Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_14.3082.288ON96596550370.0
YNL023C (FAP1)2.288ON96596444240.0
Skud_14.3062.288ON97096642250.0
Suva_14.3242.288ON96896541420.0
NDAI0G006702.288ON96894132840.0
NCAS0G037802.288ON95793832410.0
KNAG0H019902.288ON97395530260.0
KAFR0H033002.288ON96694330110.0
TDEL0G021902.288ON93692829900.0
CAGL0M06919g2.288ON95692828970.0
TBLA0B059502.288ON99598828540.0
ZYRO0A01936g2.288ON95389627700.0
Kpol_1039.452.288ON96890026870.0
SAKL0E07634g2.288ON97490826730.0
KLTH0G10406g2.288ON96391626550.0
Kwal_27.115182.288ON95391025800.0
TPHA0D015302.288ON96292425460.0
KLLA0E08317g2.288ON92190023580.0
ADL213W2.288ON90890122640.0
Ecym_33272.288ON92691422590.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_14.308
         (965 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_14.308 Chr14 complement(550650..553547) [2898 bp, 965 aa] {...  1944   0.0  
YNL023C Chr14 complement(588263..591160) [2898 bp, 965 aa] {ON} ...  1708   0.0  
Skud_14.306 Chr14 complement(558943..561855) [2913 bp, 970 aa] {...  1632   0.0  
Suva_14.324 Chr14 complement(571146..574052) [2907 bp, 968 aa] {...  1600   0.0  
NDAI0G00670 Chr7 (146574..149480) [2907 bp, 968 aa] {ON} Anc_2.2...  1269   0.0  
NCAS0G03780 Chr7 complement(696877..699750) [2874 bp, 957 aa] {O...  1253   0.0  
KNAG0H01990 Chr8 complement(349855..352776) [2922 bp, 973 aa] {O...  1170   0.0  
KAFR0H03300 Chr8 complement(627520..630420) [2901 bp, 966 aa] {O...  1164   0.0  
TDEL0G02190 Chr7 (430157..432967) [2811 bp, 936 aa] {ON} Anc_2.2...  1156   0.0  
CAGL0M06919g Chr13 complement(703702..706572) [2871 bp, 956 aa] ...  1120   0.0  
TBLA0B05950 Chr2 (1404509..1407496) [2988 bp, 995 aa] {ON} Anc_2...  1103   0.0  
ZYRO0A01936g Chr1 (159749..162610) [2862 bp, 953 aa] {ON} simila...  1071   0.0  
Kpol_1039.45 s1039 (135833..138739) [2907 bp, 968 aa] {ON} (1358...  1039   0.0  
SAKL0E07634g Chr5 complement(616444..619368) [2925 bp, 974 aa] {...  1034   0.0  
KLTH0G10406g Chr7 (880042..882933) [2892 bp, 963 aa] {ON} simila...  1027   0.0  
Kwal_27.11518 s27 complement(832986..835847) [2862 bp, 953 aa] {...   998   0.0  
TPHA0D01530 Chr4 complement(313063..315951) [2889 bp, 962 aa] {O...   985   0.0  
KLLA0E08317g Chr5 complement(747272..750037) [2766 bp, 921 aa] {...   912   0.0  
ADL213W Chr4 (329646..332372) [2727 bp, 908 aa] {ON} Syntenic ho...   876   0.0  
Ecym_3327 Chr3 (626396..629176) [2781 bp, 926 aa] {ON} similar t...   874   0.0  

>Smik_14.308 Chr14 complement(550650..553547) [2898 bp, 965 aa] {ON}
           YNL023C (REAL)
          Length = 965

 Score = 1944 bits (5037), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 955/965 (98%), Positives = 955/965 (98%)

Query: 1   MTDHESLDLKQNQEGGGVCRRHSLSSEQDSSVEDNNEQPSSYEEETDDDMQYYERSIQEI 60
           MTDHESLDLKQNQEGGGVCRRHSLSSEQDSSVEDNNEQPSSYEEETDDDMQYYERSIQEI
Sbjct: 1   MTDHESLDLKQNQEGGGVCRRHSLSSEQDSSVEDNNEQPSSYEEETDDDMQYYERSIQEI 60

Query: 61  SKGDSYICMICTVEMDYTCQMFACKRCYRVFDYGCIREWAIKSTEKTVDRIWKCPNCYHV 120
           SKGDSYICMICTVEMDYTCQMFACKRCYRVFDYGCIREWAIKSTEKTVDRIWKCPNCYHV
Sbjct: 61  SKGDSYICMICTVEMDYTCQMFACKRCYRVFDYGCIREWAIKSTEKTVDRIWKCPNCYHV 120

Query: 121 GKKVPANNRPTCWCGKVVXXXXXXXXXXSCGQTCSAPICIHGCSKTCHLGPHPECTRMVE 180
           GKKVPANNRPTCWCGKVV          SCGQTCSAPICIHGCSKTCHLGPHPECTRMVE
Sbjct: 121 GKKVPANNRPTCWCGKVVNPDPNPLDPNSCGQTCSAPICIHGCSKTCHLGPHPECTRMVE 180

Query: 181 IMCHCGKHSQSIFCYQSKAMKKNFKCQEECGLPLSCSVHNCKRKCHTGLCGPCPELITSK 240
           IMCHCGKHSQSIFCYQSKAMKKNFKCQEECGLPLSCSVHNCKRKCHTGLCGPCPELITSK
Sbjct: 181 IMCHCGKHSQSIFCYQSKAMKKNFKCQEECGLPLSCSVHNCKRKCHTGLCGPCPELITSK 240

Query: 241 DSTEEQIKCYCGNHSRASIKCSEARFPKSGRSSKDGNGNEWIGVFACTDIRTVDFSCRKH 300
           DSTEEQIKCYCGNHSRASIKCSEARFPKSGRSSKDGNGNEWIGVFACTDIRTVDFSCRKH
Sbjct: 241 DSTEEQIKCYCGNHSRASIKCSEARFPKSGRSSKDGNGNEWIGVFACTDIRTVDFSCRKH 300

Query: 301 SFIEPCLSPPSVNGRKVCPFLPSLLKTCPCGRTALDELTKPRKHCDDPIPTCNSRCSKPL 360
           SFIEPCLSPPSVNGRKVCPFLPSLLKTCPCGRTALDELTKPRKHCDDPIPTCNSRCSKPL
Sbjct: 301 SFIEPCLSPPSVNGRKVCPFLPSLLKTCPCGRTALDELTKPRKHCDDPIPTCNSRCSKPL 360

Query: 361 KCGKHSCPFICHDLACMDPCLQIDSAKCACEQSTFSVPCGFQGRPRCNIKCESLMSCRRH 420
           KCGKHSCPFICHDLACMDPCLQIDSAKCACEQSTFSVPCGFQGRPRCNIKCESLMSCRRH
Sbjct: 361 KCGKHSCPFICHDLACMDPCLQIDSAKCACEQSTFSVPCGFQGRPRCNIKCESLMSCRRH 420

Query: 421 RCTDRCCSGRPSAVKRRKNFFRSQDLLDESLVEAKHICLKPCNLTLSCGIHKCQRKCHPG 480
           RCTDRCCSGRPSAVKRRKNFFRSQDLLDESLVEAKHICLKPCNLTLSCGIHKCQRKCHPG
Sbjct: 421 RCTDRCCSGRPSAVKRRKNFFRSQDLLDESLVEAKHICLKPCNLTLSCGIHKCQRKCHPG 480

Query: 481 KCPPCLESDSNDLICPCGKTVVPAPVRCGTELPVCNHPCIKVVRGESSCGHKPMPHTCHP 540
           KCPPCLESDSNDLICPCGKTVVPAPVRCGTELPVCNHPCIKVVRGESSCGHKPMPHTCHP
Sbjct: 481 KCPPCLESDSNDLICPCGKTVVPAPVRCGTELPVCNHPCIKVVRGESSCGHKPMPHTCHP 540

Query: 541 LGVPCPPCTETVFKPCKCGKKDKVRTVCFQKDVSCGTKCGLLLHFCRHTCQKTCHLPGNC 600
           LGVPCPPCTETVFKPCKCGKKDKVRTVCFQKDVSCGTKCGLLLHFCRHTCQKTCHLPGNC
Sbjct: 541 LGVPCPPCTETVFKPCKCGKKDKVRTVCFQKDVSCGTKCGLLLHFCRHTCQKTCHLPGNC 600

Query: 601 QKVCKQICGHERLSCRHTCPKPCHGKTECPDLPCPTLVKITCKCGRNEKSVTCSAKSGVV 660
           QKVCKQICGHERLSCRHTCPKPCHGKTECPDLPCPTLVKITCKCGRNEKSVTCSAKSGVV
Sbjct: 601 QKVCKQICGHERLSCRHTCPKPCHGKTECPDLPCPTLVKITCKCGRNEKSVTCSAKSGVV 660

Query: 661 PANESSVLDCDEECEALKRLKELREAFGIKEESNNVTSNELDALKKLVSVATTFEELHLP 720
           PANESSVLDCDEECEALKRLKELREAFGIKEESNNVTSNELDALKKLVSVATTFEELHLP
Sbjct: 661 PANESSVLDCDEECEALKRLKELREAFGIKEESNNVTSNELDALKKLVSVATTFEELHLP 720

Query: 721 FTETTLSVYSKQERWCSQIEVILNKLMDDKTRSSLHFKPMRPPQRHFIRELAKAYGLYSE 780
           FTETTLSVYSKQERWCSQIEVILNKLMDDKTRSSLHFKPMRPPQRHFIRELAKAYGLYSE
Sbjct: 721 FTETTLSVYSKQERWCSQIEVILNKLMDDKTRSSLHFKPMRPPQRHFIRELAKAYGLYSE 780

Query: 781 SQDREPMRSVFIKKEDNGTSNKPVLSLGEALPLYESFKQLQKERKVQEFQSRTTAKLINF 840
           SQDREPMRSVFIKKEDNGTSNKPVLSLGEALPLYESFKQLQKERKVQEFQSRTTAKLINF
Sbjct: 781 SQDREPMRSVFIKKEDNGTSNKPVLSLGEALPLYESFKQLQKERKVQEFQSRTTAKLINF 840

Query: 841 EVQDAQPKVEVAKNNGFLVRNLVTGNTVEDLKRFFEPHLKHTLVVNPQYLILDDGKTALV 900
           EVQDAQPKVEVAKNNGFLVRNLVTGNTVEDLKRFFEPHLKHTLVVNPQYLILDDGKTALV
Sbjct: 841 EVQDAQPKVEVAKNNGFLVRNLVTGNTVEDLKRFFEPHLKHTLVVNPQYLILDDGKTALV 900

Query: 901 YPENYETASVNTERDMELLVGHFDFMAKEAFLADSILLCSTDEEVGKRLDTPVIQEDTSI 960
           YPENYETASVNTERDMELLVGHFDFMAKEAFLADSILLCSTDEEVGKRLDTPVIQEDTSI
Sbjct: 901 YPENYETASVNTERDMELLVGHFDFMAKEAFLADSILLCSTDEEVGKRLDTPVIQEDTSI 960

Query: 961 EDKNK 965
           EDKNK
Sbjct: 961 EDKNK 965

>YNL023C Chr14 complement(588263..591160) [2898 bp, 965 aa] {ON}
           FAP1Protein that binds to Fpr1p, conferring rapamycin
           resistance by competing with rapamycin for Fpr1p
           binding; accumulates in the nucleus upon treatment of
           cells with rapamycin; has similarity to D. melanogaster
           shuttle craft and human NFX1
          Length = 965

 Score = 1708 bits (4424), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 820/964 (85%), Positives = 873/964 (90%)

Query: 1   MTDHESLDLKQNQEGGGVCRRHSLSSEQDSSVEDNNEQPSSYEEETDDDMQYYERSIQEI 60
           MT+HESL L+QNQ+GG   R H+LS    SSVED NEQPSSYEEE+DDDMQYYER+IQEI
Sbjct: 1   MTEHESLGLEQNQDGGDTYRHHNLSDGCISSVEDANEQPSSYEEESDDDMQYYERAIQEI 60

Query: 61  SKGDSYICMICTVEMDYTCQMFACKRCYRVFDYGCIREWAIKSTEKTVDRIWKCPNCYHV 120
           S GDSY+CMICTVEMDYTCQMFACKRCYRVFDYGCIREWA+KSTEKTVDRIWKCPNCY+V
Sbjct: 61  SSGDSYVCMICTVEMDYTCQMFACKRCYRVFDYGCIREWALKSTEKTVDRIWKCPNCYYV 120

Query: 121 GKKVPANNRPTCWCGKVVXXXXXXXXXXSCGQTCSAPICIHGCSKTCHLGPHPECTRMVE 180
            K+VP  NRPTCWCGKVV          SCGQTC+A  C+HGCSK CHLGPHPECTRMVE
Sbjct: 121 SKRVPVKNRPTCWCGKVVNPDPNPLDPNSCGQTCNASTCMHGCSKICHLGPHPECTRMVE 180

Query: 181 IMCHCGKHSQSIFCYQSKAMKKNFKCQEECGLPLSCSVHNCKRKCHTGLCGPCPELITSK 240
           IMCHCGKHS+SIFCYQSK MKKNF CQE CGLPLSCS+H CK+KCH GLCGPCPE+I SK
Sbjct: 181 IMCHCGKHSKSIFCYQSKVMKKNFNCQEVCGLPLSCSIHTCKKKCHPGLCGPCPEMIISK 240

Query: 241 DSTEEQIKCYCGNHSRASIKCSEARFPKSGRSSKDGNGNEWIGVFACTDIRTVDFSCRKH 300
           DS ++QIKCYCGNH+RA+IKCSE +FPKSG+SSKD NGN WIGVFAC D R VD+SCRKH
Sbjct: 241 DSPKKQIKCYCGNHTRANIKCSETKFPKSGKSSKDENGNRWIGVFACADNRVVDYSCRKH 300

Query: 301 SFIEPCLSPPSVNGRKVCPFLPSLLKTCPCGRTALDELTKPRKHCDDPIPTCNSRCSKPL 360
           SFIE C+SPP++NG K CPFLPS LKTCPCGRTAL+ELTKPRKHCDDPIPTC+SRC KPL
Sbjct: 301 SFIESCISPPTINGEKACPFLPSSLKTCPCGRTALEELTKPRKHCDDPIPTCDSRCGKPL 360

Query: 361 KCGKHSCPFICHDLACMDPCLQIDSAKCACEQSTFSVPCGFQGRPRCNIKCESLMSCRRH 420
           KCGKHSCPF CHD ACM+PCLQIDS KCACEQSTFSVPCGFQGRPRCNIKCESLMSCRRH
Sbjct: 361 KCGKHSCPFTCHDKACMEPCLQIDSVKCACEQSTFSVPCGFQGRPRCNIKCESLMSCRRH 420

Query: 421 RCTDRCCSGRPSAVKRRKNFFRSQDLLDESLVEAKHICLKPCNLTLSCGIHKCQRKCHPG 480
           RCTDRCCSGRPSA++R+KN FR+QDLLDESLVEAKHICLKPCNLTLSCGIHKCQRKCHPG
Sbjct: 421 RCTDRCCSGRPSAIRRKKNLFRTQDLLDESLVEAKHICLKPCNLTLSCGIHKCQRKCHPG 480

Query: 481 KCPPCLESDSNDLICPCGKTVVPAPVRCGTELPVCNHPCIKVVRGESSCGHKPMPHTCHP 540
           KCPPCLESDSNDL+CPCG TVVPAPVRCGT+LP CNHPCIKVVRGES+CGHKPMPHTCH 
Sbjct: 481 KCPPCLESDSNDLVCPCGNTVVPAPVRCGTKLPTCNHPCIKVVRGESTCGHKPMPHTCHS 540

Query: 541 LGVPCPPCTETVFKPCKCGKKDKVRTVCFQKDVSCGTKCGLLLHFCRHTCQKTCHLPGNC 600
           L V CPPCTETVFKPCKCGKK KVRTVCFQ DVSCG KCG+ L +C HTCQKTCHLPGNC
Sbjct: 541 LDVSCPPCTETVFKPCKCGKKTKVRTVCFQTDVSCGIKCGIPLSYCYHTCQKTCHLPGNC 600

Query: 601 QKVCKQICGHERLSCRHTCPKPCHGKTECPDLPCPTLVKITCKCGRNEKSVTCSAKSGVV 660
           QKVCKQ CG +RL+C H CPKPCHGKTECPDLPC TLVKI CKCGR +KSVTC AKS  V
Sbjct: 601 QKVCKQTCGQKRLNCNHECPKPCHGKTECPDLPCATLVKIYCKCGRIKKSVTCGAKSDRV 660

Query: 661 PANESSVLDCDEECEALKRLKELREAFGIKEESNNVTSNELDALKKLVSVATTFEELHLP 720
              ESSVLDC+EECEALKRLKEL+EAFGIKEE+NN TSNELDALKKLVSVATTFEEL LP
Sbjct: 661 SVTESSVLDCNEECEALKRLKELKEAFGIKEETNNFTSNELDALKKLVSVATTFEELQLP 720

Query: 721 FTETTLSVYSKQERWCSQIEVILNKLMDDKTRSSLHFKPMRPPQRHFIRELAKAYGLYSE 780
           FTE  LSVYSKQERWCSQIE ILNKLMDDKTRSSLHFKPMRPPQRHFIRELAKAYGLYSE
Sbjct: 721 FTEAALSVYSKQERWCSQIEAILNKLMDDKTRSSLHFKPMRPPQRHFIRELAKAYGLYSE 780

Query: 781 SQDREPMRSVFIKKEDNGTSNKPVLSLGEALPLYESFKQLQKERKVQEFQSRTTAKLINF 840
           SQDREPMRSVFIKKEDNG SNKPVLSL EA PLYESFKQLQKERK QEFQ+RTTAKLINF
Sbjct: 781 SQDREPMRSVFIKKEDNGASNKPVLSLAEAYPLYESFKQLQKERKAQEFQARTTAKLINF 840

Query: 841 EVQDAQPKVEVAKNNGFLVRNLVTGNTVEDLKRFFEPHLKHTLVVNPQYLILDDGKTALV 900
           EVQD +PKVEVAK NGFLV+NLV GNT EDL+RFFEPHLKHTLVVNPQYLILDDGKTALV
Sbjct: 841 EVQDTEPKVEVAKKNGFLVQNLVAGNTAEDLRRFFEPHLKHTLVVNPQYLILDDGKTALV 900

Query: 901 YPENYETASVNTERDMELLVGHFDFMAKEAFLADSILLCSTDEEVGKRLDTPVIQEDTSI 960
           YPENYETASVNTERDMELLVGHFDFMAKEAFLADSI LCST+EE+ +RLDTPVIQED+ +
Sbjct: 901 YPENYETASVNTERDMELLVGHFDFMAKEAFLADSISLCSTEEELERRLDTPVIQEDSPV 960

Query: 961 EDKN 964
            D N
Sbjct: 961 MDNN 964

>Skud_14.306 Chr14 complement(558943..561855) [2913 bp, 970 aa] {ON}
           YNL023C (REAL)
          Length = 970

 Score = 1632 bits (4225), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 782/966 (80%), Positives = 857/966 (88%), Gaps = 2/966 (0%)

Query: 1   MTDHESLDLKQNQEGGGVCRRHSLSSEQDSSVEDNNEQPSSYE--EETDDDMQYYERSIQ 58
           +T+HESLDL+Q+Q GGG+ + HSLS+    SVED++EQ SSYE  EE+DDD+QYYER+IQ
Sbjct: 4   ITEHESLDLEQDQNGGGIHKHHSLSNGHVLSVEDSSEQLSSYEFEEESDDDLQYYERAIQ 63

Query: 59  EISKGDSYICMICTVEMDYTCQMFACKRCYRVFDYGCIREWAIKSTEKTVDRIWKCPNCY 118
           EI+KGDSYICMICTVEMDYTCQMFACK+CYRVFDY CIREWA+KSTEKTVD+IWKCPNCY
Sbjct: 64  EIAKGDSYICMICTVEMDYTCQMFACKKCYRVFDYACIREWALKSTEKTVDKIWKCPNCY 123

Query: 119 HVGKKVPANNRPTCWCGKVVXXXXXXXXXXSCGQTCSAPICIHGCSKTCHLGPHPECTRM 178
           HVGKKVP  NRPTCWCG VV          SCGQTC+AP C+HGC K CHLGPHPECTRM
Sbjct: 124 HVGKKVPTRNRPTCWCGNVVNPDPNQLDPNSCGQTCNAPTCVHGCFKICHLGPHPECTRM 183

Query: 179 VEIMCHCGKHSQSIFCYQSKAMKKNFKCQEECGLPLSCSVHNCKRKCHTGLCGPCPELIT 238
           VEI CHCG+HS++IFCYQSKAM++ F CQEECGL LSC VH CK+KCH+GLCG CPE I 
Sbjct: 184 VEIKCHCGRHSKTIFCYQSKAMRRRFNCQEECGLSLSCGVHKCKKKCHSGLCGSCPEFII 243

Query: 239 SKDSTEEQIKCYCGNHSRASIKCSEARFPKSGRSSKDGNGNEWIGVFACTDIRTVDFSCR 298
           + DS+++QIKCYCGNH + SIKCSEARFPKSGR+SKD +GNEW GVFAC DIRTVD++C 
Sbjct: 244 NDDSSKKQIKCYCGNHIQNSIKCSEARFPKSGRTSKDESGNEWAGVFACADIRTVDYACH 303

Query: 299 KHSFIEPCLSPPSVNGRKVCPFLPSLLKTCPCGRTALDELTKPRKHCDDPIPTCNSRCSK 358
           KHSFIEPCLSPP+++G+K CPFLPSLLKTCPCGRTAL+ELTKPRKHC DPIPTCNSRCSK
Sbjct: 304 KHSFIEPCLSPPTISGQKTCPFLPSLLKTCPCGRTALEELTKPRKHCHDPIPTCNSRCSK 363

Query: 359 PLKCGKHSCPFICHDLACMDPCLQIDSAKCACEQSTFSVPCGFQGRPRCNIKCESLMSCR 418
           PLKCGKH CPF CHD ACMDPCLQIDSA C+CEQSTFS+PCGFQ  PRCNIKCESLMSCR
Sbjct: 364 PLKCGKHLCPFTCHDGACMDPCLQIDSANCSCEQSTFSIPCGFQESPRCNIKCESLMSCR 423

Query: 419 RHRCTDRCCSGRPSAVKRRKNFFRSQDLLDESLVEAKHICLKPCNLTLSCGIHKCQRKCH 478
           RHRC DRCCSGRPSA++R+K+FFRSQDLLDESLVEAKHICLKPCNLTLSCG+HKCQRKCH
Sbjct: 424 RHRCIDRCCSGRPSAIRRKKSFFRSQDLLDESLVEAKHICLKPCNLTLSCGLHKCQRKCH 483

Query: 479 PGKCPPCLESDSNDLICPCGKTVVPAPVRCGTELPVCNHPCIKVVRGESSCGHKPMPHTC 538
           PGKCPPCLESDSNDLIC CGKTVVPAPVRCGT+LP CNHPCIKVVRGES CGHKPMPHTC
Sbjct: 484 PGKCPPCLESDSNDLICACGKTVVPAPVRCGTKLPTCNHPCIKVVRGESWCGHKPMPHTC 543

Query: 539 HPLGVPCPPCTETVFKPCKCGKKDKVRTVCFQKDVSCGTKCGLLLHFCRHTCQKTCHLPG 598
           HP  + CPPCTETVFKPC+CGKKDKVRTVCFQ DVSCGT CG+ L  C HTCQKTCHL G
Sbjct: 544 HPSNISCPPCTETVFKPCRCGKKDKVRTVCFQADVSCGTSCGIPLSGCYHTCQKTCHLLG 603

Query: 599 NCQKVCKQICGHERLSCRHTCPKPCHGKTECPDLPCPTLVKITCKCGRNEKSVTCSAKSG 658
            CQKVCKQICG +RL C HTCPKPCHGKTECPDLPC  LVKITC+CGR +KS+TCSAK  
Sbjct: 604 KCQKVCKQICGQKRLDCIHTCPKPCHGKTECPDLPCAALVKITCECGRIKKSITCSAKRD 663

Query: 659 VVPANESSVLDCDEECEALKRLKELREAFGIKEESNNVTSNELDALKKLVSVATTFEELH 718
            V    SS+LDC+EECE LKRLKELREAFG+ E  NNV  NELDAL +LVSVA TFEEL 
Sbjct: 664 TVSVITSSILDCNEECETLKRLKELREAFGVSEGPNNVIRNELDALSELVSVAKTFEELQ 723

Query: 719 LPFTETTLSVYSKQERWCSQIEVILNKLMDDKTRSSLHFKPMRPPQRHFIRELAKAYGLY 778
           LPFTE TLSVYSKQERWC QIE ILNKLMD + RSSLHFKPMRPPQRHFI E+AKAY LY
Sbjct: 724 LPFTEATLSVYSKQERWCLQIEGILNKLMDSEIRSSLHFKPMRPPQRHFIHEMAKAYNLY 783

Query: 779 SESQDREPMRSVFIKKEDNGTSNKPVLSLGEALPLYESFKQLQKERKVQEFQSRTTAKLI 838
           +ESQDREPMRSVFIKKEDN TS KPVLSL EA PLYESFKQ QKERK+QEFQ+RTTAKLI
Sbjct: 784 AESQDREPMRSVFIKKEDNCTSKKPVLSLAEAYPLYESFKQSQKERKLQEFQARTTAKLI 843

Query: 839 NFEVQDAQPKVEVAKNNGFLVRNLVTGNTVEDLKRFFEPHLKHTLVVNPQYLILDDGKTA 898
           NFEVQDA+ K+E AKNNGFLV+NLV+GNTVEDLKRFFEPHLKHTLV NPQYLILDD ++A
Sbjct: 844 NFEVQDAESKIEAAKNNGFLVQNLVSGNTVEDLKRFFEPHLKHTLVANPQYLILDDSRSA 903

Query: 899 LVYPENYETASVNTERDMELLVGHFDFMAKEAFLADSILLCSTDEEVGKRLDTPVIQEDT 958
           L+YPENYETASVNTERDMELLVGHFDFMAKEAFLADSI LCS DEE+GKRLD+P IQE +
Sbjct: 904 LIYPENYETASVNTERDMELLVGHFDFMAKEAFLADSIHLCSVDEEIGKRLDSPAIQEVS 963

Query: 959 SIEDKN 964
           S E+K+
Sbjct: 964 SPEEKD 969

>Suva_14.324 Chr14 complement(571146..574052) [2907 bp, 968 aa] {ON}
           YNL023C (REAL)
          Length = 968

 Score = 1600 bits (4142), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 771/965 (79%), Positives = 847/965 (87%), Gaps = 3/965 (0%)

Query: 2   TDHESLDLKQNQEGGGVCRRHSLSSEQDSSVEDNNEQPSSY--EEETDDDMQYYERSIQE 59
            + ESLDL+Q+Q G  V   H L+ E  S VE ++EQ S+Y  EEE+DDDMQYYER+IQE
Sbjct: 5   NERESLDLEQSQNGSDV-HEHCLNDEHVSGVEVSHEQSSTYDSEEESDDDMQYYERAIQE 63

Query: 60  ISKGDSYICMICTVEMDYTCQMFACKRCYRVFDYGCIREWAIKSTEKTVDRIWKCPNCYH 119
           I+KGDSYICMICTVEMDYTCQMFACK+CYRVFDY CIREWA+KSTEKTVD+IWKCPNCYH
Sbjct: 64  IAKGDSYICMICTVEMDYTCQMFACKKCYRVFDYACIREWALKSTEKTVDKIWKCPNCYH 123

Query: 120 VGKKVPANNRPTCWCGKVVXXXXXXXXXXSCGQTCSAPICIHGCSKTCHLGPHPECTRMV 179
           +GKKVP  NRPTCWCGKVV          SCGQTC+AP C+HGCSK CHLGPHPECTR V
Sbjct: 124 IGKKVPTRNRPTCWCGKVVNPDHNPLDPNSCGQTCNAPTCVHGCSKICHLGPHPECTRTV 183

Query: 180 EIMCHCGKHSQSIFCYQSKAMKKNFKCQEECGLPLSCSVHNCKRKCHTGLCGPCPELITS 239
           EI C CGKHS+SIFCYQSKAMKK+F CQEECGLPLSC +H CK+KCH+GLCGPCPELI S
Sbjct: 184 EIKCRCGKHSKSIFCYQSKAMKKHFDCQEECGLPLSCGIHKCKKKCHSGLCGPCPELIMS 243

Query: 240 KDSTEEQIKCYCGNHSRASIKCSEARFPKSGRSSKDGNGNEWIGVFACTDIRTVDFSCRK 299
           +D   + IKCYCG HS+ SIKC E  FPKSGRSSKD +GNEWIGVFAC DIRTVD++C K
Sbjct: 244 EDKAMDWIKCYCGIHSKDSIKCCEVNFPKSGRSSKDESGNEWIGVFACKDIRTVDYACHK 303

Query: 300 HSFIEPCLSPPSVNGRKVCPFLPSLLKTCPCGRTALDELTKPRKHCDDPIPTCNSRCSKP 359
           HSFIEPC+SPP+VNG+K CPFLPSLLKTCPCGRTAL+ELTKPRKHC DPIPTC+SRCSKP
Sbjct: 304 HSFIEPCISPPTVNGKKTCPFLPSLLKTCPCGRTALEELTKPRKHCTDPIPTCSSRCSKP 363

Query: 360 LKCGKHSCPFICHDLACMDPCLQIDSAKCACEQSTFSVPCGFQGRPRCNIKCESLMSCRR 419
           LKCGKHSCPFICHD ACMDPCLQ DS KCACEQSTF VPCGFQ +P CNIKCESLMSCRR
Sbjct: 364 LKCGKHSCPFICHDGACMDPCLQTDSVKCACEQSTFLVPCGFQEKPHCNIKCESLMSCRR 423

Query: 420 HRCTDRCCSGRPSAVKRRKNFFRSQDLLDESLVEAKHICLKPCNLTLSCGIHKCQRKCHP 479
           HRC DRCCSGRPSA++R+K  FRSQDL+DESLVEA+HICLKPCNLTLSCGIHKCQRKCHP
Sbjct: 424 HRCIDRCCSGRPSALERKKRIFRSQDLMDESLVEAQHICLKPCNLTLSCGIHKCQRKCHP 483

Query: 480 GKCPPCLESDSNDLICPCGKTVVPAPVRCGTELPVCNHPCIKVVRGESSCGHKPMPHTCH 539
           GKCPPCLESDSNDL+CPCGKTV+PAPVRCGT+LP+CN+ CIKVVRGES CGHKPMPHTCH
Sbjct: 484 GKCPPCLESDSNDLVCPCGKTVIPAPVRCGTKLPLCNYACIKVVRGESECGHKPMPHTCH 543

Query: 540 PLGVPCPPCTETVFKPCKCGKKDKVRTVCFQKDVSCGTKCGLLLHFCRHTCQKTCHLPGN 599
           PL + CPPCTETVFKPCKCGKKDKVRTVCFQ DVSCGT CG  L  C HTCQKTCHLP N
Sbjct: 544 PLDLACPPCTETVFKPCKCGKKDKVRTVCFQTDVSCGTTCGKPLSGCHHTCQKTCHLPEN 603

Query: 600 CQKVCKQICGHERLSCRHTCPKPCHGKTECPDLPCPTLVKITCKCGRNEKSVTCSAKSGV 659
           CQKVCKQIC  +R +C H CPKPCHG++ECPDLPC +LVKITCKCGR EK V C AKS V
Sbjct: 604 CQKVCKQICRQKRPNCDHACPKPCHGRSECPDLPCASLVKITCKCGRIEKKVACGAKSNV 663

Query: 660 VPANESSVLDCDEECEALKRLKELREAFGIKEESNNVTSNELDALKKLVSVATTFEELHL 719
           V   E+  LDC+EECEALKRLKELREAFGI EESN  T+NELD LKKLVSVATTFEEL L
Sbjct: 664 VSVTEAPQLDCNEECEALKRLKELREAFGISEESNESTNNELDTLKKLVSVATTFEELQL 723

Query: 720 PFTETTLSVYSKQERWCSQIEVILNKLMDDKTRSSLHFKPMRPPQRHFIRELAKAYGLYS 779
           PFTET LSVY+KQE WC QIE I+NKLM DKTRSSLHFKPMRPPQRHFIRELAKAY LYS
Sbjct: 724 PFTETVLSVYAKQEGWCLQIENIVNKLMSDKTRSSLHFKPMRPPQRHFIRELAKAYNLYS 783

Query: 780 ESQDREPMRSVFIKKEDNGTSNKPVLSLGEALPLYESFKQLQKERKVQEFQSRTTAKLIN 839
           ESQDREPMRSVFIKKEDN  S++P+LSL EA PLYESFK+LQKERK+QEFQ+RTTAKLIN
Sbjct: 784 ESQDREPMRSVFIKKEDNSKSSRPILSLAEAFPLYESFKELQKERKIQEFQARTTAKLIN 843

Query: 840 FEVQDAQPKVEVAKNNGFLVRNLVTGNTVEDLKRFFEPHLKHTLVVNPQYLILDDGKTAL 899
           FEV+DA+PKVE+AKNNGFLV+ LV GN V+DL+RFFEPHLKHTLVV PQYLI+DDGKTAL
Sbjct: 844 FEVRDAEPKVELAKNNGFLVQKLVNGNDVDDLRRFFEPHLKHTLVVKPQYLIIDDGKTAL 903

Query: 900 VYPENYETASVNTERDMELLVGHFDFMAKEAFLADSILLCSTDEEVGKRLDTPVIQEDTS 959
           VYPENY+  SVNTERDM++LVGHFDFMAKEAFLADSI LCS DEE+G+RLD PV Q D+ 
Sbjct: 904 VYPENYQEVSVNTERDMDILVGHFDFMAKEAFLADSISLCSIDEELGRRLDPPVTQGDSL 963

Query: 960 IEDKN 964
            +++N
Sbjct: 964 AKEEN 968

>NDAI0G00670 Chr7 (146574..149480) [2907 bp, 968 aa] {ON} Anc_2.288
           YNL023C
          Length = 968

 Score = 1269 bits (3284), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 603/941 (64%), Positives = 725/941 (77%), Gaps = 9/941 (0%)

Query: 25  SSEQDSSVEDNNE--QPSSYEEET--DDDMQYYERSIQEISKGDSYICMICTVEMDYTCQ 80
           SSE  SS  DN+E  Q   Y   T  D+DM+YYER+IQEI+KGDSY+CMICTVEMDYTCQ
Sbjct: 29  SSENVSSTSDNDEYDQEDEYAAATAADEDMKYYERTIQEIAKGDSYVCMICTVEMDYTCQ 88

Query: 81  MFACKRCYRVFDYGCIREWAIKSTEKTVDRIWKCPNCYHVGKKVPANNRPTCWCGKVVXX 140
           M+ACK CYRVFDY CIREWA+KSTEKTVDRIWKCPNCYHV KKVP  NR TCWCGKVV  
Sbjct: 89  MYACKECYRVFDYDCIREWAVKSTEKTVDRIWKCPNCYHVNKKVPPKNRSTCWCGKVVNP 148

Query: 141 XXXXXXXXSCGQTCSAPICIHGCSKTCHLGPHPECTRMVEIMCHCGKHSQSIFCYQSKAM 200
                   SCGQTC+A IC+HGC+  CHLGPHPECTRM+ I C CGKH++ IFCYQSK  
Sbjct: 149 EANPLNPNSCGQTCNAKICVHGCTNICHLGPHPECTRMLSITCRCGKHTKDIFCYQSKTF 208

Query: 201 KKN--FKCQEECGLPLSCSVHNCKRKCHTGLCGPCPELITSKDSTEEQIKCYCGNHSRAS 258
           K N  F+C++ECGLPLSC +H CKRKCH+GLCG CPE +   +     +KCYCG+ ++ S
Sbjct: 209 KGNSKFQCKDECGLPLSCGIHKCKRKCHSGLCGVCPERLEVNEENAWILKCYCGSETQKS 268

Query: 259 IKCSEARFPKSGRSSKDGNGNEWIGVFACTDIRTVDFSCRKHSFIEPCLSPPSVNGRKVC 318
           +KC + + P+S + S D  GN+WIGVFAC +IRTV + C KHSFIE C++PP+++  K C
Sbjct: 269 MKCKDIKIPESAKYSSDAEGNKWIGVFACKEIRTVQYDCDKHSFIERCIAPPTLSMEKPC 328

Query: 319 PFLPSLLKTCPCGRTALDELTKPRKHCDDPIPTCNSRCSKPLKCGKHSCPFICHDLACMD 378
           P+ P LLKTCPCG+T L +L KPR  C DPIPTC S C+KPLKCGKH CPF CH  ACMD
Sbjct: 329 PYSPKLLKTCPCGKTPLQKLAKPRTLCTDPIPTCESHCNKPLKCGKHKCPFKCHTGACMD 388

Query: 379 PCLQIDSAKCACEQSTFSVPCGFQGRPRCNIKCESLMSCRRHRCTDRCCSGRPSAVKRRK 438
           PCLQI++ KC+CEQ +F VPC F G P CNIKCESLMSCRRHRC +RCCSGRP+A KR+K
Sbjct: 389 PCLQIETRKCSCEQQSFLVPCQFTGSPHCNIKCESLMSCRRHRCLERCCSGRPAAEKRKK 448

Query: 439 NFFRSQDLLDESLVEAKHICLKPCNLTLSCGIHKCQRKCHPGKCPPCLESDSNDLICPCG 498
             FRSQDL+DE+LVEA+HICLK CNL LSCGIH+CQRKCHPGKCPPCLESDSNDL+CPCG
Sbjct: 449 TLFRSQDLMDETLVEAEHICLKECNLLLSCGIHRCQRKCHPGKCPPCLESDSNDLVCPCG 508

Query: 499 KTVVPAPVRCGTELPVCNHPCIKVVRGESSCGHKPMPHTCHPLGVPCPPCTETVFKPCKC 558
           KT+V APVRCGT+LP C   CIKVVR E  CGH PMPHTCHPL  PCPPCT  VFKPCKC
Sbjct: 509 KTIVEAPVRCGTKLPPCPFQCIKVVRNEYPCGHTPMPHTCHPLDEPCPPCTAPVFKPCKC 568

Query: 559 GKKDKVRTVCFQKDVSCGTKCGLLLHFCRHTCQKTCHLPGNCQKVCKQICGHERLSCRHT 618
           GK  +VRT+CFQ DVSCG  CGL L  C H C K CH+PG+CQ  CKQICG  R++C HT
Sbjct: 569 GKVKEVRTLCFQNDVSCGKICGLPLKDCPHKCMKRCHIPGDCQTKCKQICGKRRINCDHT 628

Query: 619 CPKPCHGKTECPDLPCPTLVKITCKCGRNEKSVTCSAKSGVVPANESSVLDCDEECEALK 678
           C +PCHG TECPD+PC    K+TC+CGR E  VTC A S +  A  +++L+CDEECE L+
Sbjct: 629 CSRPCHGNTECPDVPCTVSAKVTCECGRRETYVTCGAMSNIASAVTTTILECDEECEMLE 688

Query: 679 RLKELREAFGIKEESNNVTSNELDALKKLVSVATTFEELHLPFTETTLSVYSKQERWCSQ 738
           R ++L+EAFGIKE  ++ T  E + LK +V  A  FEEL LPFTE TLS++S+QERWC Q
Sbjct: 689 RHRQLKEAFGIKEIISSSTDLEFERLKDIVPTAIAFEELQLPFTEATLSIFSRQERWCQQ 748

Query: 739 IEVILNKLMDDKTRSSLHFKPMRPPQRHFIRELAKAYGLYSESQDREPMRSVFIKKEDNG 798
           IE I+NK MDDK+R SLHFKPMRPPQRHFI EL+KAY LY ESQD EP RSVFIKK  N 
Sbjct: 749 IEEIINKFMDDKSRPSLHFKPMRPPQRHFIHELSKAYNLYCESQDPEPKRSVFIKK--NT 806

Query: 799 TSNKPVLSLGEALPLYESFKQLQKERKVQEFQSRTTAKLINFEVQDAQPKVEVAKNNGFL 858
           TS+KP  SL + LPLY++FK+L+KERK+QEF++RT+ +L+N EV +      +A+ NGFL
Sbjct: 807 TSSKPSFSLSKVLPLYQTFKELEKERKLQEFEARTSKRLVNVEVPEGPTDNYIAEANGFL 866

Query: 859 VRNLVTGNTVEDLKRFFEPHLKHTLVVNPQYLILDDGKTALVYPENYETASVNTERDMEL 918
           +++L  G TVEDL+R F  +LK TL+ NPQYL+L DGK+ ++YPE+Y T + N ERD + 
Sbjct: 867 IKDLSPGTTVEDLERIFGQYLKSTLIKNPQYLVLQDGKSGVIYPEDYPTITANVERDFKS 926

Query: 919 LVGHFDFMAKEAFLADSILLCSTDEEVG-KRLDTPVIQEDT 958
           LVGHFD +AK+ F+++ + LC  D+ +  +RL TP I E T
Sbjct: 927 LVGHFDVLAKDTFISEGVELCKIDDVLSTERLATPAIDEST 967

>NCAS0G03780 Chr7 complement(696877..699750) [2874 bp, 957 aa] {ON} 
          Length = 957

 Score = 1253 bits (3241), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 601/938 (64%), Positives = 732/938 (78%), Gaps = 9/938 (0%)

Query: 26  SEQDSSVEDNNEQPSSYEEE----TDDDMQYYERSIQEISKGDSYICMICTVEMDYTCQM 81
           S+ DS+ E  N   S YE +     DD M YYER+IQEI+KGDSY+CMICTVEMDYTCQM
Sbjct: 22  SDDDSNGESGNSDSSEYESDFAGMDDDAMHYYERAIQEIAKGDSYVCMICTVEMDYTCQM 81

Query: 82  FACKRCYRVFDYGCIREWAIKSTEKTVDRIWKCPNCYHVGKKVPANNRPTCWCGKVVXXX 141
           +ACK+CYRVFDY CIREWA+KSTEKTVDRIWKCPNCYHV KKVP  NRPTCWCGKVV   
Sbjct: 82  YACKQCYRVFDYECIREWALKSTEKTVDRIWKCPNCYHVNKKVPPKNRPTCWCGKVVNPE 141

Query: 142 XXXXXXXSCGQTCSAPICIHGCSKTCHLGPHPECTRMVEIMCHCGKHSQSIFCYQSKAM- 200
                  SCGQTC+A  C+HGCSK CHLGPHPECTR++ I C CGKH++ I CYQS  + 
Sbjct: 142 PNPLNPNSCGQTCNAHTCVHGCSKICHLGPHPECTRIITIKCRCGKHTKDISCYQSSLLR 201

Query: 201 -KKNFKCQEECGLPLSCSVHNCKRKCHTGLCGPCPELITSKDSTEEQIKCYCGNHSRASI 259
            K  F+C E CGLPL+C +H C++KCH+GLCG CPE++ +K+  +  I+CYCG+  R +I
Sbjct: 202 GKDKFQCDEPCGLPLACGLHRCQKKCHSGLCGICPEILNTKEYLDAHIRCYCGSQDRDTI 261

Query: 260 KCSEARFPKSGRSSKDGNGNEWIGVFACTDIRTVDFSCRKHSFIEPCLSPPSVNGRKVCP 319
           KC +   P S   S++  G +W+GVF C +IR VD+ C +HSF+E C++PP+++G K CP
Sbjct: 262 KCRDVHVPLSASLSQNLKGEKWVGVFKCDNIRNVDYKCHEHSFVEQCIAPPTIDGTKPCP 321

Query: 320 FLPSLLKTCPCGRTALDELTKPRKHCDDPIPTCNSRCSKPLKCGKHSCPFICHDLACMDP 379
           F P LLKTCPCG+T L EL + RK C DPIPTC+SRC KPLKCG+H+CPFICH   CMDP
Sbjct: 322 FSPKLLKTCPCGKTPLKELVESRKKCTDPIPTCDSRCGKPLKCGRHTCPFICHVGPCMDP 381

Query: 380 CLQIDSAKCACEQSTFSVPCGFQGRPRCNIKCESLMSCRRHRCTDRCCSGRPSAVKRRKN 439
           CLQID  KC+C Q +F VPC F   P+C  KCESLMSCRRHRCT+RCC+GRP A  R+K 
Sbjct: 382 CLQIDKKKCSCNQQSFLVPCQFHQDPQCTTKCESLMSCRRHRCTERCCAGRPRAEARKKR 441

Query: 440 FFRSQDLLDESLVEAKHICLKPCNLTLSCGIHKCQRKCHPGKCPPCLESDSNDLICPCGK 499
            FRSQDL+DESLVE +HICLK CNL LSCG HKCQRKCHPGKCPPCLESDSNDL+CPCG+
Sbjct: 442 LFRSQDLMDESLVEPQHICLKECNLMLSCGKHKCQRKCHPGKCPPCLESDSNDLVCPCGR 501

Query: 500 TVVPAPVRCGTELPVCNHPCIKVVRGESSCGHKPMPHTCHPLGVPCPPCTETVFKPCKCG 559
           T++ APVRCGT+LP C +PCIKVVRGE  CGH PMPHTCHPL  PCPPCT +VFKPCKCG
Sbjct: 502 TIIEAPVRCGTKLPPCPYPCIKVVRGEYPCGHTPMPHTCHPLNEPCPPCTASVFKPCKCG 561

Query: 560 KKDKVRTVCFQKDVSCGTKCGLLLHFCRHTCQKTCHLPGNCQKVCKQICGHERLSCRHTC 619
           K DKVRT+CFQ DVSCG  CGL L  C HTCQK CHL G CQK CKQIC  +R++C HTC
Sbjct: 562 KVDKVRTLCFQNDVSCGKICGLPLENCNHTCQKRCHLLGECQKTCKQICKKKRINCEHTC 621

Query: 620 PKPCHGKTECPDLPCPTLVKITCKCGRNEKSVTCSAKSGVVPANESSVLDCDEECEALKR 679
            KPCHGKT+CPD+PC   +KITC+CGR E  VTC A S +  A   + ++CDEECE L+R
Sbjct: 622 LKPCHGKTDCPDIPCSVSIKITCECGRKETYVTCGATSTIPSAATKTHIECDEECELLER 681

Query: 680 LKELREAFGIKEESNNVTSNELDALKKLVSVATTFEELHLPFTETTLSVYSKQERWCSQI 739
            ++L+EAFGI  +SN  TS E++ LK L  VATTFEEL LP+ ETTLS+Y+KQE+WC QI
Sbjct: 682 HRQLKEAFGIV-DSNRSTSLEVEKLKDLAKVATTFEELQLPYNETTLSIYAKQEKWCDQI 740

Query: 740 EVILNKLMDDKTRSSLHFKPMRPPQRHFIRELAKAYGLYSESQDREPMRSVFIKKEDNGT 799
           E ILNKLMDDK R SLHFKPMRPPQRHFI+E AK++ LY+E+QDREP RSVF+KKE++G+
Sbjct: 741 EEILNKLMDDKARPSLHFKPMRPPQRHFIQEFAKSFNLYAEAQDREPKRSVFVKKEEDGS 800

Query: 800 SNKPVLSLGEALPLYESFKQLQKERKVQEFQSRTTAKLINFEVQDAQPKVEVAKNNGFLV 859
           S+KP++SL +ALPLY++FK+L+KERK++EF++RTT +LIN E    +  V  AK +GFL+
Sbjct: 801 SSKPIISLHDALPLYQTFKELEKERKLKEFEARTTTRLINVEAPQ-EDNVYHAKYSGFLI 859

Query: 860 RNLVTGNTVEDLKRFFEPHLKHTLVVNPQYLILDDGKTALVYPENYETASVNTERDMELL 919
           + +  G TVEDL+R F   L  TL+VNPQYLI+ DGK AL+YPENY+  S   ERD+E L
Sbjct: 860 KKISPGTTVEDLQRIFGQFLTSTLIVNPQYLIIQDGKDALIYPENYQEMSAGVERDLETL 919

Query: 920 VGHFDFMAKEAFLADSILLCSTD-EEVGKRLDTPVIQE 956
           VGHFDF++KE F+AD + LC  +   +G+RL+TP+++E
Sbjct: 920 VGHFDFISKENFIADGVELCDVEVAMLGERLETPILEE 957

>KNAG0H01990 Chr8 complement(349855..352776) [2922 bp, 973 aa] {ON}
           Anc_2.288 YNL023C
          Length = 973

 Score = 1170 bits (3026), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 564/955 (59%), Positives = 696/955 (72%), Gaps = 25/955 (2%)

Query: 25  SSEQDSSVEDN-------NEQPSSYEEETDDDMQYYERSIQEISKGDSYICMICTVEMDY 77
           S ++DS+ E N        E+ ++ + E D D+ YYER+++EI+KGD Y CMICTVEMDY
Sbjct: 19  SDDEDSATEANITYSEEEEEEIATSDTEEDQDLPYYERAVREIAKGDLYTCMICTVEMDY 78

Query: 78  TCQMFACKRCYRVFDYGCIREWAIKSTEKTVDRIWKCPNCYHVGKKVPANNRPTCWCGKV 137
           TC+MFAC++CYRVFDY C+REWAIKST+KTVDRIWKCPNCY V KKVP  NRPTCWCGKV
Sbjct: 79  TCKMFACRKCYRVFDYDCVREWAIKSTDKTVDRIWKCPNCYLVNKKVPTKNRPTCWCGKV 138

Query: 138 VXXXXXXXXXXSCGQTCSAPICIHGCSKTCHLGPHPECTRMVEIMCHCGKHSQSIFCYQS 197
           V          SCGQTC A ICIHGCSK CHLGPHPEC R   + C CGK ++ I C+++
Sbjct: 139 VNPEPNPLDPNSCGQTCDAKICIHGCSKICHLGPHPECLRTTSVKCRCGKATKEIPCFET 198

Query: 198 KAMKKN--FKCQEECGLPLSCSVHNCKRKCHTGLCGPCPELITSKDSTEEQIKCYCGNHS 255
           K  +    F+C E C   L C +H C++ CH+GLCG CPE +T K+  +  I CYCG H+
Sbjct: 199 KGRRGRNLFQCNEPCNSLLPCGIHRCQKICHSGLCGSCPENLTVKEGDDVSISCYCGQHT 258

Query: 256 RASIKCSEARFPKSGRSSKDGNGNEWIGVFACTDIRTVDFSCRKHSFIEPCLSPPSVNGR 315
           R SIKC +     +GR SK+ NG+EWIGV+AC DIR+V++SCR+HSF E C++PP+V G 
Sbjct: 259 RNSIKCKDVNV--TGRKSKNANGDEWIGVYACKDIRSVEYSCRQHSFFEECIAPPTVTGT 316

Query: 316 KVCPFLPSLLKTCPCGRTALDELTKPRKHCDDPIPTCNSRCSKPLKCGKHSCPFICHDLA 375
           K CPF P  LKTC CG+T L  L K R+ C DPIP C SRC K LKCGKH+CPF CHD  
Sbjct: 317 KRCPFSPKYLKTCSCGKTPLQALGKARRRCIDPIPHCESRCDKLLKCGKHTCPFQCHDGP 376

Query: 376 CMDPCLQIDSAKCACEQSTFSVPCGFQGRPRCNIKCESLMSCRRHRCTDRCCSGRPSAVK 435
           CMDPC+QID  KCACE++TF VPCGFQG P C +KCESL+SCRRH+C +RCCSGRP+A +
Sbjct: 377 CMDPCIQIDKVKCACERNTFLVPCGFQGAPHCQLKCESLLSCRRHKCAERCCSGRPAAEE 436

Query: 436 RRKNFFRSQDLLDESLVEAKHICLKPCNLTLSCGIHKCQRKCHPGKCPPCLESDSNDLIC 495
           RRKN  R QD+ DE+L+EA+H+CLK CNLTLSCG H+CQRKCHPGKCPPCLESDSNDL+C
Sbjct: 437 RRKNSSRFQDVNDETLMEAEHVCLKACNLTLSCGQHQCQRKCHPGKCPPCLESDSNDLVC 496

Query: 496 PCGKTVVPAPVRCGTELPVCNHPCIKVVRGESSCGHKPMPHTCHPLGVPCPPCTETVFKP 555
           PCGKT+VPAPVRCGT+LP C HPCIKVV G S CGHKP+PH CHPL  PCPPCT TVFKP
Sbjct: 497 PCGKTIVPAPVRCGTKLPSCRHPCIKVVEGISECGHKPIPHACHPLDQPCPPCTATVFKP 556

Query: 556 CKCGKKDKVRTVCFQKDVSCGTKCGLLLHFCRHTCQKTCHLPGNCQKVCKQICGHERLSC 615
           CKCGK  +VRT+CFQKDVSCG  CG  L  C H CQKTCHLPG CQ  CKQ+C    ++C
Sbjct: 557 CKCGKNSRVRTICFQKDVSCGQTCGKPLPNCHHFCQKTCHLPGQCQATCKQVCNKPPVNC 616

Query: 616 RHTCPKPCHGKTECPDLPCPTLVKITCKCGRNEKSVTCSAKSGVVPANESSVLDCDEECE 675
            H C K CHG+  CPD+ C  LVKI C CGR E  VTC A S +  +  +  L+CDEECE
Sbjct: 617 AHKCRKSCHGRLTCPDILCIALVKIRCPCGRKEVEVTCGATSTLSSSLFTERLECDEECE 676

Query: 676 ALKRLKELREAFGIKEESNNVTS---NELDALKKLVSVATTFEELHLPFTETTLSVYSKQ 732
           A  R ++L+EAFGI ++  N ++    E   L+ L S ATTFEEL  PFTE+T+S Y +Q
Sbjct: 677 AYTRHRQLKEAFGITDKVANGSAMKEKEGTRLEGLASKATTFEELQFPFTESTISTYIRQ 736

Query: 733 ERWCSQIEVILNKLMDDKTRSSLHFKPMRPPQRHFIRELAKAYGLYSESQDREPMRSVFI 792
            +WC +IE  LN  MD++ +SSLHFKPM+PPQR FIRELAKAY LYSE+QD EP RSVF+
Sbjct: 737 NKWCGEIEETLNNFMDNEGKSSLHFKPMKPPQRLFIRELAKAYNLYSEAQDPEPKRSVFV 796

Query: 793 KKEDNGTSNKPVLSLGEALPLYESFKQLQKERKVQEFQSRTTAKLINFEVQD--AQPKVE 850
           KK D+G+S KP+ SL E  PLY+SFK L+KERK+Q+F ++TT  LIN ++ D  A     
Sbjct: 797 KKNDDGSSAKPIFSLSEIAPLYQSFKLLEKERKMQDFLAKTTTHLINVKLNDDVATGAQH 856

Query: 851 VAKNNGFLVRNLVTGNTVEDLKRFFEPHLKHTLVVNPQYLILDDGKTALVYPENYETASV 910
             +NN FL++N+  G T++DLK  F  +++ TL+ NPQY  L +  +A+VYPE+Y T S 
Sbjct: 857 SGQNNAFLIKNISAGTTLQDLKNLFGKYMEKTLIRNPQYQELPEENSAIVYPEDYRTISA 916

Query: 911 NTERDMELLVGHFDFMAKEAFLADSILLCS---------TDEEVGKRLDTPVIQE 956
           N   DME LVGH +F+  +AFLADS  LC          ++ ++ +RL+TP +QE
Sbjct: 917 NAVNDMENLVGHINFIVNDAFLADSAELCDASSKLPEEISENDISERLETPEVQE 971

>KAFR0H03300 Chr8 complement(627520..630420) [2901 bp, 966 aa] {ON}
           Anc_2.288 YNL023C
          Length = 966

 Score = 1164 bits (3011), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 559/943 (59%), Positives = 695/943 (73%), Gaps = 23/943 (2%)

Query: 31  SVEDNNEQPSSYEEETD-----DDMQYYERSIQEISKGDSYICMICTVEMDYTCQMFACK 85
           S +D +   SS +EE D     DDM YYER+IQEI+ GDSYICMICTVEMDYTC+M+ACK
Sbjct: 29  SEDDTSSAASSDDEEMDVLSDNDDMMYYERAIQEIAAGDSYICMICTVEMDYTCKMYACK 88

Query: 86  RCYRVFDYGCIREWAIKSTEKTVDRIWKCPNCYHVGKKVPANNRPTCWCGKVVXXXXXXX 145
           +C R+FDY CIREWA+KSTEKT +RIWKCPNCYHV KKVP  NR TCWCGKVV       
Sbjct: 89  KCCRIFDYDCIREWALKSTEKTKERIWKCPNCYHVNKKVPTKNRATCWCGKVVNPEKNPL 148

Query: 146 XXXSCGQTCSAPICIHGCSKTCHLGPHPECTRMVEIMCHCGKHSQSIFCYQSKAM---KK 202
              SCGQTC+AP+CIHGCSK CHLGPHPEC R + + C CGKH + I C+QSK+    + 
Sbjct: 149 NPNSCGQTCNAPVCIHGCSKICHLGPHPECLRTITMKCDCGKHERQISCFQSKSQSGRRN 208

Query: 203 NFKCQEECGLPLSCSVHNCKRKCHTGLCGPCPELITSKDSTEEQIKCYCGNHSRASIKCS 262
            F C+EECGLPLSC +H CK+KCH+GLCG CPEL+   +     IKCYCG  ++ S  C 
Sbjct: 209 RFSCEEECGLPLSCGIHTCKKKCHSGLCGSCPELLEVNEEKCATIKCYCGLETKKSFPCK 268

Query: 263 EARFPKSGRSSKDGNGNEWIGVFACTDIRTVDFSCRKHSFIEPCLSPPSVNGRKVCPFLP 322
           + + P +   S+D  GN+W+GVF+C  IR V++SC+KHSF+E C++PP+V+G K CPF P
Sbjct: 269 DVKAPTT--LSRDAEGNKWVGVFSCNKIRNVEYSCQKHSFVESCVAPPTVSGTKQCPFSP 326

Query: 323 SLLKTCPCGRTALDELTKPRKHCDDPIPTCNSRCSKPLKCGKHSCPFICHDLACMDPCLQ 382
           +LLKTCPCGRT L+ L+KPR  C DP+PTC + C+KPLKCGKH CPF CH+  CMDPC+Q
Sbjct: 327 NLLKTCPCGRTPLNALSKPRLKCTDPVPTCEACCNKPLKCGKHRCPFTCHNGPCMDPCIQ 386

Query: 383 IDSAKCACEQSTFSVPCGFQGRPRCNIKCESLMSCRRHRCTDRCCSGRPSAVKRRKNFFR 442
           ID   C+C QS F  PC F+G P CNIKCESLMSCRRHRCT+RCCSGRP A KR+K  FR
Sbjct: 387 IDKKPCSCHQSFFLTPCQFEGEPHCNIKCESLMSCRRHRCTERCCSGRPLAEKRKKTLFR 446

Query: 443 SQDLLDESLVEAKHICLKPCNLTLSCGIHKCQRKCHPGKCPPCLESDSNDLICPCGKTVV 502
           S D+ DE+LVEA+H+CLK CNL LSCG H+CQRKCHPGKCPPCLESDSNDL+CPCGKTVV
Sbjct: 447 SSDINDETLVEAQHVCLKECNLMLSCGKHRCQRKCHPGKCPPCLESDSNDLVCPCGKTVV 506

Query: 503 PAPVRCGTELPVCNHPCIKVVRGESSCGHKPMPHTCHPLGVPCPPCTETVFKPCKCGKKD 562
            APVRCGT+L  C  PCIKV+R ES CGH P+PH+CHPL  PCPPCT TVFKPCKCGK+D
Sbjct: 507 EAPVRCGTKLSPCLFPCIKVIRNESVCGHPPVPHSCHPLDQPCPPCTATVFKPCKCGKRD 566

Query: 563 KVRTVCFQKDVSCGTKCGLLLHFCRHTCQKTCHLPGNCQKVCKQICGHERLSCRHTCPKP 622
           KVRTVCFQKDVSCG  CGL L  C H CQK CH  G CQ  CKQ+C  +R++C H C K 
Sbjct: 567 KVRTVCFQKDVSCGKICGLPLLTCHHKCQKVCHPNGECQVKCKQVCRKKRVNCVHECLKS 626

Query: 623 CHGKTECPDLPCPTLVKITCKCGRNEKSVTCSAKSGVVPANESSVLDCDEECEALKRLKE 682
           CHG TEC D PCP   KI+C CGR E  VTC+A S +  A   + LDC+EECE +KR +E
Sbjct: 627 CHGSTECSDSPCPVSTKISCPCGRRESYVTCNATSTIDSAALITRLDCNEECEVVKRHRE 686

Query: 683 LREAFGI--KEESNNVTSNELDALKKLVSVATTFEELHLPFTETTLSVYSKQERWCSQIE 740
           LREAFGI  KEE  N+ +   + L+     AT +++L LP+TE  L  Y+KQ  WC QIE
Sbjct: 687 LREAFGIVEKEEPENLGT---ERLQSFAQSATNYDDLQLPYTEPALVAYTKQPNWCEQIE 743

Query: 741 VILNKLMDDKTRSSLHFKPMRPPQRHFIRELAKAYGLYSESQDREPMRSVFIKKEDNGTS 800
            +L K MDD +R SLHFKPMRPPQR+FI E+AKA+ LY+ESQDREP RSVF+KK D+GTS
Sbjct: 744 ELLIKFMDDNSRPSLHFKPMRPPQRYFIHEIAKAFNLYAESQDREPKRSVFLKKNDDGTS 803

Query: 801 NKPVLSLGEALPLYESFKQLQKERKVQEFQSRTTAKLINFEVQDAQPKVEVAKNNGFLVR 860
            KP L L + LP+Y++FK+L+KERK ++F++RTTA+L+N  + D   + +  +NNG +++
Sbjct: 804 LKPALRLSDVLPVYQNFKKLEKERKAKQFEARTTARLMNITLDDTLEERKKFENNGLIIK 863

Query: 861 NLVTGNTVEDLKRFFEPHLKHTLVVNPQYLILDDGKTALVYPENYETASVNTERDMELLV 920
           NL  G T+E L  FF    K TL+ NPQYLI+++    L+YPE++   +     D+++LV
Sbjct: 864 NLSNGITLEFLSEFFNKFFKSTLIKNPQYLIIENN--GLIYPESHNEITQGVYNDLDMLV 921

Query: 921 GHFDFMAKEAFLADSILLCSTDEEVGK------RLDTPVIQED 957
           GHF+ + KE  + DS+ +C+ + E+ +      RL+TP ++ D
Sbjct: 922 GHFNVIVKEELIGDSVEMCNIENELPEERLETPRLETPGLESD 964

>TDEL0G02190 Chr7 (430157..432967) [2811 bp, 936 aa] {ON} Anc_2.288
           YNL023C
          Length = 936

 Score = 1156 bits (2990), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 549/928 (59%), Positives = 687/928 (74%), Gaps = 7/928 (0%)

Query: 21  RHSLSSEQDSSVEDNNEQPSSYEEETDD-DMQYYERSIQEISKGDSYICMICTVEMDYTC 79
           +HSL  E      D + +  S  E  D+ DM YYER++QEI+ GD Y+CMICTVEMDYTC
Sbjct: 8   QHSLVLEFSEDDSDFSSESCSVHEVRDEHDMAYYERAVQEIALGDRYVCMICTVEMDYTC 67

Query: 80  QMFACKRCYRVFDYGCIREWAIKSTEKTVDRIWKCPNCYHVGKKVPANNRPTCWCGKVVX 139
           +M+AC+ CYRVFDY CIREWA+KSTEKT+DR+WKCPNCY V K+VPA NRPTCWCGK V 
Sbjct: 68  KMYACEGCYRVFDYECIREWALKSTEKTLDRVWKCPNCYKVNKRVPAKNRPTCWCGKTVN 127

Query: 140 XXXXXXXXXSCGQTCSAPICIHGCSKTCHLGPHPECTRMVEIMCHCGKHSQSIFCYQSKA 199
                    SCGQTC APIC HGCSK CHLGPHP+C R +   C CGKH++  FCYQ+ +
Sbjct: 128 PDPNPLDPNSCGQTCDAPICPHGCSKQCHLGPHPDCVRTITTKCQCGKHTRETFCYQTIS 187

Query: 200 MK--KNFKCQEECGLPLSCSVHNCKRKCHTGLCGPCPELITSKDSTEEQIKCYCGNHSRA 257
           MK    F+C E CGLPL+C +H C+R CH+G+CGPCP ++ +K S + +I+CYCG   R 
Sbjct: 188 MKGKSQFQCNEVCGLPLACGIHKCERLCHSGICGPCPAVLNAK-SNKLKIRCYCGLEHRD 246

Query: 258 SIKCSEARFPKSGRSSKDGNGNEWIGVFACTDIRTVDFSCRKHSFIEPCLSPPSVNGRKV 317
           S KC + R   +   SKDG G+ WIG F C+ IR ++++CR+HSF+E C   PS++G+  
Sbjct: 247 SFKCKDVRV--ASDLSKDGKGDSWIGAFGCSGIRKIEYACREHSFVEKCQPSPSISGKIA 304

Query: 318 CPFLPSLLKTCPCGRTALDELTKPRKHCDDPIPTCNSRCSKPLKCGKHSCPFICHDLACM 377
           CPF P LLKTCPCGRT+L  L +PRK C  PIP C+S C K L CG+H+CPF CHD  CM
Sbjct: 305 CPFSPKLLKTCPCGRTSLKVLAEPRKSCTSPIPNCDSTCGKKLACGRHTCPFTCHDGPCM 364

Query: 378 DPCLQIDSAKCACEQSTFSVPCGFQGRPRCNIKCESLMSCRRHRCTDRCCSGRPSAVKRR 437
           DPC+QI++ +C+C ++ +SVPC F+ +PRC+ KCESLMSCRRHRCT+RCC GRP A +RR
Sbjct: 365 DPCIQIETVRCSCHKNLYSVPCQFKEQPRCDTKCESLMSCRRHRCTERCCCGRPFAERRR 424

Query: 438 KNFFRSQDLLDESLVEAKHICLKPCNLTLSCGIHKCQRKCHPGKCPPCLESDSNDLICPC 497
           K    S++L+DES VE++HICLK CNLTLSCG HKCQRKCHPGKCPPCLESDSNDL+CPC
Sbjct: 425 KTPLSSRELMDESSVESEHICLKDCNLTLSCGCHKCQRKCHPGKCPPCLESDSNDLVCPC 484

Query: 498 GKTVVPAPVRCGTELPVCNHPCIKVVRGESSCGHKPMPHTCHPLGVPCPPCTETVFKPCK 557
           GKTVV APVRCGT LP C++PCI+V++    CGHKPMPHTCHPL  PCP CT  VFKPCK
Sbjct: 485 GKTVVEAPVRCGTRLPPCHYPCIRVIQNAYKCGHKPMPHTCHPLNEPCPSCTAPVFKPCK 544

Query: 558 CGKKDKVRTVCFQKDVSCGTKCGLLLHFCRHTCQKTCHLPGNCQKVCKQICGHERLSCRH 617
           CGKKDKVRT+CFQ DVSCGT CG  L  C H CQK+CH+PG CQK CKQIC  +R+ C H
Sbjct: 545 CGKKDKVRTLCFQNDVSCGTTCGKPLDNCPHMCQKSCHIPGECQKKCKQICNRKRIYCDH 604

Query: 618 TCPKPCHGKTECPDLPCPTLVKITCKCGRNEKSVTCSAKSGVVPANESSVLDCDEECEAL 677
            C   CHG  +CPD+PCP  VKI C+C   E  +TC A S       +++L CDEECE  
Sbjct: 605 KCRLICHGNDKCPDIPCPLSVKIKCECEVKESFITCGANSETPSKATTTILPCDEECERH 664

Query: 678 KRLKELREAFGIKEESNNVTSNELDALKKLVSVATTFEELHLPFTETTLSVYSKQERWCS 737
           KR  +LREAFGI   S+N + ++  +L+ L +VA +FEEL LPF+E  L  ++KQE WC+
Sbjct: 665 KRHLQLREAFGISNFSDNPSRSKTASLENLAAVANSFEELELPFSEPALGTFAKQEAWCT 724

Query: 738 QIEVILNKLMDDKTRSSLHFKPMRPPQRHFIRELAKAYGLYSESQDREPMRSVFIKKEDN 797
           QIE +LN  MD++ ++SLHFKPMRP QRHFI ELAK+Y LY ESQDREP RSVF+KK+DN
Sbjct: 725 QIENVLNSFMDNEEKTSLHFKPMRPAQRHFIHELAKSYNLYVESQDREPKRSVFVKKQDN 784

Query: 798 GTSNKPVLSLGEALPLYESFKQLQKERKVQEFQSRTTAKLINFEVQDAQPKVEVAKNNGF 857
           G S KPV+ L ++LP+Y+ FK+ +KE+K Q F+++TT + +NF +   +P++E AKNN F
Sbjct: 785 GGSCKPVIQLKDSLPIYQFFKENEKEKKAQRFEAQTTTEFVNF-IPKEEPQLERAKNNAF 843

Query: 858 LVRNLVTGNTVEDLKRFFEPHLKHTLVVNPQYLILDDGKTALVYPENYETASVNTERDME 917
            ++N+ TG T EDL+R F  HLK TLV NPQ+ I D  K  L+YPE+Y   SVN ERD+E
Sbjct: 844 KLKNVSTGTTKEDLERIFADHLKPTLVKNPQFKIQDSTKNGLIYPEDYAEISVNVERDLE 903

Query: 918 LLVGHFDFMAKEAFLADSILLCSTDEEV 945
            LVGHFD++ KE+F+ D I LC  D +V
Sbjct: 904 ALVGHFDYLCKESFIGDGIELCHIDLKV 931

>CAGL0M06919g Chr13 complement(703702..706572) [2871 bp, 956 aa]
           {ON} similar to uniprot|P53971 Saccharomyces cerevisiae
           YNL023c FAP1
          Length = 956

 Score = 1120 bits (2897), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 536/928 (57%), Positives = 659/928 (71%), Gaps = 7/928 (0%)

Query: 26  SEQDSSVEDN-----NEQPSSYEEETDDDMQYYERSIQEISKGDSYICMICTVEMDYTCQ 80
           SE +S +E N     +E+ S  +E  + DM YYE+++QEI KGDSY C+ICTVE+DYTC+
Sbjct: 30  SEDESEIETNMGAELSEELSDLDEGDEKDMAYYEKAVQEIVKGDSYSCLICTVELDYTCK 89

Query: 81  MFACKRCYRVFDYGCIREWAIKSTEKTVDRIWKCPNCYHVGKKVPANNRPTCWCGKVVXX 140
           ++AC++CYRV+DY CIREWA KST K  D++W CPNC++  K +P  NRPTCWCG+ V  
Sbjct: 90  LYACEKCYRVYDYECIREWAEKSTSKRTDKLWACPNCFYTKKAIPKKNRPTCWCGEQVNP 149

Query: 141 XXXXXXXXSCGQTCSAPICIHGCSKTCHLGPHPECTRMVEIMCHCGKHSQSIFCYQSKAM 200
                   SCGQTC+A IC HGCS+ CHLGPH ECTRM+ I C CGK ++ I C+Q +  
Sbjct: 150 EPNPLNPNSCGQTCNAKICSHGCSQICHLGPHQECTRMMSIKCSCGKVTKDIVCFQRRLY 209

Query: 201 KKNFKCQEECGLPLSCSVHNCKRKCHTGLCGPCPELITSKDSTEEQIKCYCGNHSRASIK 260
            K F C+  C   L C +H C RKCHTGLCG CPE I SK+ T  +I+CYCG  S+  IK
Sbjct: 210 SKGFNCETVCDKLLPCGIHKCNRKCHTGLCGSCPETIISKN-TNMKIRCYCGQTSKDKIK 268

Query: 261 CSEARFPKSGRSSKDGNGNEWIGVFACTDIRTVDFSCRKHSFIEPCLSPPSVNGRKVCPF 320
           C + RFP +   SKD  G  WIGVF C  IR V + C +HSF E C +PPS++GR +C F
Sbjct: 269 CKDVRFPANAAYSKDDKGQRWIGVFMCDKIRKVPYECGEHSFYEKCKAPPSISGRLICEF 328

Query: 321 LPSLLKTCPCGRTALDELTKPRKHCDDPIPTCNSRCSKPLKCGKHSCPFICHDLACMDPC 380
            P  LKTCPCG+  L +L+KPR  C D IPTC   C K LKCGKH CPF CH   CMDPC
Sbjct: 329 SPKKLKTCPCGKNELTDLSKPRSKCTDAIPTCGQVCGKMLKCGKHKCPFACHLGDCMDPC 388

Query: 381 LQIDSAKCACEQSTFSVPCGFQGRPRCNIKCESLMSCRRHRCTDRCCSGRPSAVKRRKNF 440
            QI+  +CACEQ  F++PCGF    RCN+KCESLMSCRRHRCT+RCC+GRP A +RRK  
Sbjct: 389 TQIEKVRCACEQKQFTIPCGFNDHARCNLKCESLMSCRRHRCTERCCAGRPLAERRRKTM 448

Query: 441 -FRSQDLLDESLVEAKHICLKPCNLTLSCGIHKCQRKCHPGKCPPCLESDSNDLICPCGK 499
               +DL DES +E  HICLK CNLTLSCGIHKC RKCH GKCPPCLESDSNDL+CPCGK
Sbjct: 449 KINVRDLADESTIEPIHICLKDCNLTLSCGIHKCNRKCHAGKCPPCLESDSNDLVCPCGK 508

Query: 500 TVVPAPVRCGTELPVCNHPCIKVVRGESSCGHKPMPHTCHPLGVPCPPCTETVFKPCKCG 559
           T+V APVRCGT+LP C +PCI+VVRGE+ CGH PMPH CHP  +PCP CT TVFKPCKCG
Sbjct: 509 TIVEAPVRCGTKLPNCPYPCIRVVRGETDCGHSPMPHECHPPDIPCPDCTATVFKPCKCG 568

Query: 560 KKDKVRTVCFQKDVSCGTKCGLLLHFCRHTCQKTCHLPGNCQKVCKQICGHERLSCRHTC 619
           K+ +VRTVCF KDVSCG  CG  L  C H CQK CH PG CQ VCKQ C   RL C H C
Sbjct: 569 KEQRVRTVCFMKDVSCGKVCGERLQTCYHKCQKKCHEPGACQTVCKQTCNMPRLYCNHRC 628

Query: 620 PKPCHGKTECPDLPCPTLVKITCKCGRNEKSVTCSAKSGVVPANESSVLDCDEECEALKR 679
           PKPCH   ECPD+PC  LVKITC CGR EK VTC   S    A +S+ + CDEEC  L+R
Sbjct: 629 PKPCHKFEECPDIPCTALVKITCPCGRIEKEVTCGVYSKNKEAQDSTRIVCDEECAVLQR 688

Query: 680 LKELREAFGIKEESNNVTSNELDALKKLVSVATTFEELHLPFTETTLSVYSKQERWCSQI 739
             +L+EAFGI ++  N  + E+  L++++S A+TF +L LPFTE  ++ Y + E WC+ I
Sbjct: 689 HMQLKEAFGIVDKPQNTHNEEMARLEQVISTASTFADLDLPFTEPVITTYIRHENWCTDI 748

Query: 740 EVILNKLMDDKTRSSLHFKPMRPPQRHFIRELAKAYGLYSESQDREPMRSVFIKKEDNGT 799
           E  LNKL+DD  R+SLHFKPMRPPQR+FIRELAKAY LYSESQD EP RSVF+KK  +G+
Sbjct: 749 ENTLNKLIDDNNRTSLHFKPMRPPQRYFIRELAKAYNLYSESQDPEPNRSVFVKKNLDGS 808

Query: 800 SNKPVLSLGEALPLYESFKQLQKERKVQEFQSRTTAKLINFEVQDAQPKVEVAKNNGFLV 859
           S KP+LS+ EA PLY+S+K+L+KE+K   F+S TT +LINF  + +      A+ NGFLV
Sbjct: 809 STKPILSISEAAPLYQSYKKLEKEKKQANFESMTTTRLINFTPEMSPELESAARFNGFLV 868

Query: 860 RNLVTGNTVEDLKRFFEPHLKHTLVVNPQYLILDDGKTALVYPENYETASVNTERDMELL 919
            N+    + +DL+  F P+LK TLVV PQ+ IL + K A++YP  Y+  S+N ERDME L
Sbjct: 869 TNVGEFTSTDDLQNLFAPYLKSTLVVEPQFQILPERKQAVIYPNKYKEISINVERDMETL 928

Query: 920 VGHFDFMAKEAFLADSILLCSTDEEVGK 947
           V HFDF+ KE+ LA  + LC+ +  + +
Sbjct: 929 VQHFDFLIKESLLAGGVELCNIENVLAE 956

>TBLA0B05950 Chr2 (1404509..1407496) [2988 bp, 995 aa] {ON}
           Anc_2.288 YNL023C
          Length = 995

 Score = 1103 bits (2854), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 548/988 (55%), Positives = 693/988 (70%), Gaps = 28/988 (2%)

Query: 3   DHESLDLKQNQEGGGVCRRHSLSSE-----QDSSVEDNNEQPSSYEEETD--------DD 49
           D E+++ KQ    G + + HSL  E        S  DNN   S  E+E+D        +D
Sbjct: 10  DQETIN-KQQSSNGKLFKGHSLVLEFSDDDASDSGSDNNSDLSRDEDESDVDTDNEYEED 68

Query: 50  MQYYERSIQEISKGDSYICMICTVEMDYTCQMFACKRCYRVFDYGCIREWAIKSTEKTVD 109
           + YYER+++EI+KGDSY CMICTVEMD+TC+M+AC+ CYRVFDY CIREWA+KST+KTVD
Sbjct: 69  LMYYERAVREIAKGDSYQCMICTVEMDHTCKMYACRHCYRVFDYDCIREWALKSTQKTVD 128

Query: 110 RIWKCPNCYHVGKKVPANNRPTCWCGKVVXXXXXXXXXXSCGQTCSAPICIHGCSKTCHL 169
           + WKCPNCYH  KKVP  +RPTCWCGKVV          SCGQTC+A IC H C K CHL
Sbjct: 129 KTWKCPNCYHSSKKVPLKDRPTCWCGKVVNPDPNPLDPNSCGQTCNANICPHKCLKQCHL 188

Query: 170 GPHPECTRMVEIMCHCGKHSQSIFCYQSKAMKKNFKCQEECGLPLSCSVHNCKRKCHTGL 229
           G HPECT++++I C CG+ ++ I+C++S+  K  F C +ECGL L C +H C+RKCH+GL
Sbjct: 189 GSHPECTQLLKITCRCGRETKDIYCHESRRQKSIFHCDQECGLTLPCGIHKCRRKCHSGL 248

Query: 230 CGPCPELITSKDSTEEQIKCYCGNHSRASIKCSEARFPKSGRSSKDGNGNEWIGVFACTD 289
           CG CPEL+   ++   +IKCYCG HS   + C +  FP SG+ S++    EW+G+F C +
Sbjct: 249 CGSCPELLID-ENVSGKIKCYCGLHSLKEMNCKDVAFPSSGKISRNQEDKEWVGIFDCKE 307

Query: 290 IRTVDFSCRKHSFIEPCLSPPSVNGRKVCPFLPSLLKTCPCGRTALDELTKPRKHCDDPI 349
           +R+V ++C +H F+E C++PP++    VCPF P+LLKTCPCG+TAL ++   R  C DPI
Sbjct: 308 MRSVSYTCNEHVFVEGCIAPPTLPSTVVCPFSPNLLKTCPCGKTALQDMDCERTKCTDPI 367

Query: 350 PTCNSRCSKPLKCGKHSCPFICHDLACMDPCLQIDSAKCACEQSTFSVPCGFQGRPRCNI 409
           PTC++ C+K LKCGKH CPF CH   CMDPC+QID   CACE+ TF VPC F+G+P C  
Sbjct: 368 PTCDNVCNKILKCGKHRCPFTCHTGKCMDPCIQIDKMDCACERRTFLVPCQFKGKPVCKF 427

Query: 410 KCESLMSCRRHRCTDRCCSGRPSAVKRRKNFFRSQDLLDESLVEAKHICLKPCNLTLSCG 469
           KCESLMSCRRHRC + CCSGRP A +R+K   RS D  DE+LVEA+H+CLK CNL LSCG
Sbjct: 428 KCESLMSCRRHRCMEYCCSGRPYAERRKKTILRSSDRNDETLVEAEHVCLKDCNLKLSCG 487

Query: 470 IHKCQRKCHPGKCPPCLESDSNDLICPCGKTVVPAPVRCGTELPVCNHPCIKVVRGESSC 529
           IH CQRKCHPG CPPCLESDSNDL+CPCGKTV+PAPVRCGT LP C +PCIKV+RGES C
Sbjct: 488 IHTCQRKCHPGPCPPCLESDSNDLVCPCGKTVIPAPVRCGTTLPPCKYPCIKVIRGESDC 547

Query: 530 GHKPMPHTCHPLGVPCPPCTETVFKPCKCGKKDKVRTVCFQKDVSCGTKCGLLLHFCRHT 589
           GHKPMPH+CH L  PCP CT  VFKPCKCGKKDKVRT+CFQ+DVSCG  CGL L  C H 
Sbjct: 548 GHKPMPHSCHSLDQPCPVCTAPVFKPCKCGKKDKVRTMCFQEDVSCGLPCGLPLKDCYHK 607

Query: 590 CQKTCHLPGNCQKVCKQICGHERLSCRHTCPKPCHGKTECPDLPCPTLVKITCKCGRNEK 649
           CQK CHLPG CQ  C QIC  +R +C H C + CH    CPD+PC   V + C CGR + 
Sbjct: 608 CQKRCHLPGECQNTCIQICNAKRSNCSHGCTQRCHKNAPCPDIPCTVPVTVVCDCGRRKL 667

Query: 650 SVTCSAKSGVVPANESSVLDCDEECEALKRLKELREAFGIKEE-SNNVTSNELDALKKLV 708
              CS+ S +     +S L+CDEEC  L R  EL+ AFGI     ++ TS  ++ ++  +
Sbjct: 668 VKPCSSTSTIDSVTITSHLECDEECMLLLRRMELKAAFGIVNGLGDDKTSVAIERIQNRI 727

Query: 709 SVATTFEELHLPFTETTLSVYSKQERWCSQIEVILNKLMDDKTRSSLHFKPMRPPQRHFI 768
           SVA  +EEL LPF E  L+VY+KQ +WCSQIE ILNK MD+K +SSLHFK M+ PQR F+
Sbjct: 728 SVAKAYEELELPFVEAVLTVYAKQPKWCSQIEGILNKFMDEKLKSSLHFKHMKAPQRSFV 787

Query: 769 RELAKAYGLYSESQDREPMRSVFIKKEDNGTSNKPVLSLGEALPLYESFKQLQKERKVQE 828
             LA AY +YSESQD EP+RSVF+KK  NGTS+KP+L+L EALPLYESFK++QKE+K QE
Sbjct: 788 HNLADAYKIYSESQDPEPVRSVFVKKLTNGTSSKPILTLEEALPLYESFKEVQKEKKKQE 847

Query: 829 FQSRTTAKLINFEVQDAQPKVEVAKNNGFLVRNLVTGNTVEDLKRFFEPHLKHTLVVNPQ 888
           +++RT   LIN E +  Q +    K NGFL++NLV G T EDL+R F   LK TLV +PQ
Sbjct: 848 YEARTHKTLINVEAE-TQTQQSATKYNGFLIKNLVKGTTEEDLERIFGESLKPTLVKDPQ 906

Query: 889 YLILDDGKTALVYPENYETASVNTERDMELLVGHFDFMAKEAFLADSILLCSTDEEV--- 945
           YL++D+     + P +Y   S+N ERDME L+G FD + KE F+ D + LC+ DE +   
Sbjct: 907 YLVMDESHHGFICPADYAEISINVERDMEQLIGFFDSLCKEHFIGDIVELCNIDEALLQE 966

Query: 946 --------GKRLDTPVIQEDTSIEDKNK 965
                    ++L +P ++ D+ I D  K
Sbjct: 967 NVDLEDSEEEKLTSPEVENDSDIHDSPK 994

>ZYRO0A01936g Chr1 (159749..162610) [2862 bp, 953 aa] {ON} similar
           to uniprot|P53971 Saccharomyces cerevisiae YNL023C
          Length = 953

 Score = 1071 bits (2770), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 518/896 (57%), Positives = 641/896 (71%), Gaps = 11/896 (1%)

Query: 50  MQYYERSIQEISKGDSYICMICTVEMDYTCQMFACKRCYRVFDYGCIREWAIKSTEKTVD 109
           M YYER+++EI++GD+Y+CMICTVEMDYTC+MFAC +CYRVFDY CIREWA+KST +T+D
Sbjct: 56  MMYYERAVKEIARGDTYVCMICTVEMDYTCKMFACSKCYRVFDYDCIREWALKSTGRTMD 115

Query: 110 RIWKCPNCYHVGKKVPANNRPTCWCGKVVXXXXXXXXXXSCGQTCSAPICIHGCSKTCHL 169
           + WKCPNC     KVP  +RPTCWCGKVV          SCGQTC APIC HGCSK CHL
Sbjct: 116 KTWKCPNCLDESNKVPRKSRPTCWCGKVVNPDPNPLDPNSCGQTCDAPICEHGCSKVCHL 175

Query: 170 GPHPECTRMVEIMCHCGKHSQSIFCYQ-SKAMKKNFKCQEECGLPLSCSVHNCKRKCHTG 228
           GPHPECTR++ I C CG+H++ + C +      + F C+E CGL L C VH C +KCH+G
Sbjct: 176 GPHPECTRIISIKCKCGRHTRDVRCSEVGSGRNQQFTCEESCGLLLPCGVHKCSKKCHSG 235

Query: 229 LCGPCPELITSKDSTEEQIKCYCGNHSRASIKCSEARFPKSGRSSKDGNGNEWIGVFACT 288
           LCG C E + SK      IKCYCG H   SI+C + R   + R S D  GN WIGVF C 
Sbjct: 236 LCGGCNETLHSKPDKGAVIKCYCGLHESPSIRCGDVRV--ADRDSVDDQGNGWIGVFRCK 293

Query: 289 DIRTVDFSCRKHSFIEPCLSPPSVNGRKVCPFLPSLLKTCPCGRTALDELTKPRKHCDDP 348
           D+R V+++C +HSF+E C   PS+  +  CPF P++L++CPCGRT L++L + R  C D 
Sbjct: 294 DVRVVEYACGQHSFVESCKPAPSLPKQIGCPFSPNVLRSCPCGRTPLNKLGQARVKCTDH 353

Query: 349 IPTCNSRCSKPLKCGKHSCPFICHDLACMDPCLQIDSAKCACEQSTFSVPCGFQGRPRCN 408
           IPTC S+C K L CGKH+CP+ CH+  CMDPC+Q +   C CE  +F VPC F+  PRCN
Sbjct: 354 IPTCESKCGKKLACGKHTCPYKCHEGDCMDPCVQFEKTNCLCEARSFLVPCQFREDPRCN 413

Query: 409 IKCESLMSCRRHRCTDRCCSGRPSAVKRRKNFFRSQDLLDESLVEAKHICLKPCNLTLSC 468
            KCESLMSCRRHRCT++CCSG+P A +R+K  F S++LLDESLVEA+H+CLK CNLTL+C
Sbjct: 414 TKCESLMSCRRHRCTEKCCSGKPGAERRKKTPFTSRELLDESLVEAEHVCLKSCNLTLTC 473

Query: 469 GIHKCQRKCHPGKCPPCLESDSNDLICPCGKTVVPAPVRCGTELPVCNHPCIKVVRGESS 528
           G HKCQRKCHPG+CPPCLESD NDL+CPCGKTVV APVRCGT+LP C + CI VVR    
Sbjct: 474 GRHKCQRKCHPGRCPPCLESDPNDLVCPCGKTVVEAPVRCGTKLPPCPYSCISVVRDGYP 533

Query: 529 CGHKPMPHTCHPLGVPCPPCTETVFKPCKCGKKDKVRTVCFQKDVSCGTKCGLLLHFCRH 588
           CGH PMPH CHP    CPPCT  V KPCKCGKK  VRT+CFQ+DVSCG  C   L  CRH
Sbjct: 534 CGHTPMPHLCHPPEEKCPPCTANVKKPCKCGKKSDVRTLCFQQDVSCGQICNKPLGSCRH 593

Query: 589 TCQKTCHLPGNCQKVCKQICGHERLSCRHTCPKPCHGKTECPDLPCPTLVKITCKCGRNE 648
           TCQK CH  G CQ  C+QICG +R++C H CPKPCHG   CPD PCP  V I C CGR E
Sbjct: 594 TCQKKCH-DGGCQVKCRQICGKKRVNCDHKCPKPCHGGEPCPDFPCPFSVVIKCACGRKE 652

Query: 649 KSVTCSAKSGVVPANESSVLDCDEECEALKRLKELREAFGIKEESNNVTSNEL-DALKKL 707
            +  C   S  + A+ +  L CDEECE +KR  +L++A G+KE  ++   N + +AL   
Sbjct: 653 STEPCGTNSQTLSASVTRELSCDEECERVKRCAQLKDALGLKENGDSSVENTVSNAL--- 709

Query: 708 VSVATTFEELHLPFTETTLSVYSKQERWCSQIEVILNKLMDDKTRSSLHFKPMRPPQRHF 767
             VA+ FEEL LPF ET L++YS+Q+R+C  IE +LN  +DD+ +SSLHFKPM+P QRHF
Sbjct: 710 --VASNFEELGLPFRETVLAIYSRQQRYCDNIESVLNNFIDDEKKSSLHFKPMKPAQRHF 767

Query: 768 IRELAKAYGLYSESQDREPMRSVFIKKEDNGTSNKPVLSLGEALPLYESFKQLQKERKVQ 827
           + ELAKAY LYSESQD EP RSV++KKE NG SNKP ++L EALP+Y++FKQ +KE K++
Sbjct: 768 VHELAKAYKLYSESQDPEPKRSVYVKKELNGESNKPSITLQEALPIYQAFKQREKETKIR 827

Query: 828 EFQSRTTAKLINFEVQDAQPKVEVAKNNGFLVRNLVTGNTVEDLKRFFEPHLKHTLVVNP 887
            ++ +    L+NF V   +P VE+AK NGFL+RNL  G   EDL+R +  HLK TLV NP
Sbjct: 828 RYEMQNVTNLVNF-VPKFEPTVELAKYNGFLIRNLTDGTNGEDLQRIYGEHLKPTLVRNP 886

Query: 888 QYLILDDGKTALVYPENYETASVNTERDMELLVGHFDFMAKEAFLADSILLCSTDE 943
            Y  L D   AL++PE+Y   +VNTE DME LVGHFDF+ KE F+ D + LC   E
Sbjct: 887 VYKALPDRNIALIFPESYSDVTVNTECDMERLVGHFDFICKEMFIGDGVELCQVGE 942

>Kpol_1039.45 s1039 (135833..138739) [2907 bp, 968 aa] {ON}
           (135833..138739) [2907 nt, 969 aa]
          Length = 968

 Score = 1039 bits (2687), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 507/900 (56%), Positives = 635/900 (70%), Gaps = 13/900 (1%)

Query: 47  DDDMQYYERSIQEISKGDSYICMICTVEMDYTCQMFACKRCYRVFDYGCIREWAIKSTEK 106
           ++D+ +YER+I++I+KGD Y CMICT+E+D T +M+AC  CYRVFDY CIREWA+KS++K
Sbjct: 63  NEDLMHYERAIKDIAKGDFYTCMICTIELDSTSKMYACSHCYRVFDYDCIREWAVKSSQK 122

Query: 107 TVDRIWKCPNCYHVGKKVPANNRPTCWCGKVVXXXXXXXXXXSCGQTCSAPICIHGCSKT 166
           ++D++WKCPNC H   K+P  NRPTCWCGK V          SCGQTC+A  CIH CS  
Sbjct: 123 SLDKVWKCPNCNHTSNKIPLQNRPTCWCGKTVNPDPNPFYPNSCGQTCNAKSCIHRCSHF 182

Query: 167 CHLGPHPECTRMVEIMCHCGKHSQSIFCY---QSKAMKKNFKCQEECGLPLSCSVHNCKR 223
           CHLGPHP+C R   I C CGKH++ +FCY     K   K F C E+C + LSC +H C R
Sbjct: 183 CHLGPHPQCHRTTTIHCECGKHTKDVFCYLLDHGKNRNKKFNCGEKCNMTLSCGIHKCSR 242

Query: 224 KCHTGLCGPCPELITSKDSTEEQIKCYCGNHSRASIKCSEARFPKSGRSSKDGNGNEWIG 283
            CH+G CGPCPELIT K      + CYCG+ +   I+CS  +   SG+ SKD  GN WIG
Sbjct: 243 VCHSGSCGPCPELITKK------VNCYCGSTTMDKIRCSNVKIHDSGKKSKDQEGNTWIG 296

Query: 284 VFACTDIRTVDFSCRKHSFIEPCLSPPSVNGRKVCPFLPSLLKTCPCGRTALDELTKPRK 343
           VF C  IRTV+++C+ HSF E C SPP+++G K+CP+ P LLKTCPCG+T LD+    R+
Sbjct: 297 VFKCNKIRTVEYACKNHSFFETCTSPPTISGTKICPYSPKLLKTCPCGKTNLDDFENKRQ 356

Query: 344 HCDDPIPTCNSRCSKPLKCGKHSCPFICHDLACMDPCLQIDSAKCACEQSTFSVPCGFQG 403
            C DPI TC +RC KPLKCGKH CPF CH+  CMDPC QI+  KC+C    FSVPC F  
Sbjct: 357 KCTDPISTCENRCDKPLKCGKHKCPFTCHNGPCMDPCTQIELRKCSCNYKEFSVPCQFHE 416

Query: 404 RPRCNIKCESLMSCRRHRCTDRCCSGRPSAVKRRKNFFRSQDLLDESLVEAKHICLKPCN 463
           +PRCN+KCESLMSCRRHRCT RCCSG+P A KR+K  F   DLLDESLVEA+HICLK CN
Sbjct: 417 KPRCNMKCESLMSCRRHRCTRRCCSGKPMADKRKKMLFSQADLLDESLVEAEHICLKDCN 476

Query: 464 LTLSCGIHKCQRKCHPGKCPPCLESDSNDLICPCGKTVVPAPVRCGTELPVCNHPCIKVV 523
           L LSCGIH C RKCH GKCPPCLESDS+DL+CPCGKTVV APVRCGT+LP C  PCIK +
Sbjct: 477 LKLSCGIHNCTRKCHAGKCPPCLESDSSDLVCPCGKTVVEAPVRCGTKLPECIFPCIKYI 536

Query: 524 RGESSCGHKPMPHTCHPLGVPCPPCTETVFKPCKCGKKDKVRTVCFQKDVSCGTKCGLLL 583
            G   CGHKP  H CHP  +PCPPCTE VFKPCKCGK+ K + +CFQ+  SCG  C   L
Sbjct: 537 EGSYPCGHKPGNHYCHPADIPCPPCTEVVFKPCKCGKEQKAKALCFQETASCGKLCEKKL 596

Query: 584 HFCRHTCQKTCHLPGNCQKVCKQICGHERLSCRHTCPKPCHGKTECPDLPCPTLVKITCK 643
             C H CQ  CHLPG CQK C QIC   R++C HTC + CHG + CPD+PC    ++ C 
Sbjct: 597 DGCHHYCQLKCHLPGECQKKCTQICNKRRVNCSHTCDQKCHGDSNCPDIPCKVKCEVYCG 656

Query: 644 CGRNEKSVTCSAKSGVVPANESSVLDCDEECEALKRLKELREAFGIKEESNNVTSNELDA 703
           CGR ++ + C A S       + VL CD+ C   +RL+ELR AFG+K  S +  S EL+ 
Sbjct: 657 CGRRKELLLCGATSTTQSVELTKVLPCDDACLKYQRLEELRNAFGMKSSSEDPES-ELER 715

Query: 704 LKKLVSVATTFEELHLPFTETTLSVYSKQERWCSQIEVILNKLMDDKTRSSLHFKPMRPP 763
           LKK+V   T++EEL LPF+ET LSVYSKQ  WC+QIE ++NK ++DK + SLHFKPM  P
Sbjct: 716 LKKIVEKVTSYEELELPFSETVLSVYSKQTNWCNQIEELINKFVNDKNKPSLHFKPMPAP 775

Query: 764 QRHFIRELAKAYGLYSESQDREPMRSVFIKKEDNGTSNKPVLSLGEALPLYESFKQLQKE 823
           QR+FI  L +AY +YSESQDREP RSV++KK  N  +  P +SL EALPLY+S+K+++KE
Sbjct: 776 QRNFIHALVEAYEMYSESQDREPKRSVYLKK--NKYTRIPNISLEEALPLYQSYKKIEKE 833

Query: 824 RKVQEFQSRTTAKLINFEVQDAQPKVEVAKNNGFLVRNLVTGNTVEDLKRFFEPHLKHTL 883
           RKVQ F+S+     +N++  +     +V K NGFL++ +  G T +DL   F  HLK TL
Sbjct: 834 RKVQSFESKKNVTYLNYQPPERSLTPDV-KYNGFLIKGITFGTTTDDLNTLFGVHLKPTL 892

Query: 884 VVNPQYLILDDGKTALVYPENYETASVNTERDMELLVGHFDFMAKEAFLADSILLCSTDE 943
           + + QY IL DGK+A+VYP++Y T S N ERD+E L GHFD+M KEA L +S+ +C+  +
Sbjct: 893 IKDAQYSILPDGKSAIVYPKDYLTISENVERDIESLAGHFDYMTKEAMLGESVEMCNITD 952

>SAKL0E07634g Chr5 complement(616444..619368) [2925 bp, 974 aa] {ON}
           similar to uniprot|P53971 Saccharomyces cerevisiae
           YNL023C
          Length = 974

 Score = 1034 bits (2673), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 512/908 (56%), Positives = 631/908 (69%), Gaps = 15/908 (1%)

Query: 50  MQYYERSIQEISKGDSYICMICTVEMDYTCQMFACKRCYRVFDYGCIREWAIKSTEKTVD 109
           + YYE++I EI KGDSY CMICT+EMDYTC M+AC  CYRV+D+ CIREWA+KS++K++D
Sbjct: 48  LPYYEKTIHEIQKGDSYACMICTMEMDYTCHMYACPECYRVYDHECIREWALKSSQKSLD 107

Query: 110 RIWKCPNCYHVGKKVPANNRPTCWCGKVVXXXXXXXXXXSCGQTCSAPICIHGCSKTCHL 169
           + WKCPNCY+V  ++P  NR TCWCGKVV          SCGQTC+APIC HGCSK CHL
Sbjct: 108 KTWKCPNCYYVNSEIPVKNRHTCWCGKVVHPESNPIDPNSCGQTCNAPICSHGCSKPCHL 167

Query: 170 GPHPECTRMVEIMCHCGKHSQSIFCYQSKAMKKNFKCQEECGLPLSCSVHNCKRKCHTGL 229
           GPHPEC R  ++ C CGKH++ +FCYQS+  K +++C E C L L C VH C+RKCH+G 
Sbjct: 168 GPHPECMRTTKVKCLCGKHTKDMFCYQSEEEKASYQCGEPCNLLLPCGVHKCQRKCHSGP 227

Query: 230 CGPCPELITSKDSTEEQIKCYCGNHSRASIKCSEARFPKSGRSSKDGNGNEWIGVFACTD 289
           CG C E I+ K      I CYCG  +R  I C +    KS   SK+ +G  WIGVF+C  
Sbjct: 228 CGNCEETISGK------IMCYCGMETREQIICKDV---KSVAKSKNKSGEIWIGVFSCAH 278

Query: 290 IRTVDFSCRKHSFIEPCLSPPSVNGRKVCPFLPSLLKTCPCGRTALDELTKPRKHCDDPI 349
           +R+V++SC  HSF E C +PP+ +G   CPF P LLKTCPCG T L  L  PRK C DPI
Sbjct: 279 LRSVEYSCGHHSFQESCTAPPTNSGELACPFSPRLLKTCPCGSTPLKLLEAPRKKCTDPI 338

Query: 350 PTCNSRCSKPLKCGKHSCPFICHDLACMDPCLQIDSAKCACEQSTFSVPCGFQGRPRCNI 409
           PTC +RC+KPLKCGKHSCPF+CHD  CMDPC+ +D   C+C   +F VPC F     CN 
Sbjct: 339 PTCENRCNKPLKCGKHSCPFVCHDGPCMDPCVSVDKVSCSCHSKSFLVPCQFHDEAHCNT 398

Query: 410 KCESLMSCRRHRCTDRCCSGRPSAVKRRKNFFRSQDLLDESLVEAKHICLKPCNLTLSCG 469
           KCESLMSCRRHRCT+RCCSGR  A+KR K  F ++D LDESLVEA+HICLKPCNL LSCG
Sbjct: 399 KCESLMSCRRHRCTERCCSGRSLAIKREKTIFLARDRLDESLVEAQHICLKPCNLKLSCG 458

Query: 470 IHKCQRKCHPGKCPPCLESDSNDLICPCGKTVVPAPVRCGTELPVCNHPCIKVVRGESSC 529
           IH C+RKCHPGKC PCLESDSNDL CPCGKTVVPAPVRCGT+LP C HPCIK ++ ++ C
Sbjct: 459 IHYCRRKCHPGKCSPCLESDSNDLSCPCGKTVVPAPVRCGTKLPPCRHPCIKTLQADTVC 518

Query: 530 GHKPMPHTCHPLGVPCPPCTETVFKPCKCGKKDKVRTVCFQKDVSCGTKCGLLLHFCRHT 589
           GH PMPH CH L  PCP CT  ++K CKC K +KVRT+CFQ DVSCG  CGL L  C HT
Sbjct: 519 GHPPMPHECHSLEQPCPQCTAPIYKKCKCNKVEKVRTLCFQNDVSCGKICGLPLKNCSHT 578

Query: 590 CQKTCHLPGNCQKVCKQICGHERLSCRHTCPKPCHGKTECPDLPCPTLVKITCKCGRNEK 649
           C++TCH PG CQ +CKQICG  R  C H C   CH   +CPD  C   VK+TC CGR E 
Sbjct: 579 CKRTCHEPGQCQTICKQICGLPRKFCEHKCFARCHPGKDCPDEACQVKVKVTCSCGRKES 638

Query: 650 SVTCSAKSGVVPANESSVLDCDEECEALKRLKELREAFGIKEESNNVTSNELDALKKLVS 709
            + C A +    +     L CD++CE  KR + L EAFGIKE+     +  ++ L+ LV 
Sbjct: 639 ILPCDAHADQPSSKLLITLPCDDKCEESKRHRMLMEAFGIKEK----LTAPVEELRDLVE 694

Query: 710 VATTFEELHLPFTETTLSVYSKQERWCSQIEVILNKLMDDKTRSSLHFKPMRPPQRHFIR 769
            A +F+ELHLPFTE+TLSVYSKQ  WC+QIE  L+KLM D TR+SLHFKPM+ PQR FI 
Sbjct: 695 SAKSFDELHLPFTESTLSVYSKQRAWCNQIESFLSKLMRDVTRTSLHFKPMKLPQRRFIH 754

Query: 770 ELAKAYGLYSESQDREPMRSVFIKKEDNGTSNKPVLSLGEALPLYESFKQLQKERKVQEF 829
           ELA AY LYSESQDREP RSVF+KK +N  S+ P+L LGEALPLY SFKQLQKERKV+E 
Sbjct: 755 ELANAYALYSESQDREPKRSVFVKKVEN-KSHIPLLCLGEALPLYHSFKQLQKERKVKEL 813

Query: 830 QSRTTAKLINFEVQDAQPKVEVAKNNGFLVRNLVTGNTVEDLKRFFEPHLKHTLVVNPQY 889
           +  TT +L N+ V DA      A+ N FLV+ +  G T ++L      +L+ TL+ NP Y
Sbjct: 814 EKSTTRRLFNYTVDDANDVPHNAEFNCFLVKGVAPGVTKDELSDCLAEYLQFTLIQNPSY 873

Query: 890 LILDDGKTALVYPENYETASVNTERDMELLVGHFDFMAKEAFLADSILLCSTDEEVGKRL 949
             L++G   L+YPE++ + S N E D++ L  +   + KE  +++ + L   DE +    
Sbjct: 874 QTLENGD-FLIYPEDHMSISENVENDIKRLAPYISSICKEKQISEGVKLYKIDENLKTFT 932

Query: 950 DTPVIQED 957
               +QE+
Sbjct: 933 SEEYLQEE 940

>KLTH0G10406g Chr7 (880042..882933) [2892 bp, 963 aa] {ON} similar
           to uniprot|P53971 Saccharomyces cerevisiae YNL023C
          Length = 963

 Score = 1027 bits (2655), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 504/916 (55%), Positives = 627/916 (68%), Gaps = 24/916 (2%)

Query: 49  DMQYYERSIQEISKGDSYICMICTVEMDYTCQMFACKRCYRVFDYGCIREWAIKSTEKTV 108
           D  YYE++I+EI+KGD Y CMICTVEMD+TC M+AC  CYRVFDY CIREWA+KST+K+V
Sbjct: 60  DQPYYEKTIKEIAKGDRYPCMICTVEMDFTCHMYACPECYRVFDYECIREWAVKSTQKSV 119

Query: 109 DRIWKCPNCYHVGKKVPANNRPTCWCGKVVXXXXXXXXXXSCGQTCSAPICIHGCSKTCH 168
            + WKCPNCY   K VP  NRPTCWCGK +          SCGQTC APIC+HGCS TCH
Sbjct: 120 TKTWKCPNCYFEKKDVPLKNRPTCWCGKNIHPEPNPLNPNSCGQTCDAPICVHGCSSTCH 179

Query: 169 LGPHPECTRMVEIMCHCGKHSQSIFCYQSKAMKKNFKCQEECGLPLSCSVHNCKRKCHTG 228
           LGPHP C RMV+  C CGK S+ +FC +++  ++ F+C   CGL L C VH C+R+CH G
Sbjct: 180 LGPHPTCMRMVQTKCRCGKKSKDVFCSEARKHQELFRCGNPCGLTLPCGVHKCQRECHNG 239

Query: 229 LCGPCPELITSKDSTEEQIKCYCGNHSRASIKCSEARFPKSGRSSKDGNGNEWIGVFACT 288
           +CG CPE I       ++I CYCG  S  SIKC + +       S+DG+G +WIG FAC+
Sbjct: 240 VCGECPETIA------KEINCYCGLESLPSIKCQDVKI---QSKSQDGSGKKWIGAFACS 290

Query: 289 DIRTVDFSCRKHSFIEPCLSPPSVNGRKVCPFLPSLLKTCPCGRTALDELTKPRKHCDDP 348
            IRTV++SCR+HSF EPC +PPS+ GR  CP+ P  LKTCPCG T L+ +  PR  C DP
Sbjct: 291 RIRTVEYSCREHSFAEPCKAPPSIAGRIPCPYSPKALKTCPCGETPLENMETPRTKCTDP 350

Query: 349 IPTCNSRCSKPLKCGKHSCPFICHDLACMDPCLQIDSAKCACEQSTFSVPCGFQGRPRCN 408
           IPTC++ C K L CG+H CPF CH   CM+ C   D  KC+C    F VPC FQG PRCN
Sbjct: 351 IPTCDATCGKLLSCGRHRCPFKCHTGTCMEICTCSDKIKCSCNSRPFIVPCKFQGPPRCN 410

Query: 409 IKCESLMSCRRHRCTDRCCSGRPSAVKRRKNFFRSQDLLDESLVEAKHICLKPCNLTLSC 468
            KCESLMSCRRHRC +RCC GR  A  R K  F ++D LDESLVEA+HICLK CNL LSC
Sbjct: 411 TKCESLMSCRRHRCAERCCDGRSLAQVREKKVFLTRDKLDESLVEAQHICLKKCNLKLSC 470

Query: 469 GIHKCQRKCHPGKCPPCLESDSNDLICPCGKTVVPAPVRCGTELPVCNHPCIKVVRGESS 528
           G H CQRKCHPG CPPCLESDSNDL+CPCGKTV PAPVRCGT LP C +PCIK ++G   
Sbjct: 471 GRHFCQRKCHPGNCPPCLESDSNDLVCPCGKTVAPAPVRCGTVLPPCRNPCIKTLQGPLD 530

Query: 529 CGHKPMPHTCHPLGVPCPPCTETVFKPCKCGKKDKVRTVCFQKDVSCGTKCGLLLHFCRH 588
           CGH PMPH CH L  PCP CT  VFK CKCGK  KVRT+CFQ +VSCG  CG  L  C H
Sbjct: 531 CGHPPMPHACHSLDEPCPSCTAPVFKQCKCGKNKKVRTLCFQNNVSCGRVCGKQLVSCHH 590

Query: 589 TCQKTCHLPGNCQKVCKQICGHERLSCRHTCPKPCHGKTECPDLPCPTLVKITCKCGRNE 648
           +C KTCH  G CQ +CKQ+CG  R +C H C   CH  + CPD+PC   V++ C CG   
Sbjct: 591 SCTKTCHREGECQSICKQVCGISRSNCSHICRFKCHTGSPCPDVPCNVTVEVKCGCGHRS 650

Query: 649 KSVTCSAKSGVVPANESSVLDCDEECEALKRLKELREAFGIKEESNNVTSNELDALKKLV 708
              TC+A  G  PA++   L+C E+C A +R  EL EAFG+  E+   T   +D L  L 
Sbjct: 651 SFATCAAHEGQDPADQRP-LECTEDCAAARRRLELMEAFGMNTETVQPTEGIVD-LAALA 708

Query: 709 SVATTFEELHLPFTETTLSVYSKQERWCSQIEVILNKLMDDKTRSSLHFKPMRPPQRHFI 768
              TTF+EL LPFTE +LS+++KQ  WCSQIE  LN+LM D ++ SLHFKPM+PPQRHFI
Sbjct: 709 EKVTTFQELMLPFTEASLSIFAKQSNWCSQIEEHLNRLMSDISKPSLHFKPMKPPQRHFI 768

Query: 769 RELAKAYGLYSESQDREPMRSVFIKKEDNGTSNKPVLSLGEALPLYESFKQLQKERKVQE 828
            ELA+AY LY ESQD+EP RSV++KK  +  S KP LSL EALPLY+SFK  QKERK++E
Sbjct: 769 HELAQAYKLYCESQDKEPKRSVYVKKTVD--SRKPSLSLKEALPLYQSFKNAQKERKLKE 826

Query: 829 FQSRTTAKLINFEVQDAQPKVEVAKNNGFLVRNLVTGNTVEDLKRFFEPHLKHTLVVNPQ 888
            +  TT +++N+     +    VA+ NG L++ +  G   + ++  F  +LKHTL+ +P 
Sbjct: 827 LERSTTTRILNY-TSTGESSPPVAQINGLLIQKVFEGTDEKTIEACFADYLKHTLIKDPN 885

Query: 889 YLILDDGKTALVYPENYETASVNTERDMELLVGHFDFMAKEAFLADSILLCSTDEEVGKR 948
           YL LD G   +V+ ENY TAS+N ERD+  +VGH D +AK++FLA+ + +C  ++     
Sbjct: 886 YLKLDSGD-VMVFAENYATASINVERDINRVVGHLDLIAKDSFLAEGVTVCRVEQ----- 939

Query: 949 LDTPVIQEDTSIEDKN 964
               V+ E+T+  D++
Sbjct: 940 ----VMAEETNRSDES 951

>Kwal_27.11518 s27 complement(832986..835847) [2862 bp, 953 aa] {ON}
           YNL023C (FAP1) - Transcription factor homolog;
           similarity to Drosophila melanogaster shuttle craft
           protein; similarity to human NFX1 protein; similarity to
           human DNA-binding protein tenascin [contig 27] FULL
          Length = 953

 Score =  998 bits (2580), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 507/910 (55%), Positives = 626/910 (68%), Gaps = 17/910 (1%)

Query: 29  DSSVEDNNEQPSSYEEETDD--DMQYYERSIQEISKGDSYICMICTVEMDYTCQMFACKR 86
           D+S E++ E     E+E D+  D  YYE++++EI KGD Y CMICTVEMD+TC M+AC  
Sbjct: 21  DASSEES-EDFEHVEDEIDELEDQPYYEKTVKEIEKGDRYPCMICTVEMDFTCHMYACPD 79

Query: 87  CYRVFDYGCIREWAIKSTEKTVDRIWKCPNCYHVGKKVPANNRPTCWCGKVVXXXXXXXX 146
           CYRVFD+ CIREWA+KST+K+V + WKCPNCY   K+VP  NRPTCWCGK V        
Sbjct: 80  CYRVFDFECIREWALKSTQKSVSKTWKCPNCYFERKEVPMKNRPTCWCGKSVQPEPNPLN 139

Query: 147 XXSCGQTCSAPICIHGCSKTCHLGPHPECTRMVEIMCHCGKHSQSIFCYQSKAMKKNFKC 206
             SCGQTC A IC HGCS  CHLGPHP C RMV++ C+CGK ++S+FC+++     +F C
Sbjct: 140 PNSCGQTCDAQICEHGCSSICHLGPHPTCMRMVQVKCNCGKKNKSVFCHEAGKFVDSFIC 199

Query: 207 QEECGLPLSCSVHNCKRKCHTGLCGPCPELITSKDSTEEQIKCYCGNHSRASIKCSEARF 266
              CGL L C +H C+RKCH+G+CG CPE I         I CYC   S+ S+KC+E R 
Sbjct: 200 DSPCGLTLPCGIHKCQRKCHSGICGECPESIYGT------INCYCKLESKPSLKCTEVRI 253

Query: 267 PKSGRSSKDGNGNEWIGVFACTDIRTVDFSCRKHSFIEPCLSPPSVNGRKVCPFLPSLLK 326
              GRS +D +GN+W+G F+C +IRTV+ SC+KHSF EPC +PPS++G+  CPF P  LK
Sbjct: 254 --EGRS-RDSSGNKWVGAFSCENIRTVEHSCKKHSFAEPCKAPPSISGQVPCPFSPRTLK 310

Query: 327 TCPCGRTALDELTKPRKHCDDPIPTCNSRCSKPLKCGKHSCPFICHDLACMDPCLQIDSA 386
           TCPCGR+ L E+   R  C DPIPTC+S C K L+CGKH CPF CH  +CM+ CL  D  
Sbjct: 311 TCPCGRSPLREMDVSRSQCTDPIPTCDSVCGKMLRCGKHKCPFKCHTGSCMEECLCTDKV 370

Query: 387 KCACEQSTFSVPCGFQGRPRCNIKCESLMSCRRHRCTDRCCSGRPSAVKRRKNFFRSQDL 446
           KC+C    F VPC FQ + RCN KCE+LMSCRRHRC +RCC GR  A  R K  F ++D 
Sbjct: 371 KCSCHARQFIVPCKFQEKARCNTKCEALMSCRRHRCIERCCDGRSLAQSREKKVFLTRDK 430

Query: 447 LDESLVEAKHICLKPCNLTLSCGIHKCQRKCHPGKCPPCLESDSNDLICPCGKTVVPAPV 506
           LDESLVEA+HICLK CNL LSCG H C+RKCHPG C PCLESDSNDL+CPCGKTVVPAPV
Sbjct: 431 LDESLVEAQHICLKQCNLKLSCGKHFCKRKCHPGNCAPCLESDSNDLVCPCGKTVVPAPV 490

Query: 507 RCGTELPVCNHPCIKVVRGESSCGHKPMPHTCHPLGVPCPPCTETVFKPCKCGKKDKVRT 566
           RCGT LP C HPCIK ++G + CGH PMPH CHPL  PCP CT  VFK CKC K DKVRT
Sbjct: 491 RCGTVLPRCLHPCIKTLQGPAPCGHPPMPHPCHPLEEPCPSCTAPVFKSCKCRKNDKVRT 550

Query: 567 VCFQKDVSCGTKCGLLLHFCRHTCQKTCHLPGNCQKVCKQICGHERLSCRHTCPKPCHGK 626
           +CFQ DVSCG  CG  L  C+H CQK CH  G CQ  CKQ CG  R +C H C   CH  
Sbjct: 551 LCFQNDVSCGRVCGKQLAGCQHICQKACHKEGECQTSCKQPCGKTRENCEHRCRALCHSG 610

Query: 627 TECPDLPCPTLVKITCKCGRNEKSVTCSAKSGVVPANESSVLDCDEECEALKRLKELREA 686
           T CPD PC  LV I C CG    +VTC A     PA E++ L+C+ +C+  +R  EL EA
Sbjct: 611 TPCPDKPCLNLVDIKCNCGHRSTTVTCGANENRAPAEETA-LECNNDCDVARRHHELMEA 669

Query: 687 FGIKEESNNVTSNELDALKKLVSVATTFEELHLPFTETTLSVYSKQERWCSQIEVILNKL 746
           FGIK ++N   S  L+ L+ L    +TF+EL LPF+E TLS++SKQ  WC+QIE  L +L
Sbjct: 670 FGIKNDANQ-GSKSLEDLEALAEKVSTFQELLLPFSEATLSIFSKQTTWCTQIEECLERL 728

Query: 747 MDDKTRSSLHFKPMRPPQRHFIRELAKAYGLYSESQDREPMRSVFIKKEDNGTSNKPVLS 806
           M+DK + SLHFKPMRPPQRHFI EL +AY LY ESQD+EP RSVF+KK     S +P +S
Sbjct: 729 MNDKNKPSLHFKPMRPPQRHFIHELGQAYHLYCESQDQEPKRSVFVKK--TADSQRPSIS 786

Query: 807 LGEALPLYESFKQLQKERKVQEFQSRTTAKLINFEVQDAQPKVEVAKNNGFLVRNLVTGN 866
           L  ALPLY SFK  Q+E+K++E +  TT ++IN+ V D       A+ NG LV+N++ G 
Sbjct: 787 LKVALPLYYSFKSAQREKKLKETERHTTTRIINYAVTDQAQTPPAARFNGLLVQNVLNGI 846

Query: 867 TVEDLKRFFEPHLKHTLVVNPQYLILDDGKTALVYPENYETASVNTERDMELLVGHFDFM 926
             + ++  F  +LKHTL+ +P YL+L  G   LVY ++Y TASVN E D+E +VGH D +
Sbjct: 847 NEKAIQESFSEYLKHTLLKDPHYLLLASGD-VLVYCDDYSTASVNVENDIERIVGHLDHI 905

Query: 927 AKEAFLADSI 936
            KE  LA+ +
Sbjct: 906 VKEQLLAEGV 915

>TPHA0D01530 Chr4 complement(313063..315951) [2889 bp, 962 aa] {ON}
           Anc_2.288 YNL023C
          Length = 962

 Score =  985 bits (2546), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/924 (51%), Positives = 630/924 (68%), Gaps = 15/924 (1%)

Query: 35  NNEQPSSYEEETDDDMQYYERSIQEISKGDSYICMICTVEMDYTCQMFACKRCYRVFDYG 94
           +NE      E+ DD + YYE++I++ISKGD Y CMICT+EMDYTC+M+AC+ CYRVFDY 
Sbjct: 30  SNESNFDSSEDEDDGLVYYEQTIRDISKGDRYTCMICTIEMDYTCKMYACQSCYRVFDYE 89

Query: 95  CIREWAIKSTEKTVDRIWKCPNCYHVGKKVPANNRPTCWCGKVVXXXXXXXXXXSCGQTC 154
           CI+EWA KS  KT+D++WKCPNC H  K++P  NRPTCWCGKV+          SCGQTC
Sbjct: 90  CIQEWAEKSASKTIDKVWKCPNCSHSSKQIPLRNRPTCWCGKVINPDPNELSPNSCGQTC 149

Query: 155 SAPICIHGCSKTCHLGPHPECTRMVEIMCHCGKHSQSIFCYQSKAMKKN--FKCQEECGL 212
           +   C+HGC   CHLGPH EC+ +  + C CG++ + IFC+Q K   KN  ++C E C L
Sbjct: 150 NKKTCVHGCKNFCHLGPHGECSVITTLKCKCGRNEKDIFCHQLKKSNKNNVYQCNEVCQL 209

Query: 213 PLSCSVHNCKRKCHTGLCGPCPELITSKD------STEEQIKCYCGNHSRASIKCSEARF 266
           PL+C VH CKR CH+GLCG CPE+++S+       +   + KCYCG +S+  I C   + 
Sbjct: 210 PLACGVHKCKRVCHSGLCGACPEILSSEQIQSVESNENRKFKCYCGENSKNEIMCK--KL 267

Query: 267 PKSGRSSKDGNGNEWIGVFACTDIRTVDFSCRKHSFIEPCLSPPSVNGRKVCPFLPSLLK 326
             +G  SK+  G++WIG FAC   R V ++C +HSFIEPC +  S++G+K+CP+ P LL 
Sbjct: 268 AITGTFSKNSEGDKWIGTFACKTRRIVFYACNEHSFIEPCQAQLSISGKKICPYTPKLLN 327

Query: 327 TCPCGRTALDELTKPRKHCDDPIPTCNSRCSKPLKCGKHSCPFICHDLACMDPCLQIDSA 386
           +CPCG+T+L +L + RK C DPIPTC +RC K LKCGKH+CP+ICH+ +CMDPC+Q++  
Sbjct: 328 SCPCGKTSLKQLAQKRKKCTDPIPTCENRCGKALKCGKHTCPYICHNGSCMDPCIQLEVT 387

Query: 387 KCACEQSTFSVPCGFQGRPRCNIKCESLMSCRRHRCTDRCCSGRPSAVKRRKNFFRSQDL 446
            C+C Q  F VPC F+  P+C  KCESLMSCRRHRC  +CC+G+P A KR+K     ++L
Sbjct: 388 NCSCLQKHFLVPCNFEQTPKCTFKCESLMSCRRHRCPKKCCTGKPEADKRKKMLLTREEL 447

Query: 447 LDESLVEAKHICLKPCNLTLSCGIHKCQRKCHPGKCPPCLESDSNDLICPCGKTVVPAPV 506
            DESLVEA HICLK CNL LSCGIH C RKCHPG+CP CL SDSNDL+CPCGKTV+ APV
Sbjct: 448 NDESLVEAVHICLKECNLKLSCGIHDCTRKCHPGRCPSCLISDSNDLVCPCGKTVIEAPV 507

Query: 507 RCGTELPVCNHPCIKVVRGESSCGHKPMPHTCHPLGVPCPPCTETVFKPCKCGKKDKVRT 566
           RCG++LP C   CIKV+     CGHKP PH CHP   PCPPCT  V +PCKCGK   V+ 
Sbjct: 508 RCGSKLPPCPFECIKVIERSYPCGHKPPPHQCHPSTEPCPPCTAVVERPCKCGKHHAVKA 567

Query: 567 VCFQKDVSCGTKCGLLLHFCRHTCQKTCHLPGNCQKVCKQICGHERLSCRHTCPKPCHGK 626
           VCFQ+  SCG  C   L  C H CQ  CH  G CQK CKQ+C  +R +C H C   CHG 
Sbjct: 568 VCFQEFGSCGEICNKELENCHHKCQYKCHEIGQCQKSCKQVCNKDRANCNHQCKSKCHGS 627

Query: 627 TECPDLPCPTLVKITCKCGRNEKSVTCSAKSGVVPANESSVLDCDEECEALKRLKELREA 686
           + CPD+PC  + K++CKCGR ++   C A      A+   +L CDE+CEA  R  +LR+A
Sbjct: 628 SPCPDVPCNEVTKVSCKCGRKQEYRKCYATLDNSSAS-IELLPCDEDCEAHARHLQLRDA 686

Query: 687 FGIKEESNNVTSNELDALKKLVSVATTFEELHLPFTETTLSVYSKQERWCSQIEVILNKL 746
           FG  + S + ++  +  ++ L+   +T+EEL LP+ ++ +S YSKQ +WCSQIE IL K 
Sbjct: 687 FGY-DSSLDTSNKNIQDIQSLMEKVSTYEELRLPYPQSVISTYSKQIKWCSQIEDILRKF 745

Query: 747 MDDKTRSSLHFKPMRPPQRHFIRELAKAYGLYSESQDREPMRSVFIKKEDNGTSNKPVLS 806
           + DK +++LHFKPM+P QRHF+REL+ ++ LYSESQD EP RSVF+K++ +  +  P +S
Sbjct: 746 VLDKAKNNLHFKPMKPAQRHFVRELSTSFNLYSESQDPEPKRSVFVKRKVD--TRIPNIS 803

Query: 807 LGEALPLYESFKQLQKERKVQEFQSRTTAKLINFEVQDAQPKVEVAKNNGFLVRNLVTGN 866
           L E LPL+  FK+L+KERK+Q F+S +  K IN+E ++   K      NGF ++ +  G 
Sbjct: 804 LEEVLPLWTGFKKLEKERKIQHFESTSQRKYINYEPKEVIVK-SSNDTNGFFIKKISPGI 862

Query: 867 TVEDLKRFFEPHLKHTLVVNPQYLILDDGKTALVYPENYETASVNTERDMELLVGHFDFM 926
           T EDL   F   LK TL+ N  Y IL +   A++YPE Y + + +  +D+E+LVGHFDF+
Sbjct: 863 TEEDLSEVFGKALKSTLIKNVCYKILPESSDAIIYPEQYNSITESVHQDLEVLVGHFDFI 922

Query: 927 AKEAFLADSILLCSTDEEVGKRLD 950
            KEA + DSI+LC+ +  + +  D
Sbjct: 923 GKEALIFDSIMLCNVEGYINQISD 946

>KLLA0E08317g Chr5 complement(747272..750037) [2766 bp, 921 aa] {ON}
           similar to uniprot|P53971 Saccharomyces cerevisiae
           YNL023C
          Length = 921

 Score =  912 bits (2358), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/900 (49%), Positives = 581/900 (64%), Gaps = 16/900 (1%)

Query: 49  DMQYYERSIQEISKGDSYICMICTVEMDYTCQMFACKRCYRVFDYGCIREWAIKSTEKTV 108
           ++ YYE++++EI  GD Y+CMICTVE+D TC+M+AC  CYRVFDY C+REWA+KST KT+
Sbjct: 31  NIPYYEQTVKEIKDGDQYVCMICTVELDSTCRMYACDSCYRVFDYECVREWALKSTNKTL 90

Query: 109 DRIWKCPNCYHVGKKVPANNRPTCWCGKVVXXXXXXXXXXSCGQTCSAPICIHGCSKTCH 168
           D+ WKCPNCY +  K+P   R TCWCGKVV          SCGQTC+A  C+HGCSK CH
Sbjct: 91  DKSWKCPNCYKINHKIPKQKRSTCWCGKVVNPDVNELDPNSCGQTCNAYSCVHGCSKVCH 150

Query: 169 LGPHPECTRMVEIMCHCGKHSQSIFCYQSKAMKKNFKCQEECGLPLSCSVHNCKRKCHTG 228
           LGPHPEC   V+I C CGKH + I C +SK +  ++ C + CGL L C  H C++ CHTG
Sbjct: 151 LGPHPECLIPVQIKCKCGKHCKQIPCSRSKVLGNSYNCGDVCGLLLPCGKHTCQKTCHTG 210

Query: 229 LCGPCPELITSKDSTEEQIKCYCGNHSRASIKCSEARFPKSGRSSKDGNGNEWIGVFACT 288
            CGPC  +I +      ++ CYCG+  ++ I+CS+ R       SKD +G +WIGV++C 
Sbjct: 211 FCGPCESIIKT------ELPCYCGSDVKSGIQCSDLRVLDY---SKDVSGKKWIGVYSCG 261

Query: 289 DIRTVDFSCRKHSFIEPCLSPPSVNGRKVCPFLPSLLKTCPCGRTALDELTKPRKHCDDP 348
           ++RT+ +SC  H+++E CL+P  ++  + CPF P  LKTCPCG+T L EL KPR+ C D 
Sbjct: 262 EVRTLHYSCDHHTYVEQCLAPAGIDRSRPCPFSPKTLKTCPCGKTMLKELDKPRRKCTDT 321

Query: 349 IPTCNSRCSKPLKCGKHSCPFICHDLACMDPCLQIDSAKCACEQSTFSVPCGFQGRPRCN 408
           IPTC++ C K L CGKH+CPF CH   CMDPCL I    C C   TF  PC     PRCN
Sbjct: 322 IPTCSNVCGKQLSCGKHTCPFSCHTGDCMDPCLIITKTPCTCHSKTFLTPCQLHDTPRCN 381

Query: 409 IKCESLMSCRRHRCTDRCCSGRPSAVKRRKNFFRSQDLLDESLVEAKHICLKPCNLTLSC 468
           IKCES MSCRRH+C + CCSG+P+A KR K  F  +DL +E+LVE +H+CLK CNL LSC
Sbjct: 382 IKCESNMSCRRHKCMEICCSGKPAAKKREKTLFLKRDLNNETLVEPEHVCLKQCNLKLSC 441

Query: 469 GIHKCQRKCHPGKCPPCLESDSNDLICPCGKTVVPAPVRCGTELPVCNHPCIKVVRGESS 528
           GIH C  KCHPGKCPPCLESD NDL+CPCGKTVVPAPVRCGT+LP C +PCIK+  G + 
Sbjct: 442 GIHDCTWKCHPGKCPPCLESDPNDLVCPCGKTVVPAPVRCGTKLPPCPNPCIKISEGPAP 501

Query: 529 CGHKPMPHTCHPLGVPCPPCTETVFKPCKCGKKDKVRTVCFQKD--VSCGTKCGLLLHFC 586
           CGH+  PH CHP G  CPPCT  V K C+C KK  +RT+C   D  V+CGT+CGL L  C
Sbjct: 502 CGHRVGPHKCHPAGTDCPPCTANVIKKCRCYKKHDMRTLCLVPDSQVACGTECGLPLATC 561

Query: 587 RHTCQKTCHLPGNCQKVCKQICGHERLSCRHTCPKPCHGKTECPDLPCPTLVKITCKCGR 646
            H CQK CH+ G C+  C + CG +R  C H C + CHG + CP+  C   V ITC C R
Sbjct: 562 HHKCQKKCHVEGECEIKCAKPCGLKRSLCGHLCKEKCHGNSPCPEKVCHEKVVITCDCNR 621

Query: 647 NEKSVTCSAKSGVVPANESSVLDCDEECEALKRLKELREAFGIKEESNNVTSNELDALKK 706
             K V C A       +E+  L CDEEC  L+R  EL EAFG+ E+  N      + L+ 
Sbjct: 622 RTKQVECGATHDTQSRSETEKLPCDEECAKLQRHMELMEAFGMNEKPKNTK----EQLES 677

Query: 707 LVSVATTFEELHLPFTETTLSVYSKQERWCSQIEVILNKLMDDKTRSSLHFKPMRPPQRH 766
           +V VA  F++L++P++E  L+VY KQ  WC QI  + +K ++D  + SLH KPMR PQR 
Sbjct: 678 IVLVAKKFDDLNMPYSELVLNVYKKQVNWCDQICAVFDKFIEDTQKLSLHLKPMRVPQRQ 737

Query: 767 FIRELAKAYGLYSESQDREPMRSVFIKKEDNGTSNKPVLSLGEALPLYESFKQLQKERKV 826
           FI+ELA AY LYSESQDREP RSV++KK     S KP L+L +A  LY+ FK L+KER  
Sbjct: 738 FIKELASAYALYSESQDREPNRSVYLKK-IQSQSKKPELTLKDASELYQLFKTLEKERMQ 796

Query: 827 QEFQSRTTAKLINFEVQDAQPKVEVAKNNGFLVRNLVTGNTVEDLKRFFEPHLKHTLVVN 886
           + + ++ T  LIN    +          N  ++  +   + +++++      LK+TLV  
Sbjct: 797 EHYSTKVTKTLINIPASETPLPAPYEGPNAIVISGVFDSSQIDNIEPLVHDFLKYTLVKT 856

Query: 887 PQYLILDDGKTALVYPENYETASVNTERDMELLVGHFDFMAKEAFLADSILLCSTDEEVG 946
           PQY  L D  + L++PENY   + NT  DME ++       ++  LA  + +C  DE + 
Sbjct: 857 PQYRFLKDLNSVLIFPENYSGITKNTASDMEKVIPFIKTALQDQMLATGVEMCQVDENLS 916

>ADL213W Chr4 (329646..332372) [2727 bp, 908 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL023C (FAP1)
          Length = 908

 Score =  876 bits (2264), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 449/901 (49%), Positives = 560/901 (62%), Gaps = 21/901 (2%)

Query: 48  DDMQYYERSIQEISKGDSYICMICTVEMDYTCQMFACKRCYRVFDYGCIREWAIKSTEKT 107
           + + YYE+++ E+  G++Y C+ICTVEMD +C M+AC +CYRV+DY CIR WA+K+T  T
Sbjct: 14  EGIPYYEQTVLELRDGETYQCLICTVEMDASCPMYACHQCYRVYDYECIRRWALKATSTT 73

Query: 108 VDRIWKCPNCYHVGKKVPANNRPTCWCGKVVXXXXXXXXXXSCGQTCSAPICIHGCSKTC 167
           VDR WKCPNCYHV +KVP  NR TCWCGK V          SCGQTC APIC HGCSK C
Sbjct: 74  VDRTWKCPNCYHVNRKVPPKNRHTCWCGKQVNLDPNYINPNSCGQTCGAPICQHGCSKLC 133

Query: 168 HLGPHPECTRMVEIMCHCGKHSQSIFCYQSKAMKKNFKCQEECGLPLSCSVHNCKRKCHT 227
           HLGPH EC   ++  C CGK ++ I CY++KA K+NF C + CGLP+ C +H C+R CH 
Sbjct: 134 HLGPHEECMVRIDFKCRCGKLTEEIPCYEAKAAKRNFSCDQPCGLPMPCGIHKCERVCHN 193

Query: 228 GLCGPCPELITSKDSTEEQIKCYCGNHSRASIKCSEARFPKSGRSSKDGNGNEWIGVFAC 287
           G CGPC E I         IKCYCG  +R  + CSE       + SK      WIG FAC
Sbjct: 194 GPCGPCKEEIAG------DIKCYCGLTTRNKMVCSEVSVVARSKVSK---YKSWIGAFAC 244

Query: 288 TDIRTVDFSCRKHSFIEPCLSPPSVNGRKVCPFLPSLLKTCPCGRTALDELTKPRKHCDD 347
             +R V +SC KHSF E C++PPS+  R  CP+ P    TCPCG+T L EL   R  C D
Sbjct: 245 DRMREVPYSCGKHSFHEKCIAPPSLPKRTPCPYSPENCTTCPCGKTQLAELGSTRTACTD 304

Query: 348 PIPTCNSRCSKPLKCGKHSCPFICHDLACMDPCLQIDSAKCACEQSTFSVPCGFQGRPRC 407
            I +C   C K L CG H+CP  CHD  CMDPCL I   KCACEQ  F VPC F   P C
Sbjct: 305 HISSCGKVCGKQLSCGNHTCPMTCHDGNCMDPCLVITEQKCACEQRRFLVPCQFPHSPSC 364

Query: 408 NIKCESLMSCRRHRCTDRCCSGRPSAVKRRKNFFRSQDLLDESLVEAKHICLKPCNLTLS 467
             KCESLMSCRRHRC +RCCSGRP +VKR     R +   DES VEA+H+CLK CN  L 
Sbjct: 365 TAKCESLMSCRRHRCAERCCSGRPHSVKRNSR-RRRESPDDESEVEAQHVCLKDCNRVLL 423

Query: 468 CGIHKCQRKCHPGKCPPCLESDSNDLICPCGKTVVPAPVRCGTELPVCNHPCIKVVRGES 527
           CGIH C  KCH GKCPPCLESDSNDLICPCGKT+VPAPVRCGT+LP C HPC   +    
Sbjct: 424 CGIHMCNYKCHAGKCPPCLESDSNDLICPCGKTIVPAPVRCGTKLPRCTHPCRNSLLDTW 483

Query: 528 SCGHKPMPHTCHPLGVPCPPCTETVFKPCKCGKKDKVRTVCFQKDVSCGTKCGLLLHFCR 587
            CGH P  H CHPL  PCPPCT TV K C+CG K+++RT C+  DVSC   C   L +C 
Sbjct: 484 PCGHSPPSHNCHPLDEPCPPCTITVKKTCRCG-KNEIRTFCYNDDVSCSRPCKKPLSYCN 542

Query: 588 HTCQKTCHLPGNCQKVCKQICGHERLSCRHTCPKPCHGKTECPDLPCPTLVKITCKCGRN 647
           H CQ  CH  G CQ+ CKQ CG  R +C H C   CHG T CP+ PC     ITC CG  
Sbjct: 543 HFCQVPCHSDGQCQQTCKQACGLPRKACEHVCKAKCHGHTACPESPCTEKKTITCSCGHK 602

Query: 648 EKSVTCSAKSGVVPA-NESSVLDCDEECEALKRLKELREAFGIKEESNNVTSNELDALKK 706
             +  CS  +G       S  L CDE+C   +R ++L  AFG+ E++   TS E +AL  
Sbjct: 603 SSTKICSEYAGKDDGIGASQHLSCDEDCAKFQRHQQLMRAFGVVEKA---TSEEDEAL-L 658

Query: 707 LVSVATTFEELHLPFTETTLSVYSKQERWCSQIEVILNKLMDDKTRSSLHFKPMRPPQRH 766
           L   + +F++LHLPFTE  LSV++KQ +WC+QIE  L KLMDD +  +LHFKPMR  QR 
Sbjct: 659 LAQRSQSFDDLHLPFTEYVLSVFTKQSQWCTQIEQYLIKLMDDSSPKALHFKPMRAAQRR 718

Query: 767 FIRELAKAYGLYSESQDREPMRSVFIKKEDNGTSNKPVLSLGEALPLYESFKQLQKERKV 826
           F+ EL+ ++GLYSESQD EP RSV++KK   G S  P + L +A PLY SFK+L++E K 
Sbjct: 719 FVHELSSSFGLYSESQDPEPKRSVYVKK--TGISRVPAIGLSKAAPLYTSFKKLEREFKA 776

Query: 827 QEFQSRTTAKLINFEVQDAQPKVEVAKNNGFLVRNLVTGNTVEDLKRFFEPHLKHTLVVN 886
              +S  T KL++  + D+      A  N  L+  L +  +   L+  F  +   TL+  
Sbjct: 777 NS-ESAVTKKLVSVHIDDSPESQHDAAINAILLSGLTSFASESALRDCFADYFSQTLLNC 835

Query: 887 PQYLILDDGKTALVYPENYETASVNTERDMELLVGHFDFMAKEAFLADSILLCSTDEEVG 946
           PQY++   G    ++P +Y + S N E+D+  L G+F  + +E  L   I  C  D  + 
Sbjct: 836 PQYVV--RGTEGYIFPTDYLSLSANAEKDLTKLAGYFRLLFQEQNLWTDISTCKLDSNLN 893

Query: 947 K 947
           +
Sbjct: 894 R 894

>Ecym_3327 Chr3 (626396..629176) [2781 bp, 926 aa] {ON} similar to
           Ashbya gossypii ADL213W
          Length = 926

 Score =  874 bits (2259), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/914 (48%), Positives = 574/914 (62%), Gaps = 21/914 (2%)

Query: 25  SSEQDSSVEDNNEQPSSYEEETDDD-MQYYERSIQEISKGDSYICMICTVEMDYTCQMFA 83
           +SE+ S VE+ +   S Y  E DDD + YYE++I++I  G  Y C+ICTVE+D TC+M+A
Sbjct: 4   TSERSSEVEEVSY--SDYLSEADDDGLPYYEKAIKDIQNGYLYQCLICTVEIDSTCRMYA 61

Query: 84  CKRCYRVFDYGCIREWAIKSTEKTVDRIWKCPNCYHVGKKVPANNRPTCWCGKVVXXXXX 143
           C  CYRV+DY CI EWA KS++++ D  WKCPNCYH   KV    R TCWCGK +     
Sbjct: 62  CSNCYRVYDYECIMEWAKKSSKRSADSTWKCPNCYHSYNKVLPKKRSTCWCGKQINPEKN 121

Query: 144 XXXXXSCGQTCSAPICIHGCSKTCHLGPHPECTRMVEIMCHCGKHSQSIFCYQSKAMKKN 203
                SCGQTC A IC HGC+ TCHLGPHP+C   V + C CGK ++ I CYQ+KA+K  
Sbjct: 122 ATYPNSCGQTCGASICKHGCASTCHLGPHPKCMVPVGLKCKCGKITEQISCYQTKAVKPK 181

Query: 204 FKCQEECGLPLSCSVHNCKRKCHTGLCGPCPELITSKDSTEEQIKCYCGNHSRASIKCSE 263
             C+  CGLPL C VH C++ CH+G CG C  +++ K       KCYCG++   SI C +
Sbjct: 182 LSCKLPCGLPLPCGVHTCQKICHSGPCGRCNTVMSGK------FKCYCGSNHLDSIICKD 235

Query: 264 ARFPKSGRSSKDGNGNEWIGVFACTDIRTVDFSCRKHSFIEPCLSPPSVNGRKVCPFLPS 323
               K  RS   G   +WIGVF+C +IR V + C++HSF E C   PS + R  CP+ P+
Sbjct: 236 VAVTKMSRS---GKHKKWIGVFSCKNIREVRYRCKEHSFNESCKPSPSPDARIQCPYSPN 292

Query: 324 LLKTCPCGRTALDELTKPRKHCDDPIPTCNSRCSKPLKCGKHSCPFICHDLACMDPCLQI 383
           + KTC CG T L ++ + R+ C DPIPTC+ RC KPL CGKH+CP  CH   CMDPCLQI
Sbjct: 293 ICKTCCCGNTTLIDMQQKREKCTDPIPTCDQRCGKPLSCGKHTCPMTCHPGKCMDPCLQI 352

Query: 384 DSAKCACEQSTFSVPCGFQGRPRCNIKCESLMSCRRHRCTDRCCSGRPSAVKRRKNFFRS 443
           +  KC+C++ TF  PC F G+P CNIKCE+LMSCRRHRC  RCCSG+P A+ R       
Sbjct: 353 EERKCSCQERTFLTPCQFDGKPSCNIKCENLMSCRRHRCIKRCCSGKPLALARSSTITPW 412

Query: 444 QDLLDESLVEAKHICLKPCNLTLSCGIHKCQRKCHPGKCPPCLESDSNDLICPCGKTVVP 503
            D  DESL+EA+HIC K CN  LSCG+H C  KCHPGKCPPCLESDSNDL+CPCGK+V+ 
Sbjct: 413 LDKNDESLIEAEHICFKNCNRKLSCGLHHCTNKCHPGKCPPCLESDSNDLVCPCGKSVIL 472

Query: 504 APVRCGTELPVCNHPCIKVVRGESSCGHKPMPHTCHPLGVPCPPCTETVFKPCKCGKKDK 563
           APVRCGT  P CN+PCI  +RG   CGH+   H CHP    CPPCT  V+KPCKCGK   
Sbjct: 473 APVRCGTVRPNCNYPCINTLRGSMPCGHRAPFHKCHPSTEDCPPCTAFVYKPCKCGKLTA 532

Query: 564 VRTVCFQKDVSCGTKCGLLLHFCRHTCQKTCHLPGNCQKVCKQICGHERLSCRHTCPKPC 623
            RT+CFQ D+SCG KC   L  C H CQK CH PG C   C ++CG +R +C H C   C
Sbjct: 533 ARTICFQNDISCGRKCAAKLTNCHHLCQKQCHPPGECPNTCTEVCGLKRSACEHLCTANC 592

Query: 624 HGKTECPDLPCPTLVKITCKCGRNEKSVTCSAKSGVVPANESSVLDCDEECEALKRLKEL 683
           HG   CPD+PC   V ++C CGR    V C A      A  +  L CD++C  +++ + L
Sbjct: 593 HGDEICPDVPCLEEVVVSCGCGRRSLKVPCGAYKDKESATATQSLLCDDDCAKVQKHQML 652

Query: 684 REAFGIKEESNNVTSNELDALKKLVSVATTFEELHLPFTETTLSVYSKQERWCSQIEVIL 743
            +     E +N         + K     T++E+L LP++E  + V+SKQ  WC  I+  L
Sbjct: 653 LQTLRSSESTNKAEHGSSSVINK----PTSYEDLGLPYSEQMMCVFSKQATWCKNIQDSL 708

Query: 744 NKLMDDKTRSSLHFKPMRPPQRHFIRELAKAYGLYSESQDREPMRSVFIKKEDNGTSNKP 803
            +L++DK+R SLHFKPM+ PQR F+ EL+KA+GLYSESQDREP RSVF+K     TS  P
Sbjct: 709 IRLLEDKSRKSLHFKPMKAPQRQFVHELSKAFGLYSESQDREPKRSVFVKILK--TSKIP 766

Query: 804 VLSLGEALPLYESFKQLQKERKVQEFQSRTTAKLINFEVQD-AQPKVEVAKNNGFLVRNL 862
            + L EAL LY+  K  QKER+  E Q  TT  LI+  + D +  K   A  N  L+  +
Sbjct: 767 AIGLSEALLLYQRMKTFQKERRDLELQHNTTKILISIPIDDGSDSKTLEASCNAILITGV 826

Query: 863 VTGNTVEDLKRFFEPHLKHTLVVNPQYLILDDGKTALVYPENYETASVNTERDMELLVGH 922
               TVE++K  F+  LK TL+ +PQ+ +++    A +YP N+   S N E D++ LV +
Sbjct: 827 PRTVTVENIKACFDECLKQTLLKDPQFRLINSN--AYIYPSNFLEISANVETDIQRLVPY 884

Query: 923 FDFMAKEAFLADSI 936
           F  + +   +  ++
Sbjct: 885 FSHVCERKQIGYNV 898

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.135    0.445 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 105,734,047
Number of extensions: 4677766
Number of successful extensions: 18525
Number of sequences better than 10.0: 72
Number of HSP's gapped: 17738
Number of HSP's successfully gapped: 76
Length of query: 965
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 846
Effective length of database: 39,836,145
Effective search space: 33701378670
Effective search space used: 33701378670
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 71 (32.0 bits)