          Length = 625

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 56/205 (27%), Positives = 94/205 (45%), Gaps = 33/205 (16%)

Query: 213 ITAHELYKNGKIIIQDRASCFPAHILNPGPNDIVIDACSAPGNKTTHTASYICSEPPKDS 272
           I A   Y  G  I+Q  +S  P   L+P  N+ ++D  +APG KTT+ ++ +     K++
Sbjct: 323 IGATPEYLAGNYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISALM-----KNT 377

Query: 273 RTRIYAFEKDPERAKILQKMIKIAGCSSNIDVSVGDFTKLATPEKFKDATGFIVDPSCSG 332
            T ++A + +  R K L   I   GC++ I   V ++     P+        ++D  CSG
Sbjct: 378 GT-VFANDANKNRTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSG 433

Query: 333 SGIFGRKFFDSLNRXXXXXXXXXXXIVPDEQEEFMAKEELQTR--LAKLSSFQFQMVKHA 390
           +G+ G+     ++R                +++F+    LQ +  L+ + S      KH 
Sbjct: 434 TGVIGKDQSVKVSRT---------------EKDFIQIPHLQKQLLLSAIDSVDCNS-KH- 476

Query: 391 MSFPVAKKIVYSTCSIHAEENERVV 415
                   IVYSTCS+  EE+E VV
Sbjct: 477 -----GGIIVYSTCSVAVEEDEAVV 496

>KNAG0I01870 Chr9 complement(366800..368689) [1890 bp, 629 aa] {ON}
           Anc_2.247 YNL061W
          Length = 629

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 53/205 (25%), Positives = 91/205 (44%), Gaps = 33/205 (16%)

Query: 213 ITAHELYKNGKIIIQDRASCFPAHILNPGPNDIVIDACSAPGNKTTHTASYICSEPPKDS 272
           I A   Y  G  I+Q  +S  P   L+P  N+ ++D  +APG KTT+ ++ +       +
Sbjct: 328 IGATPEYLAGHYILQAASSFLPVIALDPQENERILDMAAAPGGKTTYISAMM------KN 381

Query: 273 RTRIYAFEKDPERAKILQKMIKIAGCSSNIDVSVGDFTKLATPEKFKDATGFIVDPSCSG 332
              ++A + +  R K L   I   GC++ I   V ++     P+        ++D  CSG
Sbjct: 382 TGCVFANDANKNRTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSG 438

Query: 333 SGIFGRKFFDSLNRXXXXXXXXXXXIVPDEQEEFMAKEELQTR--LAKLSSFQFQMVKHA 390
           +G+ G+     ++R                +++F+    LQ +  L+ + S      K  
Sbjct: 439 TGVIGKDQSVKVSRT---------------EKDFIQIPHLQKQLLLSAIDSVDANSKKGG 483

Query: 391 MSFPVAKKIVYSTCSIHAEENERVV 415
           +       IVYSTCS+  EE+E VV
Sbjct: 484 I-------IVYSTCSVAVEEDEAVV 501

>Ecym_3284 Chr3 (537227..539047) [1821 bp, 606 aa] {ON} similar to
           Ashbya gossypii ADL254W
          Length = 606

 Score = 60.1 bits (144), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 54/203 (26%), Positives = 93/203 (45%), Gaps = 29/203 (14%)

Query: 213 ITAHELYKNGKIIIQDRASCFPAHILNPGPNDIVIDACSAPGNKTTHTASYICSEPPKDS 272
           I A   Y  G  I+Q  +S  P   L+P  N+ ++D  +APG KTT+ ++ +       +
Sbjct: 305 IGATPEYLAGHYILQAASSFLPVIALDPQENERILDMAAAPGGKTTYISALM------KN 358

Query: 273 RTRIYAFEKDPERAKILQKMIKIAGCSSNIDVSVGDFTKLATPEKFKDATGFIVDPSCSG 332
              ++A + +  R K L   I   GC++ I   V ++     P+        ++D  CSG
Sbjct: 359 TGCVFANDANKARTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSG 415

Query: 333 SGIFGRKFFDSLNRXXXXXXXXXXXIVPDEQEEFMAKEELQTRLAKLSSFQFQMVKHAMS 392
           +G+  +     ++R                +++FM    LQ +L  LS+    +  ++ +
Sbjct: 416 TGVIAKDQSVKVSRT---------------EKDFMQIPHLQKQLI-LSAID-SVDSNSKT 458

Query: 393 FPVAKKIVYSTCSIHAEENERVV 415
             +   IVYSTCS+  EENE VV
Sbjct: 459 GGI---IVYSTCSVAVEENEAVV 478

>Kwal_23.4841 s23 (890138..892021) [1884 bp, 627 aa] {ON} YNL061W
           (NOP2) - 90-kDa protein, located in nucleolus, that is
           homologous to a human proliferation-associated nucleolar
           protein, p120 [contig 5] FULL
          Length = 627

 Score = 60.1 bits (144), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 70/277 (25%), Positives = 121/277 (43%), Gaps = 46/277 (16%)

Query: 147 ANDLPPVRWIRINPLKCYPNGKTEPVLAELRKKFTLK-VEKWSELVPESIYYDEYIPNLF 205
           AN++P    IR N LK       + ++    +   LK +  W+++  +   +D  +P   
Sbjct: 273 ANEVPRPITIRTNSLKTRRRDLAQTLV---NRGVNLKPIGPWTKVGLQ--IFDSQVP--- 324

Query: 206 GIHPSDKITAHELYKNGKIIIQDRASCFPAHILNPGPNDIVIDACSAPGNKTTHTASYIC 265
                  I A   Y  G  I+Q  +S  P   L+P  N+ ++D  +APG KTT+ ++ + 
Sbjct: 325 -------IGATPEYLAGHYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMM- 376

Query: 266 SEPPKDSRTRIYAFEKDPERAKILQKMIKIAGCSSNIDVSVGDFTKLATPEKFKDATGFI 325
                 +   ++A + +  R K L   I   GC++ I   V ++     P+        +
Sbjct: 377 -----KNTGCVFANDANKARTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRIL 428

Query: 326 VDPSCSGSGIFGRKFFDSLNRXXXXXXXXXXXIVPDEQEEFMAKEELQTRLAKLSSFQFQ 385
           +D  CSG+G+  +     ++R                +++F+    LQ +L  L S    
Sbjct: 429 LDAPCSGTGVIAKDQSVKVSRT---------------EKDFIQIPHLQKQL--LLSAIDS 471

Query: 386 MVKHAMSFPVAKKIVYSTCSIHAEENERVVIDLLLDK 422
           +  ++ +  V   IVYSTCS+  EENE  VID  L K
Sbjct: 472 VDANSKTGGV---IVYSTCSVAVEENE-AVIDYALRK 504

>KLTH0G09460g Chr7 (787197..789110) [1914 bp, 637 aa] {ON} similar
           to uniprot|P40991 Saccharomyces cerevisiae YNL061W NOP2
           Probable RNA m(5)C methyltransferase essential for
           processing and maturation of 27S pre-rRNA and large
           ribosomal subunit biogenesis localized to the nucleolus
          Length = 637

 Score = 60.1 bits (144), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 55/203 (27%), Positives = 91/203 (44%), Gaps = 29/203 (14%)

Query: 213 ITAHELYKNGKIIIQDRASCFPAHILNPGPNDIVIDACSAPGNKTTHTASYICSEPPKDS 272
           I A   Y  G  I+Q  +S  P   L+P  N+ ++D  +APG KTT+ ++ + +      
Sbjct: 327 IGATPEYLAGHYILQAASSFLPVVALDPHENERILDMAAAPGGKTTYISAMMKNTGC--- 383

Query: 273 RTRIYAFEKDPERAKILQKMIKIAGCSSNIDVSVGDFTKLATPEKFKDATGFIVDPSCSG 332
              ++A + +  R K L   I   GC++ I   V ++     P+        ++D  CSG
Sbjct: 384 ---VFANDANKARTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSG 437

Query: 333 SGIFGRKFFDSLNRXXXXXXXXXXXIVPDEQEEFMAKEELQTRLAKLSSFQFQMVKHAMS 392
           +G+  +     ++R                 ++FM    LQ +L  L S    +  ++ +
Sbjct: 438 TGVIAKDQSVKVSRT---------------DKDFMQIPHLQKQL--LLSAIDSVDANSKT 480

Query: 393 FPVAKKIVYSTCSIHAEENERVV 415
             V   IVYSTCS+  EENE VV
Sbjct: 481 GGV---IVYSTCSVAVEENEAVV 500

>NCAS0G03030 Chr7 (556908..558380) [1473 bp, 490 aa] {ON} Anc_2.247
           YNL061W
          Length = 490

 Score = 59.7 bits (143), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 54/205 (26%), Positives = 91/205 (44%), Gaps = 33/205 (16%)

Query: 213 ITAHELYKNGKIIIQDRASCFPAHILNPGPNDIVIDACSAPGNKTTHTASYICSEPPKDS 272
           I A   Y  G  I+Q  +S  P   L+P  N+ ++D  +APG KTT+ ++ +       +
Sbjct: 188 IGATPEYLAGNYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMM------KN 241

Query: 273 RTRIYAFEKDPERAKILQKMIKIAGCSSNIDVSVGDFTKLATPEKFKDATGFIVDPSCSG 332
              ++A + +  R K L   I   GC++ I   V ++     P+        ++D  CSG
Sbjct: 242 TGCVFANDANKNRTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSG 298

Query: 333 SGIFGRKFFDSLNRXXXXXXXXXXXIVPDEQEEFMAKEELQTR--LAKLSSFQFQMVKHA 390
           +G+ G+     ++R                +++F+    LQ +  L+ + S      KH 
Sbjct: 299 TGVIGKDQSVKVSRT---------------EKDFIQIPHLQKQLLLSAIDSVDCNS-KHG 342

Query: 391 MSFPVAKKIVYSTCSIHAEENERVV 415
                   IVYSTCS+  EE+E VV
Sbjct: 343 GV------IVYSTCSVAVEEDEAVV 361

>Suva_14.280 Chr14 (509488..511350) [1863 bp, 620 aa] {ON} YNL061W
           (REAL)
          Length = 620

 Score = 59.7 bits (143), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 71/279 (25%), Positives = 116/279 (41%), Gaps = 48/279 (17%)

Query: 213 ITAHELYKNGKIIIQDRASCFPAHILNPGPNDIVIDACSAPGNKTTHTASYICSEPPKDS 272
           I A   Y  G  I+Q  +S  P   L+P  N+ ++D  +APG KTT+ ++ +       +
Sbjct: 318 IGATPEYLAGHYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMM------KN 371

Query: 273 RTRIYAFEKDPERAKILQKMIKIAGCSSNIDVSVGDFTKLATPEKFKDATGFIVDPSCSG 332
              ++A + +  R K L   I   GC++ I   V ++     P+        ++D  CSG
Sbjct: 372 TGCVFANDANKSRTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSG 428

Query: 333 SGIFGRKFFDSLNRXXXXXXXXXXXIVPDEQEEFMAKEELQTR--LAKLSSFQFQMVKHA 390
           +G+ G+     ++R                +++F+    LQ +  L+ + S      KH 
Sbjct: 429 TGVIGKDQSVKVSRT---------------EKDFIQIPHLQKQLLLSAIDSVDCNS-KHG 472

Query: 391 MSFPVAKKIVYSTCSIHAEENERVVIDLLLDKAVQEWGWRVAPRSEVIPFWPRRGKVEEF 450
                   IVYSTCS+  EE+E VV          ++  R  P  +++      GK E F
Sbjct: 473 GV------IVYSTCSVAVEEDEAVV----------DYALRKRPNVKLVETGLAIGK-EGF 515

Query: 451 EEVFREGAAHDPQELAEGCIRALPKDDGGIGFFAVCFER 489
              FR    H   +LA    R  P      GFF   F++
Sbjct: 516 TS-FRGKKFHPSVKLAR---RYYPHTYNVDGFFVAKFQK 550

>YNL061W Chr14 (510540..512396) [1857 bp, 618 aa] {ON}  NOP2Probable
           RNA m(5)C methyltransferase, essential for processing
           and maturation of 27S pre-rRNA and large ribosomal
           subunit biogenesis; localized to the nucleolus;
           constituent of 66S pre-ribosomal particles
          Length = 618

 Score = 59.7 bits (143), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 57/212 (26%), Positives = 94/212 (44%), Gaps = 34/212 (16%)

Query: 213 ITAHELYKNGKIIIQDRASCFPAHILNPGPNDIVIDACSAPGNKTTHTASYICSEPPKDS 272
           I A   Y  G  I+Q  +S  P   L+P  N+ ++D  +APG KTT+ ++ +       +
Sbjct: 316 IGATPEYLAGHYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMM------KN 369

Query: 273 RTRIYAFEKDPERAKILQKMIKIAGCSSNIDVSVGDFTKLATPEKFKDATGFIVDPSCSG 332
              ++A + +  R K L   I   GC++ I   V ++     P+        ++D  CSG
Sbjct: 370 TGCVFANDANKSRTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSG 426

Query: 333 SGIFGRKFFDSLNRXXXXXXXXXXXIVPDEQEEFMAKEELQTR--LAKLSSFQFQMVKHA 390
           +G+ G+     ++R                +++F+    LQ +  L+ + S      KH 
Sbjct: 427 TGVIGKDQSVKVSRT---------------EKDFIQIPHLQKQLLLSAIDSVDCNS-KHG 470

Query: 391 MSFPVAKKIVYSTCSIHAEENERVVIDLLLDK 422
                   IVYSTCS+  EE+E  VID  L K
Sbjct: 471 GV------IVYSTCSVAVEEDE-AVIDYALRK 495

>Smik_14.266 Chr14 (490908..492764) [1857 bp, 618 aa] {ON} YNL061W
           (REAL)
          Length = 618

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 57/212 (26%), Positives = 94/212 (44%), Gaps = 34/212 (16%)

Query: 213 ITAHELYKNGKIIIQDRASCFPAHILNPGPNDIVIDACSAPGNKTTHTASYICSEPPKDS 272
           I A   Y  G  I+Q  +S  P   L+P  N+ ++D  +APG KTT+ ++ +       +
Sbjct: 316 IGATPEYLAGHYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMM------KN 369

Query: 273 RTRIYAFEKDPERAKILQKMIKIAGCSSNIDVSVGDFTKLATPEKFKDATGFIVDPSCSG 332
              ++A + +  R K L   I   GC++ I   V ++     P+        ++D  CSG
Sbjct: 370 TGCVFANDANKSRTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSG 426

Query: 333 SGIFGRKFFDSLNRXXXXXXXXXXXIVPDEQEEFMAKEELQTR--LAKLSSFQFQMVKHA 390
           +G+ G+     ++R                +++F+    LQ +  L+ + S      KH 
Sbjct: 427 TGVIGKDQSVKVSRT---------------EKDFIQIPHLQKQLLLSAIDSVDCNS-KHG 470

Query: 391 MSFPVAKKIVYSTCSIHAEENERVVIDLLLDK 422
                   IVYSTCS+  EE+E  VID  L K
Sbjct: 471 GV------IVYSTCSVAVEEDE-AVIDYALRK 495

>Skud_14.271 Chr14 (500809..502668) [1860 bp, 619 aa] {ON} YNL061W
           (REAL)
          Length = 619

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 54/205 (26%), Positives = 91/205 (44%), Gaps = 33/205 (16%)

Query: 213 ITAHELYKNGKIIIQDRASCFPAHILNPGPNDIVIDACSAPGNKTTHTASYICSEPPKDS 272
           I A   Y  G  I+Q  +S  P   L+P  N+ ++D  +APG KTT+ ++ +       +
Sbjct: 317 IGATPEYLAGHYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMM------KN 370

Query: 273 RTRIYAFEKDPERAKILQKMIKIAGCSSNIDVSVGDFTKLATPEKFKDATGFIVDPSCSG 332
              ++A + +  R K L   I   GC++ I   V ++     P+        ++D  CSG
Sbjct: 371 TGCVFANDANKSRTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSG 427

Query: 333 SGIFGRKFFDSLNRXXXXXXXXXXXIVPDEQEEFMAKEELQTR--LAKLSSFQFQMVKHA 390
           +G+ G+     ++R                +++F+    LQ +  L+ + S      KH 
Sbjct: 428 TGVIGKDQSVKVSRT---------------EKDFIQIPHLQKQLLLSAIDSVDCNS-KHG 471

Query: 391 MSFPVAKKIVYSTCSIHAEENERVV 415
                   IVYSTCS+  EE+E VV
Sbjct: 472 GV------IVYSTCSVAVEEDEAVV 490

>TDEL0C04150 Chr3 complement(734914..736758) [1845 bp, 614 aa] {ON}
           Anc_2.247 YNL061W
          Length = 614

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 52/203 (25%), Positives = 93/203 (45%), Gaps = 29/203 (14%)

Query: 213 ITAHELYKNGKIIIQDRASCFPAHILNPGPNDIVIDACSAPGNKTTHTASYICSEPPKDS 272
           I A   Y  G  I+Q  +S  P   L+P  N+ ++D  +APG KTT+ ++ +       +
Sbjct: 313 IGATPEYLAGNYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISALM------KN 366

Query: 273 RTRIYAFEKDPERAKILQKMIKIAGCSSNIDVSVGDFTKLATPEKFKDATGFIVDPSCSG 332
              ++A + +  R K L   I   GC++ I   V ++     P+        ++D  C+G
Sbjct: 367 TGCVFANDANKARTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCTG 423

Query: 333 SGIFGRKFFDSLNRXXXXXXXXXXXIVPDEQEEFMAKEELQTRLAKLSSFQFQMVKHAMS 392
           +G+ G+     ++R                +++F+    LQ +L  L S    +  ++ +
Sbjct: 424 TGVIGKDQSVKVSRT---------------EKDFIQVPHLQKQL--LLSAIDSVDSNSKT 466

Query: 393 FPVAKKIVYSTCSIHAEENERVV 415
             +   IVYSTCS+  EE+E VV
Sbjct: 467 GGI---IVYSTCSVAVEEDEMVV 486

>KNAG0D02050 Chr4 (339873..341921) [2049 bp, 682 aa] {ON} Anc_8.171
           YBL024W
          Length = 682

 Score = 57.4 bits (137), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 75/298 (25%), Positives = 112/298 (37%), Gaps = 62/298 (20%)

Query: 222 GKIIIQDRASCFPAHILNPGPNDIVIDACSAPGNKTTHTASYICSEPPKDSRTRIYAFEK 281
           G I  Q+  S  P  +L   P   V+D C+APG+KT      +  +  + +   + A + 
Sbjct: 145 GNISRQEAVSMIPPIVLEVEPQHTVLDMCAAPGSKTAQLLEALHRDTDEPT-GFVVANDA 203

Query: 282 DPERAKILQKMIKIAGCSSNIDVSVGD---FTKLATP---EKFKDATGF---IVDPSCSG 332
           D  R+ +L   +K    S+N+ V   D   F ++ T    EK  D   F   + D  CSG
Sbjct: 204 DNRRSHMLVHQLKRLN-SANLIVVNHDAQFFPRIKTSKNSEKKSDLLKFDRILCDVPCSG 262

Query: 333 SGIFGRKFFDSLNRXXXXXXXXXXXIVPDEQEEFMAKEELQTRLAKLSSFQFQMVKHAMS 392
            G   +                                  Q  L  L   Q  ++   + 
Sbjct: 263 DGTMRKNV------------------------NVWRDWNTQNALG-LHQVQANILNRGLH 297

Query: 393 F-PVAKKIVYSTCSIHAEENERVVIDLLLDKAVQEWGWRV-----------APRSEVIPF 440
                 ++VYSTCS++  ENE VV      +A+++WG +V             R++ I  
Sbjct: 298 LLKKGGRLVYSTCSMNPIENEAVVA-----QALRKWGDKVRLVNCDDKLPGLVRNKGISK 352

Query: 441 WPRRGKVEEFEEVFREGAAH---DPQE------LAEGCIRALPKDDGGIGFFAVCFER 489
           WP   +  E  E  +EGA      P E        E CIR  P      GFF   FE+
Sbjct: 353 WPTLNRNMEEMEKGQEGANDSWFQPTEEEAEKFQLENCIRVYPHQQNTGGFFITVFEK 410

>SAKL0H19448g Chr8 (1713663..1715738) [2076 bp, 691 aa] {ON} highly
           similar to uniprot|P38205 Saccharomyces cerevisiae
           YBL024W
          Length = 691

 Score = 57.4 bits (137), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 73/296 (24%), Positives = 117/296 (39%), Gaps = 61/296 (20%)

Query: 222 GKIIIQDRASCFPAHILNPGPNDIVIDACSAPGNKTTHTASYICSEPPKDSRTR-IYAFE 280
           G I  Q+  S  P  +L   PN  V+D C+APG+KT      + ++  +D  T  + A +
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPNHTVLDMCAAPGSKTAQLIEALHAQ--EDEPTGFVVAND 202

Query: 281 KDPERAKILQKMIKIAGCSSNIDVSVGD---FTKLATPEKFKDATGF---IVDPSCSGSG 334
            D +R+ +L   +K    S+N+ V   D   F ++ +    K+   F   + D  CSG G
Sbjct: 203 ADAKRSHMLVHQLKRLN-SANLMVVNHDAQFFPRIKSQPDSKEFLKFDRVLCDVPCSGDG 261

Query: 335 IFGRKFFDSLNRXXXXXXXXXXXIVPDEQEEFMAKEELQTRLAKLSSFQFQMVKHAMS-F 393
              RK  +                        + ++        L + Q  ++   ++  
Sbjct: 262 TM-RKNVN------------------------VWRDWGTASGLGLHTVQLNILNRGLNLL 296

Query: 394 PVAKKIVYSTCSIHAEENERVVIDLLLDKAVQEWGWRV-----------APRSEVIPFWP 442
               ++VYSTCS++  ENE V+       A+++WG ++             RS+ I  WP
Sbjct: 297 KDGGRLVYSTCSLNPIENESVIA-----AALRKWGDKIRLVNCDEKLPGLVRSKGITQWP 351

Query: 443 RRGKVEEFEEVFREGAAHD---PQE------LAEGCIRALPKDDGGIGFFAVCFER 489
              K    +E   EG       P E        E CIR  P      GFF   FE+
Sbjct: 352 VYDKNFALKEKGDEGVIETWFPPTEEEATRFHLENCIRVYPHQQNTGGFFITVFEK 407

>ZYRO0G08998g Chr7 complement(726070..728121) [2052 bp, 683 aa] {ON}
           similar to uniprot|P38205 Saccharomyces cerevisiae
           YBL024W
          Length = 683

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 74/298 (24%), Positives = 117/298 (39%), Gaps = 62/298 (20%)

Query: 222 GKIIIQDRASCFPAHILNPGPNDIVIDACSAPGNKTTHTASYICSEPPKDSRTRIYAFEK 281
           G I  Q+  S  P  +L+  P+  V+D C+APG+KT     Y+  +  + S   + A + 
Sbjct: 142 GNISRQEAVSMIPPTLLDVQPHHTVLDMCAAPGSKTAQMIEYLHRDNDEPS-GFVVANDA 200

Query: 282 DPERAKILQKMIKIAGCSSNIDVSVGD---FTKL-ATPEKF--KDATGF---IVDPSCSG 332
           D +R+ +L   +K    S+N+ V   D   F ++ A P+    KD   F   + D  CSG
Sbjct: 201 DAKRSHMLVHQLKRLN-SANLIVVNHDAQFFPRVKAHPDHTNKKDILRFDRVLCDVPCSG 259

Query: 333 SGIFGRKFFDSLNRXXXXXXXXXXXIVPDEQEEFMAKEELQTRLAKLSSFQFQMVKHAMS 392
            G   +                                  Q  LA L + Q  ++   + 
Sbjct: 260 DGTMRKNV------------------------NVWRDWTTQNGLA-LHNVQLNILNRGLH 294

Query: 393 -FPVAKKIVYSTCSIHAEENERVVIDLLLDKAVQEWGWRV-----------APRSEVIPF 440
                 ++VYSTCS++  ENE VV +     A+++WG +V             RS  I  
Sbjct: 295 LLKSGGRLVYSTCSMNPIENEAVVAE-----ALRKWGGKVRLVDCSDKLPGLVRSNGINQ 349

Query: 441 WPRRGKVEEFEEVFREGAAHD-----PQELA----EGCIRALPKDDGGIGFFAVCFER 489
           WP   +  E +E   +G          +E A    + C+R  P      GFF    E+
Sbjct: 350 WPVLNRNMETKEKGEDGTNDSWFPPTDEEAARFHLDYCVRVYPHQQNTGGFFITVLEK 407

>TBLA0A08740 Chr1 (2141750..2143810) [2061 bp, 686 aa] {ON}
           Anc_8.171 YBL024W
          Length = 686

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 70/304 (23%), Positives = 110/304 (36%), Gaps = 74/304 (24%)

Query: 222 GKIIIQDRASCFPAHILNPGPNDIVIDACSAPGNKTTHTASYICSEPPKDSRTRIYAFEK 281
           G I  Q+  S  P  +L   P+  V+D C+APG+KT      +  E  + +   + A + 
Sbjct: 145 GNISRQEAVSMIPPLVLEVKPHHTVLDMCAAPGSKTAQMIEALHMENAEPT-GFVVANDS 203

Query: 282 DPERAKILQKMIKIAGCSS------------NIDVSVGDFTKLATPEKFKDATGF---IV 326
           D  R+ +L   +K    ++             I +SVGD        K KDA  F   + 
Sbjct: 204 DYRRSHMLVHQLKRLNSANMMVVNHDAQFFPRIKLSVGD-------NKAKDALKFDRILC 256

Query: 327 DPSCSGSGIFGRKFFDSLNRXXXXXXXXXXXIVPDEQEEFMAKEELQTRLAKLSSFQFQM 386
           D  CSG G   +                                  Q  L  L + Q+ +
Sbjct: 257 DVPCSGDGTMRKNV------------------------NVWKDWNTQAGLG-LHTIQYNI 291

Query: 387 VKHAMS-FPVAKKIVYSTCSIHAEENERVVIDLLLDKAVQEWGWRVA-----------PR 434
           +   +       ++VYSTCS++  ENE VV      +A++ WG ++             R
Sbjct: 292 LNRGLHLLKTGGRLVYSTCSLNPIENEAVVA-----RALRTWGSKIKIINCDDKLPGLIR 346

Query: 435 SEVIPFWPRRGKVEEFEEVFREGAAH------DPQELA---EGCIRALPKDDGGIGFFAV 485
           S  +  WP   +  E +    EG         D +  A   + C+R  P      GFF  
Sbjct: 347 SNGVTQWPVFDRNMESKNKGDEGTLESWFPPTDEEVTAFNLQNCMRVYPHQQNTGGFFIT 406

Query: 486 CFER 489
             E+
Sbjct: 407 VIEK 410

>TPHA0H00150 Chr8 (15977..17926) [1950 bp, 649 aa] {ON} Anc_8.171
           YBL024W
          Length = 649

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 75/307 (24%), Positives = 117/307 (38%), Gaps = 78/307 (25%)

Query: 222 GKIIIQDRASCFPAHILNPGPNDIVIDACSAPGNKTTHT--ASYICSEPPKDSRTRIYAF 279
           G I  Q+  S  P  +L+  P+  V+D C+APG+KT     + +I S+ P      + A 
Sbjct: 140 GNISRQEAVSMLPPILLDVKPHHTVLDMCAAPGSKTAQLMESLHIDSDEPSGF---VIAN 196

Query: 280 EKDPERAKILQKMIKIAGCSS----NIDVSVGDFTKLATPEKFKDATG--------FIVD 327
           + D +R+ +L   +K    S+    N D       K+ T    KDA+          + D
Sbjct: 197 DADNKRSHLLVHQLKRLSTSNVLIVNHDAQFFPNLKINT----KDASSQEDLKFDRILCD 252

Query: 328 PSCSGSGIFGRKFFDSLNRXXXXXXXXXXXIVPDEQEEFMAKEELQTRLAKLSSFQFQMV 387
             CSG G   +                                  Q  L  L + QF ++
Sbjct: 253 VPCSGDGTMRKNV------------------------NVWKNWNTQNALG-LHNVQFNIL 287

Query: 388 KHAMS-FPVAKKIVYSTCSIHAEENERVVIDLLLDKAVQEWGWRV-----------APRS 435
              ++      K+VYSTCS++  ENE VV  +L     ++WG +V             RS
Sbjct: 288 DRGLTLLKETGKLVYSTCSLNPIENEAVVAAVL-----RKWGDKVRLVCCDDKLKGLIRS 342

Query: 436 EVIPFWPRRGKVEEFEEVFR-------EGAAHDPQE------LAEGCIRALPKDDGGIGF 482
           + +  WP   +  + EEV R         + + P E        + C+R  P      GF
Sbjct: 343 KGLTTWPVINR--DMEEVPRNRSDDKINKSCYPPTEEEVSKFNLDRCMRVYPHQQNTGGF 400

Query: 483 FAVCFER 489
           F   FE+
Sbjct: 401 FITMFEK 407

>Kpol_1002.109 s1002 (272892..274904) [2013 bp, 670 aa] {ON}
           (272892..274904) [2013 nt, 671 aa]
          Length = 670

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 73/302 (24%), Positives = 113/302 (37%), Gaps = 70/302 (23%)

Query: 222 GKIIIQDRASCFPAHILNPGPNDIVIDACSAPGNKTTHTASYICSEPPKDSRTRIYAFEK 281
           G I  Q+  S  P  +L   P+  V+D C+APG+KT      +  E  + S   + A + 
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIEALHMEDDEPS-GFVVANDA 203

Query: 282 DPERAKILQKMIKIAGCSSNIDVSVGDFTKLATPEKFKDATG---------FIVDPSCSG 332
           D +R+ +L   +K    S+N+ V   D       +  +DAT           + D  CSG
Sbjct: 204 DAKRSHMLVHQLKRLN-SANLMVVNHDAQFFPRIKLHEDATQKKDVLRFDRVLCDVPCSG 262

Query: 333 SGIFGRKFFDSLNRXXXXXXXXXXXIVPDEQEEFMAKEELQTRLAKLSSFQFQMVKHAMS 392
            G   +                                  Q+ L  L + Q  ++   + 
Sbjct: 263 DGTMRKNV------------------------NVWRDWNTQSGLG-LHTVQLNILNRGLH 297

Query: 393 FPVAK-KIVYSTCSIHAEENERVVIDLLLDKAVQEWGWRV-----------APRSEVIPF 440
               K ++VYSTCS++  ENE VV       A+++WG ++             RS+ I  
Sbjct: 298 LLKPKGRLVYSTCSMNPIENEAVVA-----AALRKWGDKIRLVNCDDKLPGLVRSKGIST 352

Query: 441 WP---------RRGKVEEFEEVFREGAAHDPQELAE----GCIRALPKDDGGIGFFAVCF 487
           WP         ++G     E  F    A  P+E  +     CIR  P      GFF   F
Sbjct: 353 WPVVDRNMEEKKKGDENTVESWF----APTPEEAEKFDLSSCIRVYPHQQNTGGFFITVF 408

Query: 488 ER 489
           E+
Sbjct: 409 EK 410

>KNAG0G01510 Chr7 complement(341469..343469) [2001 bp, 666 aa] {ON}
           Anc_8.171 YBL024W
          Length = 666

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 73/296 (24%), Positives = 108/296 (36%), Gaps = 58/296 (19%)

Query: 222 GKIIIQDRASCFPAHILNPGPNDIVIDACSAPGNKTTHTASYICSEPPKDSRTRIYAFEK 281
           G I  Q+  S  P  +L    N  V+D C+APG+KT      +  +  + +   I A + 
Sbjct: 159 GNISRQEAVSMIPPLLLRLESNHNVLDMCAAPGSKTAQLIEQLHKDTDEPTGI-IVANDS 217

Query: 282 DPERAKILQKMIKIAGCSSNIDVSVGD---FTKLATPEKFKDAT----GFIVDPSCSGSG 334
           D  R+ +L   +K    SSNI V   D   F  + T     + T      + D  CSG G
Sbjct: 218 DMRRSYLLVHQLKRLN-SSNILVVNHDAQFFPNIRTNSLNNNITMKFDRILCDVPCSGDG 276

Query: 335 IFGRKFFDSLNRXXXXXXXXXXXIVPDEQEEFMAKEELQTRLAKLSSFQFQMVKHAMSFP 394
              RK  +  N                  +  +    LQ  +        Q++++     
Sbjct: 277 TL-RKNINIWNDWRF--------------QNALGLHRLQNNILNRG---LQLLRNG---- 314

Query: 395 VAKKIVYSTCSIHAEENERVVIDLLLDKAVQEWGWRVAP-----------RSEVIPFWP- 442
              ++VYSTCS++  ENE V+ +     A++ W   V+            RS  I  WP 
Sbjct: 315 --GRLVYSTCSMNPIENEAVIAN-----ALRNWAGEVSLVNFDDELPGLIRSRGISSWPV 367

Query: 443 --------RRGKVEEFEEVFREGAAHDPQELAEGCIRALPKDDGGIGFFAVCFERK 490
                    RG  E  +  F   A        E CIR  P       FF   FE+ 
Sbjct: 368 IDRNGEMRERGDPETLDSWFPPTADEQKTFNLEKCIRVYPHQQDTGAFFIAVFEKN 423

>TPHA0C02870 Chr3 (620913..622937) [2025 bp, 674 aa] {ON} Anc_8.171
           YBL024W
          Length = 674

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 69/299 (23%), Positives = 115/299 (38%), Gaps = 64/299 (21%)

Query: 222 GKIIIQDRASCFPAHILNPGPNDIVIDACSAPGNKTTHTASYICSEPPKDSRTRI-YAFE 280
           G I  Q+  S  P  +L    N  V+D C+APG+KT      + +   +D  T I  A +
Sbjct: 144 GNISRQEAVSMIPPILLEVESNHTVLDMCAAPGSKTAQLIEALHTN--EDEPTGIVVAND 201

Query: 281 KDPERAKILQKMIKIAGCSSNIDVSVGD---FTKLATPEKFKDATGF------IVDPSCS 331
            D  R+ +L   +K    S+N+ V   D   F ++A  E   D+  F      + D  CS
Sbjct: 202 ADARRSHMLVHQLKRLN-SANLMVVNHDAQFFPRIALHENTTDSNDFLKFDRILCDVPCS 260

Query: 332 GSGIFGRKFFDSLNRXXXXXXXXXXXIVPDEQEEFMAKEELQTRLAKLSSFQFQMVKHAM 391
           G G   +                      +   ++ ++  L      L + Q  ++   +
Sbjct: 261 GDGTMRKNV--------------------NVWRDWTSQGGL-----GLHNIQLNILNRGL 295

Query: 392 SFPVAK-KIVYSTCSIHAEENERVVIDLLLDKAVQEWGWRV-----------APRSEVIP 439
                K ++VYSTCS++  ENE V+       A+++WG ++             RS+ I 
Sbjct: 296 HLLKPKGRLVYSTCSMNPIENEAVIA-----AALRKWGSKIRVINCDEKLPGLVRSKGID 350

Query: 440 FWPRRGKVEEFEEVFREGAAHD---------PQELAEGCIRALPKDDGGIGFFAVCFER 489
            WP   +  E  +   +G ++           Q   + CIR  P       FF    E+
Sbjct: 351 SWPVFNRDMEIRQKGDQGVSNTWFPPSEEEKSQFNLQNCIRVYPHQQNTGAFFITVIEK 409

>NDAI0B01830 Chr2 (436254..438314) [2061 bp, 686 aa] {ON} Anc_8.171
           YBL024W
          Length = 686

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 69/297 (23%), Positives = 113/297 (38%), Gaps = 60/297 (20%)

Query: 222 GKIIIQDRASCFPAHILNPGPNDIVIDACSAPGNKTTHTASYICSEPPKDSRTRIYAFEK 281
           G I  Q+  S  P  +L   P+  V+D C+APG+KT      +  +  + +   + A + 
Sbjct: 145 GNISRQEAVSMIPPIVLEVEPHHTVLDMCAAPGSKTAQLIEALHKDTDEPT-GFVVANDA 203

Query: 282 DPERAKILQKMIKIAGCSS----NIDVSVGDFTKLAT-PEKFKDATGF---IVDPSCSGS 333
           D +R+ +L   +K    ++    N D       KL T  EK K+   F   + D  CSG 
Sbjct: 204 DAKRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKLHTDAEKKKEMLKFDRILCDVPCSGD 263

Query: 334 GIFGRKFFDSLNRXXXXXXXXXXXIVPDEQEEFMAKEELQTRLAKLSSFQFQMVKHAMS- 392
           G   +                                  Q  L  L + Q  ++   ++ 
Sbjct: 264 GTMRKNV------------------------NVWKDWNTQGGLG-LHTVQLNILNRGLNL 298

Query: 393 FPVAKKIVYSTCSIHAEENERVVIDLLLDKAVQEWGWRVA-----------PRSEVIPFW 441
                ++VYSTCS++  ENE VV +     A+++WG ++             RS+ I  W
Sbjct: 299 LKSGGRLVYSTCSMNPIENEAVVAE-----ALRKWGSKIKLVNCDDKLVGLVRSKGISNW 353

Query: 442 PRRGKVEEFEEVFREGA-------AHDPQEL--AEGCIRALPKDDGGIGFFAVCFER 489
           P   +    +    EG          + +E+   + CIR  P      GFF   FE+
Sbjct: 354 PVLDRNMAVKNKGDEGTIESWFPPTEEEREIFHLDSCIRVYPHQQNTGGFFITVFEK 410

>NCAS0B04390 Chr2 complement(795633..797648) [2016 bp, 671 aa] {ON}
           Anc_8.171 YBL024W
          Length = 671

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 71/298 (23%), Positives = 117/298 (39%), Gaps = 62/298 (20%)

Query: 222 GKIIIQDRASCFPAHILNPGPNDIVIDACSAPGNKTTHTASYICSEPPKDSRTRIYAFEK 281
           G I  Q+  S  P  +L   P   V+D C+APG+KT      +  +  + +   + A + 
Sbjct: 145 GNISRQEAVSMIPPIVLEVEPQHTVLDMCAAPGSKTAQLIEALHKDTDEPT-GFVVANDA 203

Query: 282 DPERAKILQKMIKIAGCSSNIDVSVGD---FTKLA---TPEKFKDATGF---IVDPSCSG 332
           D  R+ +L   +K    S+N+ V   D   F ++      EK +D   F   + D  CSG
Sbjct: 204 DARRSHMLVHQLKRLN-SANLMVVNHDAQFFPRIKLHDDAEKKRDMLKFDRILCDVPCSG 262

Query: 333 SGIFGRKFFDSLNRXXXXXXXXXXXIVPDEQEEFMAKEELQTRLAKLSSFQFQMVKHAMS 392
            G   +                      +  +++ A+  L      L + Q+ ++   + 
Sbjct: 263 DGTMRKNV--------------------NVWKDWNAQGAL-----GLHTVQWNILNRGLH 297

Query: 393 FPVAK-KIVYSTCSIHAEENERVVIDLLLDKAVQEWGWRV-----------APRSEVIPF 440
                 ++VYSTCS++  ENE VV      +A+++WG ++             RS+ I  
Sbjct: 298 LLKPNGRLVYSTCSLNPIENEAVVA-----QALRKWGNKIRLVNCDEKLPGLVRSKGISQ 352

Query: 441 WPRRGKVEEFEEVFREGAAHD---PQELA------EGCIRALPKDDGGIGFFAVCFER 489
           WP   +  E +    EG       P E        + CIR  P      GFF   FE+
Sbjct: 353 WPVLNRDLETKNKNDEGVLESWFPPSEEEASLFNLDACIRVYPHQQNTGGFFITVFEK 410

>KAFR0B02220 Chr2 complement(438809..440869) [2061 bp, 686 aa] {ON}
           Anc_8.171 YBL024W
          Length = 686

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 69/299 (23%), Positives = 109/299 (36%), Gaps = 64/299 (21%)

Query: 222 GKIIIQDRASCFPAHILNPGPNDIVIDACSAPGNKTTHT--ASYICSEPPKDSRTRIYAF 279
           G I  Q+  S  P  +L   P   V+D C+APG+KT     A ++ ++ P      + A 
Sbjct: 146 GNISRQEAVSMIPPIVLEVEPQHTVLDMCAAPGSKTAQLIEALHMDTDEPTGF---VVAN 202

Query: 280 EKDPERAKILQKMIKIAGCSS----NIDVSVGDFTKLAT-PEKFKDATGF---IVDPSCS 331
           + D  R+ +L   +K    ++    N D       K++   +K KD   F   + D  CS
Sbjct: 203 DADSRRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKISNDSDKKKDLLKFDRILCDVPCS 262

Query: 332 GSGIFGRKFFDSLNRXXXXXXXXXXXIVPDEQEEFMAKEELQTRLAKLSSFQFQMVKHAM 391
           G G   +                                  Q+ L  L + Q+ ++   +
Sbjct: 263 GDGTMRKNV------------------------NVWKDWNTQSGLG-LHTVQYNILNRGL 297

Query: 392 SF-PVAKKIVYSTCSIHAEENERVVIDLLLDKAVQEWGWRVA-----------PRSEVIP 439
           +      ++VYSTCS++  ENE VV      +A++ WG ++             RS+ I 
Sbjct: 298 NLLKSGGRLVYSTCSLNPIENEAVVA-----QALRTWGDKIKLVNCGDKLPGLVRSQGIS 352

Query: 440 FWP---------RRGKVEEFEEVFREGAAHDPQELAEGCIRALPKDDGGIGFFAVCFER 489
            WP          +G     E  F            E CIR  P      GFF    E+
Sbjct: 353 QWPVIDRNMTEKNKGDEGTIESWFPPSEEEAKNFHLENCIRVYPHQQNTGGFFITVIEK 411

>TDEL0B04390 Chr2 (769749..771770) [2022 bp, 673 aa] {ON} Anc_8.171
           YBL024W
          Length = 673

 Score = 54.3 bits (129), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 71/302 (23%), Positives = 115/302 (38%), Gaps = 69/302 (22%)

Query: 222 GKIIIQDRASCFPAHILNPGPNDIVIDACSAPGNKTTHTASYICSEPPKDSRTRIYAFEK 281
           G I  Q+  S  P  +L   P+  V+D C+APG+KT      +  +  + +   + A + 
Sbjct: 143 GNISRQEAVSMIPPIVLEVEPHHTVLDMCAAPGSKTAQMIEALHKDTDEPT-GFVVANDA 201

Query: 282 DPERAKILQKMIKIAGCSS------------NIDVSVGDFTKLATPEKFKDATGFIVDPS 329
           D +R+ +L   +K    ++             I  S  D +  A   KF      + D  
Sbjct: 202 DSKRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKSSAADDSSKANVLKFDRV---LCDVP 258

Query: 330 CSGSGIFGRKFFDSLNRXXXXXXXXXXXIVPDEQEEFMAKEELQTRLAKLSSFQFQMVKH 389
           CSG G   +                      +   ++  +  L      L + QF ++  
Sbjct: 259 CSGDGTMRKNV--------------------NVWRDWTPQGGL-----GLHTVQFNILNR 293

Query: 390 AMSFPVAK-KIVYSTCSIHAEENERVVIDLLLDKAVQEWGWRV-----------APRSEV 437
            +     K ++VYSTCS++  ENE VV +     A+++WG ++             RS+ 
Sbjct: 294 GLHLLKNKGRLVYSTCSMNPIENEAVVAE-----ALRKWGDKIRLVSCEDKLPGLVRSKG 348

Query: 438 IPFWPRRGKVEEFEEVFREGAAHDP------QELA----EGCIRALPKDDGGIGFFAVCF 487
           +  WP   +     E   EG  HD       +E A    E CIR  P      GFF   F
Sbjct: 349 VSQWPVIDRNMTPREKGDEG-THDSWFPPTEEEAAKFNLENCIRVYPHQQNTGGFFITVF 407

Query: 488 ER 489
           E+
Sbjct: 408 EK 409

>Suva_2.97 Chr2 (172667..174679) [2013 bp, 670 aa] {ON} YBL024W
           (REAL)
          Length = 670

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 67/298 (22%), Positives = 109/298 (36%), Gaps = 62/298 (20%)

Query: 222 GKIIIQDRASCFPAHILNPGPNDIVIDACSAPGNKTTHTASYICSEPPKDSRTRIYAFEK 281
           G I  Q+  S  P  +L   P+  V+D C+APG+KT      +  +  + S   + A + 
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIEALHKDTDEPS-GFVVANDA 203

Query: 282 DPERAKILQKMIKIAGCSSNIDVSVGD---FTKLATPE---KFKDATGF---IVDPSCSG 332
           D  R+ +L   +K    S+N+ V   D   F ++   E   K  D   F   + D  CSG
Sbjct: 204 DARRSHMLVHQLKRLN-SANLMVVNHDAQFFPRIRLHENSNKKNDVLKFDRILCDVPCSG 262

Query: 333 SGIFGRKFFDSLNRXXXXXXXXXXXIVPDEQEEFMAKEELQTRLAKLSSFQFQMVKHAMS 392
            G   +                                  Q  L  L + Q  ++   + 
Sbjct: 263 DGTMRKNV------------------------NVWKDWNTQAGLG-LHTVQLNILNRGLH 297

Query: 393 F-PVAKKIVYSTCSIHAEENERVVIDLLLDKAVQEWGWRV-----------APRSEVIPF 440
                 ++VYSTCS++  ENE V+ +     A+++WG ++             RS+ +  
Sbjct: 298 LLKDGGRLVYSTCSLNPIENEAVIAE-----ALRKWGDKIRLVNCDDKLSGLVRSKGVSK 352

Query: 441 WP---------RRGKVEEFEEVFREGAAHDPQELAEGCIRALPKDDGGIGFFAVCFER 489
           WP          +G     E  F        +   + C+R  P      GFF   FE+
Sbjct: 353 WPVYDRNLTEKTKGDEGTLESFFAPSEEEASKFNLQNCMRVYPHQQNTGGFFITVFEK 410

>KLTH0H08096g Chr8 (706261..708327) [2067 bp, 688 aa] {ON} similar
           to uniprot|P38205 Saccharomyces cerevisiae YBL024W
          Length = 688

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 74/296 (25%), Positives = 116/296 (39%), Gaps = 61/296 (20%)

Query: 222 GKIIIQDRASCFPAHILNPGPNDIVIDACSAPGNKTTHTASYICSEPPKDSRTR-IYAFE 280
           G I  Q+  S  P  +L    +  V+D C+APG+KT      + S   +D  T  + A +
Sbjct: 145 GNISRQEAVSMIPPIVLEVESHHSVLDMCAAPGSKTAQMIEALHS--SEDEPTGFVVAND 202

Query: 281 KDPERAKILQKMIKIAGCSSNIDVSVGD---FTKLATPEKFKDATGF---IVDPSCSGSG 334
            D  R+ +L   +K    S+N+ V   D   F ++ T ++      F   + D  CSG G
Sbjct: 203 ADARRSHMLVHQLKRLN-SANLVVVNHDAQFFPRVKTDKETNQFLKFDRILCDVPCSGDG 261

Query: 335 IFGRKFFDSLNRXXXXXXXXXXXIVPDEQEEFMAKEELQTRLAKLSSFQFQMVKHAMSF- 393
              RK  +                        + K+        L + Q  ++K  ++  
Sbjct: 262 TM-RKNVN------------------------VWKDWGTASGLGLHTVQLNILKRGLNLL 296

Query: 394 PVAKKIVYSTCSIHAEENERVVIDLLLDKAVQEWGWRVA-----------PRSEVIPFWP 442
               ++VYSTCS++  ENE VV       A+++WG ++             RS+ I  WP
Sbjct: 297 KKGGRLVYSTCSMNPIENEAVVA-----AALRQWGDKIKLVDCSDKLPGLVRSKGISNWP 351

Query: 443 RRGKVEEFEEVFREGAAH-----DPQELA----EGCIRALPKDDGGIGFFAVCFER 489
              K  E +E   EG          +E A    + CIR  P      GFF    E+
Sbjct: 352 VIDKAFEKKEKGDEGTTESWFPPSAEEAADFHLDRCIRVYPHQQNTGGFFITVIEK 407

>Smik_2.92 Chr2 (166201..168225) [2025 bp, 674 aa] {ON} YBL024W
           (REAL)
          Length = 674

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 66/298 (22%), Positives = 107/298 (35%), Gaps = 62/298 (20%)

Query: 222 GKIIIQDRASCFPAHILNPGPNDIVIDACSAPGNKTTHTASYICSEPPKDSRTRIYAFEK 281
           G I  Q+  S  P  +L   P+  V+D C+APG+KT      +  +  + S   + A + 
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIEALHKDTDEPS-GFVVANDA 203

Query: 282 DPERAKILQKMIKIAGCSSNIDVSVGD---FTKL---ATPEKFKDATGF---IVDPSCSG 332
           D  R+ +L   +K    S+N+ V   D   F ++          D   F   + D  CSG
Sbjct: 204 DARRSHMLVHQLKRLN-SANLMVVNHDAQFFPRIRLHGNSSNKNDVLKFDRILCDVPCSG 262

Query: 333 SGIFGRKFFDSLNRXXXXXXXXXXXIVPDEQEEFMAKEELQTRLAKLSSFQFQMVKHAMS 392
            G   +                                  Q  L  L + Q  ++   + 
Sbjct: 263 DGTMRKNV------------------------NVWKDWNTQAGLG-LHTVQLNILNRGLH 297

Query: 393 F-PVAKKIVYSTCSIHAEENERVVIDLLLDKAVQEWGWRV-----------APRSEVIPF 440
                 ++VYSTCS++  ENE VV +     A+++WG ++             RS+ +  
Sbjct: 298 LLKNNGRLVYSTCSLNPIENEAVVAE-----ALRKWGDKIRLVNCDDKLPGLIRSKGVSK 352

Query: 441 WP---------RRGKVEEFEEVFREGAAHDPQELAEGCIRALPKDDGGIGFFAVCFER 489
           WP          +G     E  F        +   + C+R  P      GFF   FE+
Sbjct: 353 WPVYDRNLTEKTKGDEGTLESFFSPSEEEASRFNLQNCMRVYPHQQNTGGFFITVFEK 410

>Skud_2.81 Chr2 (156273..158318) [2046 bp, 681 aa] {ON} YBL024W
           (REAL)
          Length = 681

 Score = 50.8 bits (120), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 66/298 (22%), Positives = 109/298 (36%), Gaps = 62/298 (20%)

Query: 222 GKIIIQDRASCFPAHILNPGPNDIVIDACSAPGNKTTHTASYICSEPPKDSRTRIYAFEK 281
           G I  Q+  S  P  +L   P+  V+D C+APG+KT      +  +  + S   + A + 
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIEALHKDTDEPS-GFVVANDA 203

Query: 282 DPERAKILQKMIKIAGCSSNIDVSVGD---FTKL---ATPEKFKDATGF---IVDPSCSG 332
           D  R+ +L   +K    S+N+ V   D   F ++       K  D   F   + D  CSG
Sbjct: 204 DARRSHMLVHQLKRLN-SANLMVVNHDAQFFPRIRLHGNSNKKNDILKFDRILCDVPCSG 262

Query: 333 SGIFGRKFFDSLNRXXXXXXXXXXXIVPDEQEEFMAKEELQTRLAKLSSFQFQMVKHAMS 392
            G   +                                  Q  L  L + Q  ++   + 
Sbjct: 263 DGTMRKNV------------------------NVWKDWNTQAGLG-LHTVQLNILNRGLH 297

Query: 393 FPVAK-KIVYSTCSIHAEENERVVIDLLLDKAVQEWGWRV-----------APRSEVIPF 440
              +  ++VYSTCS++  ENE V+ +     A+++WG ++             RS+ +  
Sbjct: 298 LLKSNGRLVYSTCSLNPIENEAVIAE-----ALRKWGDKIRLVNCDDKLTGLIRSKGVSK 352

Query: 441 WP---------RRGKVEEFEEVFREGAAHDPQELAEGCIRALPKDDGGIGFFAVCFER 489
           WP          +G     E  F        +   + C+R  P      GFF   FE+
Sbjct: 353 WPVYDRNLTEKNKGDEGTLESFFPPSEEEASKFNLKNCMRVYPHQQNTGGFFISVFEK 410

>YBL024W Chr2 (172534..174588) [2055 bp, 684 aa] {ON}
           NCL1S-adenosyl-L-methionine-dependent tRNA:
           m5C-methyltransferase, methylates cytosine to m5C at
           several positions in tRNAs and intron-containing
           pre-tRNAs; increases proportion of tRNALeu(CAA) with m5C
           at wobble position in response to hydrogen peroxide,
           causing selective translation of mRNA from genes
           enriched in TTG codon; loss of NCL1 confers
           hypersensitivity to oxidative stress; similar to Nop2p
           and human proliferation associated nucleolar protein
           p120
          Length = 684

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 65/298 (21%), Positives = 107/298 (35%), Gaps = 62/298 (20%)

Query: 222 GKIIIQDRASCFPAHILNPGPNDIVIDACSAPGNKTTHTASYICSEPPKDSRTRIYAFEK 281
           G I  Q+  S  P  +L   P+  V+D C+APG+KT      +  +  + S   + A + 
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIEALHKDTDEPS-GFVVANDA 203

Query: 282 DPERAKILQKMIKIAGCSSNIDVSVGD---FTKL---ATPEKFKDATGF---IVDPSCSG 332
           D  R+ +L   +K    S+N+ V   D   F ++          D   F   + D  CSG
Sbjct: 204 DARRSHMLVHQLKRLN-SANLMVVNHDAQFFPRIRLHGNSNNKNDVLKFDRILCDVPCSG 262

Query: 333 SGIFGRKFFDSLNRXXXXXXXXXXXIVPDEQEEFMAKEELQTRLAKLSSFQFQMVKHAMS 392
            G   +                                  Q  L  L + Q  ++   + 
Sbjct: 263 DGTMRKNV------------------------NVWKDWNTQAGLG-LHAVQLNILNRGLH 297

Query: 393 F-PVAKKIVYSTCSIHAEENERVVIDLLLDKAVQEWGWRV-----------APRSEVIPF 440
                 ++VYSTCS++  ENE VV +     A+++WG ++             RS+ +  
Sbjct: 298 LLKNNGRLVYSTCSLNPIENEAVVAE-----ALRKWGDKIRLVNCDDKLPGLIRSKGVSK 352

Query: 441 WP---------RRGKVEEFEEVFREGAAHDPQELAEGCIRALPKDDGGIGFFAVCFER 489
           WP          +G     +  F        +   + C+R  P      GFF   FE+
Sbjct: 353 WPVYDRNLTEKTKGDEGTLDSFFSPSEEEASKFNLQNCMRVYPHQQNTGGFFITVFEK 410

>CAGL0K01991g Chr11 (173969..175987) [2019 bp, 672 aa] {ON} highly
           similar to uniprot|P38205 Saccharomyces cerevisiae
           YBL024w NCL1 tRNA (cytosine-5-)-methyltransferase
          Length = 672

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 71/292 (24%), Positives = 109/292 (37%), Gaps = 62/292 (21%)

Query: 222 GKIIIQDRASCFPAHILNPGPNDIVIDACSAPGNKTTHTASYICSEPPKDSRTRIYAFEK 281
           G I  Q+  S  P  +L   P+  V+D C+APG+KTT     +  +  + +   + A + 
Sbjct: 143 GNISRQEAVSMIPPIVLEVEPHHTVLDMCAAPGSKTTQMIEALHKDTDEPT-GFVVANDA 201

Query: 282 DPERAKILQKMIKIAGCSSNIDVSVGD---FTKLAT---PEKFKDATGF---IVDPSCSG 332
           D  R+ +L   +K    S+N+ V   D   F ++     P K K    F   + D  CSG
Sbjct: 202 DSRRSHMLVHQLKRLN-SANLMVVNHDAQFFPRIILSDEPSKKKAQLKFDRILCDVPCSG 260

Query: 333 SGIFGRKFFDSLNRXXXXXXXXXXXIVPDEQEEFMAKEELQTRLAKLSSFQFQMVKHAMS 392
            G   +                                  Q  L  L + Q  ++   + 
Sbjct: 261 DGTMRKNV------------------------NVWKDWNTQGALG-LHTVQLNILDRGLH 295

Query: 393 FPVAK-KIVYSTCSIHAEENERVVIDLLLDKAVQEWGWRV-----------APRSEVIPF 440
                 ++VYSTCS++  ENE VV +     A++ WG +V             RS+ I  
Sbjct: 296 LLQNNGRLVYSTCSMNPIENEAVVAE-----ALRRWGDKVRLVDCSEKLPGLIRSQGITQ 350

Query: 441 WPRRGKVEEFEEVFREGAAHD---PQE------LAEGCIRALPKDDGGIGFF 483
           WP   +  E  +   EG  +    P E        E C+R  P      GFF
Sbjct: 351 WPVIDRNMEERKKEDEGMINSWFPPSEEEVSKFHLERCMRVYPHQQNTGGFF 402

>NCAS0B05640 Chr2 complement(1068983..1070962) [1980 bp, 659 aa]
           {ON} 
          Length = 659

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 68/298 (22%), Positives = 108/298 (36%), Gaps = 62/298 (20%)

Query: 222 GKIIIQDRASCFPAHILNPGPNDIVIDACSAPGNKTTHTASYICSEPPKDSRTRIYAFEK 281
           G I  Q+  S  P  +L   P+  V+D C+APG+KT      +  +   +    + A + 
Sbjct: 139 GNISRQEAVSMIPPIVLEVEPHHTVLDMCAAPGSKTAQLLEALHRD-SNEPTGFVVANDS 197

Query: 282 DPERAKILQKMIKIAGCSSNIDVSVGD---FTKLATPEKFKDATGF------IVDPSCSG 332
           D  RA +L   +K    S+N+ V   D   F K+       + +G       + D  CSG
Sbjct: 198 DSRRAYMLVHQLKRLN-SANLLVVNHDAQFFPKIKLRADATNKSGMLKYDRILCDVPCSG 256

Query: 333 SGIFGRKFFDSLNRXXXXXXXXXXXIVPDEQEEFMAKEELQTRLAKLSSFQFQMVKHAMS 392
            G   RK  +                        + K+        L + Q  ++   + 
Sbjct: 257 DGTM-RKNVN------------------------VWKDWNTQNALGLHNVQLNILNRGLQ 291

Query: 393 -FPVAKKIVYSTCSIHAEENERVVIDLLLDKAVQEWGWRVA-----------PRSEVIPF 440
                 ++VYSTCS++  ENE VV       A+++WG ++             RS  I  
Sbjct: 292 LLKDNGRLVYSTCSLNPIENEAVVA-----AALRKWGNKIKLVDCQNKLQGLVRSNGISH 346

Query: 441 WPRRGK-----VEEFEEV----FREGAAHDPQELAEGCIRALPKDDGGIGFFAVCFER 489
           W    +      ++ E      F    A       E C+R  P      GFF   FE+
Sbjct: 347 WSVYDREMNAITKDSESTKSSWFEPTDAEKENFNLEHCMRVYPHQQNTGGFFIAVFEK 404

>KLLA0F12562g Chr6 (1163366..1165480) [2115 bp, 704 aa] {ON} highly
           similar to uniprot|P38205 Saccharomyces cerevisiae
           YBL024W
          Length = 704

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 64/299 (21%), Positives = 112/299 (37%), Gaps = 63/299 (21%)

Query: 222 GKIIIQDRASCFPAHILNPGPNDIVIDACSAPGNKTTHTASYICSEPPKDSRTRIYAFEK 281
           G I  Q+  S  P  +L+  P+  V+D C+APG+KT      + +E  + S   + A + 
Sbjct: 145 GNISRQEAVSMIPPIVLDVKPHHYVLDMCAAPGSKTAQLIEALHAESDEPS-GFVIANDA 203

Query: 282 DPERAKILQKMIKIAGCSSNIDVSVG---------DFTKLATPEKFKDATGFIVDPSCSG 332
           D +R+ +L   +K    ++ + V+           D T+ +   +F      + D  CSG
Sbjct: 204 DYKRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKVDSTEGSKGPQFLKFDRVLCDVPCSG 263

Query: 333 SGIFGRKFFDSLNRXXXXXXXXXXXIVPDEQEEFMAKEELQTRLAKLSSFQ--FQMVKHA 390
            G   +                      +  +++     L   + +L+  +    ++K  
Sbjct: 264 DGTMRKNV--------------------NVWKDWNTGSGLGLHIVQLNILERGLNLLKE- 302

Query: 391 MSFPVAKKIVYSTCSIHAEENERVVIDLLLDKAVQEWGWRV-----------APRSEVIP 439
                  K+VYSTCS++  ENE V+       A++ WG +V             RS+ I 
Sbjct: 303 -----GGKLVYSTCSLNPIENEAVIA-----AALRRWGDKVRLVNCDDQLPGLVRSKGIT 352

Query: 440 FWP---------RRGKVEEFEEVFREGAAHDPQELAEGCIRALPKDDGGIGFFAVCFER 489
            W           +G     +  F   A    +   E C+R         GFF   FE+
Sbjct: 353 EWKVYDKQFQVREKGHENCLDSWFPPTAEEVEKFHLENCMRVYQHQQNTGGFFITVFEK 411

>NDAI0B02980 Chr2 complement(757926..759965) [2040 bp, 679 aa] {ON} 
          Length = 679

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 64/299 (21%), Positives = 109/299 (36%), Gaps = 63/299 (21%)

Query: 222 GKIIIQDRASCFPAHILNPGPNDIVIDACSAPGNKTTHTASYICSEPPKDSRTRIYAFEK 281
           G I  Q+  S  P  +L+  P+  V+D C+APG+KT      +  + P+ S   + A + 
Sbjct: 139 GNISRQEAVSMIPPIVLDVKPHHTVLDMCAAPGSKTAQLIEALHMDGPEPS-GFVVANDS 197

Query: 282 DPERAKILQKMIKIAGCSSNIDVSVGD---FTKLATP-------EKFKDATGFIVDPSCS 331
           D +R+ +L   +K    S+N+ V   D   F K+          +++      + D  CS
Sbjct: 198 DSKRSHMLVHQLKRLN-SANLMVVNHDAQFFPKIQLDSNKGRHNKEYLKFDRILCDVPCS 256

Query: 332 GSGIFGRKFFDSLNRXXXXXXXXXXXIVPDEQEEFMAKEELQTRLAKLSSFQFQMVKHAM 391
           G G   +                                  Q  L  L + Q  ++   +
Sbjct: 257 GDGTIRKNV------------------------NIWKDWNTQNSLG-LHNVQLNILNRGI 291

Query: 392 S-FPVAKKIVYSTCSIHAEENERVVIDLLLDKAVQEWGWRV--APRSEVIPFWPRRGKVE 448
                  ++VYSTCS+   ENE V+        +++WG ++      E++P       + 
Sbjct: 292 QLLKSGGRLVYSTCSLSPIENEAVI-----SATLRKWGNKIKLVDCKEMLPGLISSPGIS 346

Query: 449 EFE------EVFREGAA------HDPQELAEG------CIRALPKDDGGIGFFAVCFER 489
           ++E       +  +GA         P E          CIR  P      GFF    E+
Sbjct: 347 KWEVYDRTMSIVSKGAEKSKDTWFQPTEEEANDFNLSHCIRVFPHQQNTGGFFIAVLEK 405

>Kwal_14.2081 s14 (598648..599463) [816 bp, 272 aa] {ON} YBL024W
           (NCL1) - Probable proliferating-cell nucleolar antigen
           (human p120) [contig 230] PARTIAL
          Length = 272

 Score = 37.4 bits (85), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 51/123 (41%), Gaps = 12/123 (9%)

Query: 222 GKIIIQDRASCFPAHILNPGPNDIVIDACSAPGNKTTHT--ASYICSEPPKDSRTRIYAF 279
           G I  Q+  S  P  +L   P+  V+D C+APG+KT     A +   + P      + A 
Sbjct: 145 GNISRQEAVSMIPPIVLEVEPHHAVLDMCAAPGSKTAQMIEALHATEDEPTGF---VVAN 201

Query: 280 EKDPERAKILQKMIKIAGCSSNIDVSVGDFTKLATPEKFKDATGF------IVDPSCSGS 333
           + D  R+ +L   +K    S+N+ V   D       +   D+  F      + D  CSG 
Sbjct: 202 DADARRSHMLVHQLKRLN-SANLMVVNHDAQFFPRVKLDNDSNQFLKFDRVLCDVPCSGD 260

Query: 334 GIF 336
           G  
Sbjct: 261 GTM 263

>Ecym_3003 Chr3 complement(6934..7893) [960 bp, 319 aa] {ON} similar
           to Ashbya gossypii ACR026W
          Length = 319

 Score = 34.7 bits (78), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 32/74 (43%), Gaps = 9/74 (12%)

Query: 242 PNDIVIDACSAPGNKTTHTASYICSEPPKDSRTRIYAFEKDPERAKILQKMIKIAGCSSN 301
           P+DIV++     GN TT            +   ++ A E DP  A  L K +        
Sbjct: 56  PSDIVLEVGPGTGNLTTRIL---------EKARKVVAVEFDPRMAAELTKRVHGTAAEKK 106

Query: 302 IDVSVGDFTKLATP 315
           +++ +GDFTK   P
Sbjct: 107 LEIILGDFTKTELP 120

>YNL023C Chr14 complement(588263..591160) [2898 bp, 965 aa] {ON}
           FAP1Protein that binds to Fpr1p, conferring rapamycin
           resistance by competing with rapamycin for Fpr1p
           binding; accumulates in the nucleus upon treatment of
           cells with rapamycin; has similarity to D. melanogaster
           shuttle craft and human NFX1
          Length = 965

 Score = 34.7 bits (78), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 32/60 (53%), Gaps = 2/60 (3%)

Query: 219 YKNGKIIIQDRASCFPAHILNPGPNDIVIDACSAPGNKTT--HTASYICSEPPKDSRTRI 276
           Y + ++ +++R +C+   ++NP PN +  ++C    N +T  H  S IC   P    TR+
Sbjct: 119 YVSKRVPVKNRPTCWCGKVVNPDPNPLDPNSCGQTCNASTCMHGCSKICHLGPHPECTRM 178

>KNAG0L02440 Chr12 (434232..435185) [954 bp, 317 aa] {ON} Anc_6.1
           YPL266W
          Length = 317

 Score = 33.5 bits (75), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 33/81 (40%), Gaps = 12/81 (14%)

Query: 235 AHILNPGPNDIVIDACSAPGNKTTHTASYICSEPPKDSRTRIYAFEKDPERAKILQKMIK 294
           AHI    P+DIV++     GN T             +   ++ A E DP  A  L K + 
Sbjct: 52  AHI---KPSDIVLEVGPGTGNLTVRIL---------EKAKKVVAVEMDPRMAAELTKRVH 99

Query: 295 IAGCSSNIDVSVGDFTKLATP 315
                  +D+ +GDF K   P
Sbjct: 100 GTPAEKKLDIMLGDFMKTELP 120

>SAKL0E00660g Chr5 complement(42779..43747) [969 bp, 322 aa] {ON}
           highly similar to uniprot|P41819 Saccharomyces
           cerevisiae YPL266W DIM1 Essential 18S rRNA dimethylase
           responsible for conserved m6(2)Am6(2)A dimethylation in
           3'- terminal loop of 18 S rRNA part of 90S and 40S pre-
           particles in nucleolus involved in pre-ribosomal RNA
           processing
          Length = 322

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 30/74 (40%), Gaps = 9/74 (12%)

Query: 242 PNDIVIDACSAPGNKTTHTASYICSEPPKDSRTRIYAFEKDPERAKILQKMIKIAGCSSN 301
           P+D+V++     GN T             +   R+ A E DP  A  L K +        
Sbjct: 57  PSDVVLEVGPGTGNLTVRIL---------EQARRVVAVEMDPRMAAELTKRVHGTAAEKK 107

Query: 302 IDVSVGDFTKLATP 315
           +++ +GDF K   P
Sbjct: 108 LEILLGDFMKTELP 121

>KNAG0M00120 Chr13 complement(12320..14965) [2646 bp, 881 aa] {ON} 
          Length = 881

 Score = 32.0 bits (71), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 28/64 (43%), Gaps = 2/64 (3%)

Query: 205 FGIHPSDKITAHELYKNGKIIIQDRASCFPAHILNPGPNDIVIDACSAPGNKTTHTASYI 264
           +G H      A EL  NG I + + +S  P+  L P P+D  +   S    K T  A  I
Sbjct: 64  YGAHTQILTPAEELLDNGTISLTNTSSQLPSFYLTPRPSDGTV--LSRSSEKLTDKAHVI 121

Query: 265 CSEP 268
            S P
Sbjct: 122 QSSP 125

>TBLA0A07080 Chr1 complement(1748948..1749913) [966 bp, 321 aa] {ON}
           Anc_6.1 YPL266W
          Length = 321

 Score = 31.6 bits (70), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 30/74 (40%), Gaps = 9/74 (12%)

Query: 242 PNDIVIDACSAPGNKTTHTASYICSEPPKDSRTRIYAFEKDPERAKILQKMIKIAGCSSN 301
           P+DIV++     GN T             +   ++ A E DP  A  L K +        
Sbjct: 57  PSDIVLEVGPGTGNLTVRIL---------EQARKVIAVEFDPRMAAELTKRVHGTPAEKK 107

Query: 302 IDVSVGDFTKLATP 315
           +D+ +GDF K   P
Sbjct: 108 LDIILGDFMKTELP 121

>TPHA0J00200 Chr10 complement(47344..48303) [960 bp, 319 aa] {ON}
           Anc_6.1 YPL266W
          Length = 319

 Score = 31.6 bits (70), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 30/74 (40%), Gaps = 9/74 (12%)

Query: 242 PNDIVIDACSAPGNKTTHTASYICSEPPKDSRTRIYAFEKDPERAKILQKMIKIAGCSSN 301
           P+DIV++     GN T             +   ++ A E DP  A  L K +        
Sbjct: 57  PSDIVLEVGPGTGNLTVRIL---------EQARKVVAVEMDPRMAAELTKRVHGTPGEKK 107

Query: 302 IDVSVGDFTKLATP 315
           +D+ +GDF K   P
Sbjct: 108 LDILLGDFMKTDLP 121

>Kpol_449.12 s449 complement(42834..43793) [960 bp, 319 aa] {ON}
           complement(42834..43793) [960 nt, 320 aa]
          Length = 319

 Score = 31.6 bits (70), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 31/77 (40%), Gaps = 9/77 (11%)

Query: 239 NPGPNDIVIDACSAPGNKTTHTASYICSEPPKDSRTRIYAFEKDPERAKILQKMIKIAGC 298
           N  P+DIV++     GN T             +   ++ A E DP  A  L K +     
Sbjct: 54  NIKPSDIVLEVGPGTGNLTVRIL---------EQARKVVAVEMDPRMAAELTKRVHGTPA 104

Query: 299 SSNIDVSVGDFTKLATP 315
              +++ +GDF K   P
Sbjct: 105 EKKLEIMLGDFMKTELP 121

>ZYRO0F00308g Chr6 complement(32198..33157) [960 bp, 319 aa] {ON}
           highly similar to uniprot|P41819 Saccharomyces
           cerevisiae YPL266W DIM1 Essential 18S rRNA dimethylase
           responsible for conserved m6(2)Am6(2)A dimethylation in
           3'- terminal loop of 18 S rRNA part of 90S and 40S pre-
           particles in nucleolus involved in pre-ribosomal RNA
           processing
          Length = 319

 Score = 31.6 bits (70), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 30/74 (40%), Gaps = 9/74 (12%)

Query: 242 PNDIVIDACSAPGNKTTHTASYICSEPPKDSRTRIYAFEKDPERAKILQKMIKIAGCSSN 301
           P+D V++     GN T      +          + YA E DP  A  L K ++       
Sbjct: 57  PSDTVLEVGPGTGNLTVRILEQV---------RKAYAVEMDPRMAAELTKRVRGTDGERK 107

Query: 302 IDVSVGDFTKLATP 315
           +++ +GDF K   P
Sbjct: 108 LEILLGDFIKTDLP 121

>Smik_6.474 Chr6 complement(781184..782140) [957 bp, 318 aa] {ON}
           YPL266W (REAL)
          Length = 318

 Score = 31.6 bits (70), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 30/74 (40%), Gaps = 9/74 (12%)

Query: 242 PNDIVIDACSAPGNKTTHTASYICSEPPKDSRTRIYAFEKDPERAKILQKMIKIAGCSSN 301
           P+D+V++     GN T        S         + A E DP  A  L K ++       
Sbjct: 56  PSDVVLEVGPGTGNLTVRILEQAKS---------VVAVEMDPRMAAELTKRVRGTQVEKK 106

Query: 302 IDVSVGDFTKLATP 315
           +++ +GDF K   P
Sbjct: 107 LEIMLGDFMKTELP 120

>CAGL0L07678g Chr12 complement(846285..847238) [954 bp, 317 aa] {ON}
           highly similar to uniprot|P41819 Saccharomyces
           cerevisiae YPL266w DIM1
          Length = 317

 Score = 31.2 bits (69), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 30/74 (40%), Gaps = 9/74 (12%)

Query: 242 PNDIVIDACSAPGNKTTHTASYICSEPPKDSRTRIYAFEKDPERAKILQKMIKIAGCSSN 301
           P+DIV++     GN T             +   ++ A E DP  A  L K +        
Sbjct: 56  PSDIVLEVGPGTGNLTVRIL---------EQARKVVAVEMDPRMAAELTKRVHGTPAEKK 106

Query: 302 IDVSVGDFTKLATP 315
           +++ +GDF K   P
Sbjct: 107 LEIMLGDFMKTELP 120

>YAR007C Chr1 complement(156754..158619) [1866 bp, 621 aa] {ON}
           RFA1Subunit of heterotrimeric Replication Protein A
           (RPA), which is a highly conserved single-stranded DNA
           binding protein involved in DNA replication, repair, and
           recombination
          Length = 621

 Score = 31.6 bits (70), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 26/116 (22%), Positives = 51/116 (43%), Gaps = 16/116 (13%)

Query: 170 EPVLAELRKKFTLKVEKWSELVPESIYYDE---YIPNLFGIHPSDKITAHELYKNGKIII 226
           EP +   RKK+ L V+ +  +   +   ++   ++ N F  HP++ +   ++  +G +  
Sbjct: 86  EPAIVRERKKYVLLVDDFELVQSRADMVNQTSTFLDNYFSEHPNETLKDEDITDSGNVAN 145

Query: 227 QDRASCFPAHILNPGPNDIVIDACSAPGNKTTHTASYICSEPPKDSRTR-IYAFEK 281
           Q  AS       N G  D++    +   N+         +E P   +TR I+A E+
Sbjct: 146 QTNAS-------NAGVPDMLHSNSNLNANERK-----FANENPNSQKTRPIFAIEQ 189

>KLTH0C11704g Chr3 (966706..967674) [969 bp, 322 aa] {ON} highly
           similar to uniprot|P41819 Saccharomyces cerevisiae
           YPL266W DIM1 Essential 18S rRNA dimethylase responsible
           for conserved m6(2)Am6(2)A dimethylation in 3'- terminal
           loop of 18 S rRNA part of 90S and 40S pre- particles in
           nucleolus involved in pre-ribosomal RNA processing
          Length = 322

 Score = 30.8 bits (68), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 29/74 (39%), Gaps = 9/74 (12%)

Query: 242 PNDIVIDACSAPGNKTTHTASYICSEPPKDSRTRIYAFEKDPERAKILQKMIKIAGCSSN 301
           P+D+V++     GN T             +   ++ A E DP     L K +        
Sbjct: 57  PSDVVLEVGPGTGNLTVRIL---------EQARKVIAVEMDPRMGAELTKRVHGTAGEKK 107

Query: 302 IDVSVGDFTKLATP 315
           +D+ +GDF K   P
Sbjct: 108 LDILLGDFMKTDLP 121

>Kwal_56.22317 s56 complement(43543..44631) [1089 bp, 362 aa] {ON}
           YPL266W (DIM1) - dimethyladenosine transferase [contig
           186] FULL
          Length = 362

 Score = 30.8 bits (68), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 29/74 (39%), Gaps = 9/74 (12%)

Query: 242 PNDIVIDACSAPGNKTTHTASYICSEPPKDSRTRIYAFEKDPERAKILQKMIKIAGCSSN 301
           P+D+V++     GN T             +   ++ A E DP     L K +        
Sbjct: 97  PSDVVLEVGPGTGNLTVRIL---------EQARKVIAVEMDPRMGAELTKRVHGTSGEKK 147

Query: 302 IDVSVGDFTKLATP 315
           +D+ +GDF K   P
Sbjct: 148 LDILLGDFMKTDLP 161

>Suva_16.39 Chr16 (54705..55661) [957 bp, 318 aa] {ON} YPL266W
           (REAL)
          Length = 318

 Score = 30.8 bits (68), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 30/74 (40%), Gaps = 9/74 (12%)

Query: 242 PNDIVIDACSAPGNKTTHTASYICSEPPKDSRTRIYAFEKDPERAKILQKMIKIAGCSSN 301
           P+D+V++     GN T             +    + A E DP  A  L K ++       
Sbjct: 56  PSDVVLEVGPGTGNLTVRIL---------EQAKNVVAVEMDPRMAAELTKRVRGTPVEKK 106

Query: 302 IDVSVGDFTKLATP 315
           +++ +GDF K   P
Sbjct: 107 LEILLGDFMKTELP 120

>KAFR0B06450 Chr2 complement(1337903..1338859) [957 bp, 318 aa] {ON}
           Anc_6.1 YPL266W
          Length = 318

 Score = 30.8 bits (68), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 19/77 (24%), Positives = 31/77 (40%), Gaps = 9/77 (11%)

Query: 239 NPGPNDIVIDACSAPGNKTTHTASYICSEPPKDSRTRIYAFEKDPERAKILQKMIKIAGC 298
           N  P+D+V++     GN T             +   ++ A E DP  A  L K +     
Sbjct: 53  NIKPSDVVLEVGPGTGNLTVRIL---------EQARKVVAVEMDPRMAAELTKRVHGTPA 103

Query: 299 SSNIDVSVGDFTKLATP 315
              +++ +GDF K   P
Sbjct: 104 ERKLEIILGDFMKTELP 120

>YPL266W Chr16 (39121..40077) [957 bp, 318 aa] {ON}  DIM1Essential
           18S rRNA dimethylase (dimethyladenosine transferase),
           responsible for conserved m6(2)Am6(2)A dimethylation in
           3'-terminal loop of 18S rRNA, part of 90S and 40S
           pre-particles in nucleolus, involved in pre-ribosomal
           RNA processing
          Length = 318

 Score = 30.8 bits (68), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 30/74 (40%), Gaps = 9/74 (12%)

Query: 242 PNDIVIDACSAPGNKTTHTASYICSEPPKDSRTRIYAFEKDPERAKILQKMIKIAGCSSN 301
           P+D+V++     GN T             +    + A E DP  A  L K ++       
Sbjct: 56  PSDVVLEVGPGTGNLTVRIL---------EQAKNVVAVEMDPRMAAELTKRVRGTPVEKK 106

Query: 302 IDVSVGDFTKLATP 315
           +++ +GDF K   P
Sbjct: 107 LEIMLGDFMKTELP 120

>TPHA0D01530 Chr4 complement(313063..315951) [2889 bp, 962 aa] {ON}
           Anc_2.288 YNL023C
          Length = 962

 Score = 30.8 bits (68), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 11/40 (27%), Positives = 25/40 (62%)

Query: 219 YKNGKIIIQDRASCFPAHILNPGPNDIVIDACSAPGNKTT 258
           + + +I +++R +C+   ++NP PN++  ++C    NK T
Sbjct: 114 HSSKQIPLRNRPTCWCGKVINPDPNELSPNSCGQTCNKKT 153

>Skud_16.11 Chr16 (18214..19170) [957 bp, 318 aa] {ON} YPL266W
           (REAL)
          Length = 318

 Score = 30.4 bits (67), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 30/74 (40%), Gaps = 9/74 (12%)

Query: 242 PNDIVIDACSAPGNKTTHTASYICSEPPKDSRTRIYAFEKDPERAKILQKMIKIAGCSSN 301
           P+D+V++     GN T             +    + A E DP  A  L K ++       
Sbjct: 56  PSDVVLEVGPGTGNLTVRIL---------EQAKNVVAVEMDPRMAAELTKRVRGTPVEKK 106

Query: 302 IDVSVGDFTKLATP 315
           +++ +GDF K   P
Sbjct: 107 LEIMLGDFMKTELP 120

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.413 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 51,300,064
Number of extensions: 2179509
Number of successful extensions: 4998
Number of sequences better than 10.0: 90
Number of HSP's gapped: 4990
Number of HSP's successfully gapped: 111
Length of query: 490
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 376
Effective length of database: 40,409,475
Effective search space: 15193962600
Effective search space used: 15193962600
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)