Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_14.3072.289ON24624611921e-167
YNL024C2.289ON24624611011e-153
Skud_14.3052.289ON24924610751e-149
Suva_14.3232.289ON25324610401e-144
NCAS0G03850singletonON2512507831e-105
NCAS0G037702.289ON2512507831e-105
NDAI0G006802.289ON2552557751e-104
KNAG0H019802.289ON2492497671e-103
CAGL0M06897g2.289ON2482437425e-99
SAKL0E07612g2.289ON2522437081e-93
KAFR0H032902.289ON2452506671e-87
Kwal_27.115132.289ON2512426402e-83
KLTH0G10428g2.289ON2512426323e-82
Ecym_33282.289ON2542516115e-79
ADL212W2.289ON2512406091e-78
KLLA0E08295g2.289ON2662415561e-70
Smik_2.4141.325ON4171331012e-04
Skud_2.4031.325ON417132978e-04
AER240W1.325ON390117900.006
KNAG0C018001.325ON42164880.010
SAKL0D06798g1.325ON42182870.013
Skud_10.3524.352ON336199820.059
Suva_4.5321.325ON416133810.089
YBR271W (EFM2)1.325ON419132800.093
NDAI0J028604.352ON347189800.10
KAFR0C042501.325ON39170800.12
KNAG0B067204.352ON283106780.14
Smik_10.4224.352ON340178770.23
NCAS0B074101.325ON414129760.30
TDEL0D019401.325ON405128750.39
Suva_12.2204.352ON337112740.52
KAFR0E042804.352ON315201730.64
TBLA0D052001.325ON39967711.3
KNAG0E019002.259ON37586701.7
Ecym_55131.325ON39664701.7
CAGL0I09438g1.325ON40665683.2
Kwal_14.25501.325ON41868683.3
NDAI0B047301.325ON432128674.3
Kpol_1066.171.325ON43571665.3
TPHA0L003404.352ON34183665.6
ZYRO0G20548g1.325ON39768656.5
TBLA0G024902.259ON36881656.7
AGR214C8.591ON28363649.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_14.307
         (246 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_14.307 Chr14 complement(549501..550241) [741 bp, 246 aa] {O...   463   e-167
YNL024C Chr14 complement(587107..587847) [741 bp, 246 aa] {ON} P...   428   e-153
Skud_14.305 Chr14 complement(557846..558595) [750 bp, 249 aa] {O...   418   e-149
Suva_14.323 Chr14 complement(569944..570705) [762 bp, 253 aa] {O...   405   e-144
NCAS0G03850 Chr7 (713255..714010) [756 bp, 251 aa] {ON}               306   e-105
NCAS0G03770 Chr7 complement(694471..695226) [756 bp, 251 aa] {ON...   306   e-105
NDAI0G00680 Chr7 (150212..150979) [768 bp, 255 aa] {ON} Anc_2.28...   303   e-104
KNAG0H01980 Chr8 complement(348806..349555) [750 bp, 249 aa] {ON...   300   e-103
CAGL0M06897g Chr13 complement(702211..702957) [747 bp, 248 aa] {...   290   5e-99
SAKL0E07612g Chr5 complement(614835..615593) [759 bp, 252 aa] {O...   277   1e-93
KAFR0H03290 Chr8 complement(626525..627262) [738 bp, 245 aa] {ON...   261   1e-87
Kwal_27.11513 s27 complement(832028..832783) [756 bp, 251 aa] {O...   251   2e-83
KLTH0G10428g Chr7 (883191..883946) [756 bp, 251 aa] {ON} similar...   248   3e-82
Ecym_3328 Chr3 (629428..630192) [765 bp, 254 aa] {ON} similar to...   239   5e-79
ADL212W Chr4 (332487..333242) [756 bp, 251 aa] {ON} Syntenic hom...   239   1e-78
KLLA0E08295g Chr5 complement(746166..746966) [801 bp, 266 aa] {O...   218   1e-70
Smik_2.414 Chr2 (730531..731784) [1254 bp, 417 aa] {ON} YBR271W ...    44   2e-04
Skud_2.403 Chr2 (713779..715032) [1254 bp, 417 aa] {ON} YBR271W ...    42   8e-04
AER240W Chr5 (1080474..1081646) [1173 bp, 390 aa] {ON} Non-synte...    39   0.006
KNAG0C01800 Chr3 (352309..353574) [1266 bp, 421 aa] {ON} Anc_1.3...    39   0.010
SAKL0D06798g Chr4 complement(564525..565790) [1266 bp, 421 aa] {...    38   0.013
Skud_10.352 Chr10 complement(622581..623591) [1011 bp, 336 aa] {...    36   0.059
Suva_4.532 Chr4 (916493..917743) [1251 bp, 416 aa] {ON} YBR271W ...    36   0.089
YBR271W Chr2 (744852..746111) [1260 bp, 419 aa] {ON}  EFM2S-aden...    35   0.093
NDAI0J02860 Chr10 complement(713765..714808) [1044 bp, 347 aa] {...    35   0.10 
KAFR0C04250 Chr3 (844020..845195) [1176 bp, 391 aa] {ON} Anc_1.3...    35   0.12 
KNAG0B06720 Chr2 complement(1329424..1330275) [852 bp, 283 aa] {...    35   0.14 
Smik_10.422 Chr10 complement(653045..654067) [1023 bp, 340 aa] {...    34   0.23 
NCAS0B07410 Chr2 complement(1401275..1402519) [1245 bp, 414 aa] ...    34   0.30 
TDEL0D01940 Chr4 (376261..377478) [1218 bp, 405 aa] {ON} Anc_1.3...    33   0.39 
Suva_12.220 Chr12 complement(343489..344502) [1014 bp, 337 aa] {...    33   0.52 
KAFR0E04280 Chr5 complement(864926..865873) [948 bp, 315 aa] {ON...    33   0.64 
TBLA0D05200 Chr4 complement(1278210..1279409) [1200 bp, 399 aa] ...    32   1.3  
KNAG0E01900 Chr5 (393289..394416) [1128 bp, 375 aa] {ON} Anc_2.2...    32   1.7  
Ecym_5513 Chr5 (1042019..1043209) [1191 bp, 396 aa] {ON} similar...    32   1.7  
CAGL0I09438g Chr9 (904886..906106) [1221 bp, 406 aa] {ON} simila...    31   3.2  
Kwal_14.2550 s14 complement(809874..811130) [1257 bp, 418 aa] {O...    31   3.3  
NDAI0B04730 Chr2 complement(1171595..1172893) [1299 bp, 432 aa] ...    30   4.3  
Kpol_1066.17 s1066 complement(28462..29769) [1308 bp, 435 aa] {O...    30   5.3  
TPHA0L00340 Chr12 (45910..46935) [1026 bp, 341 aa] {ON} Anc_4.35...    30   5.6  
ZYRO0G20548g Chr7 complement(1693797..1694990) [1194 bp, 397 aa]...    30   6.5  
TBLA0G02490 Chr7 complement(647049..648155) [1107 bp, 368 aa] {O...    30   6.7  
AGR214C Chr7 complement(1158449..1159300) [852 bp, 283 aa] {ON} ...    29   9.2  

>Smik_14.307 Chr14 complement(549501..550241) [741 bp, 246 aa] {ON}
           YNL024C (REAL)
          Length = 246

 Score =  463 bits (1192), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 231/246 (93%), Positives = 231/246 (93%)

Query: 1   MDSIFGGFGDLVVPRPKEHLGQTDLSFSGKLLPALKICEDGGESGCGGKVWIAGELLCEY 60
           MDSIFGGFGDLVVPRPKEHLGQTDLSFSGKLLPALKICEDGGESGCGGKVWIAGELLCEY
Sbjct: 1   MDSIFGGFGDLVVPRPKEHLGQTDLSFSGKLLPALKICEDGGESGCGGKVWIAGELLCEY 60

Query: 61  ILEKSVDHLLSKTVDGKKRFKKVLEXXXXXXXXXXXXXXXEKNVYHDGTKVYVTDIDKLV 120
           ILEKSVDHLLSKTVDGKKRFKKVLE               EKNVYHDGTKVYVTDIDKLV
Sbjct: 61  ILEKSVDHLLSKTVDGKKRFKKVLELGSGTGLVGLCVGLLEKNVYHDGTKVYVTDIDKLV 120

Query: 121 PLLKRNIELDKVQYEVLARELCWGEPLSADFSPQEGDLQTNNVDLVLAADCVYLEKAFPL 180
           PLLKRNIELDKVQYEVLARELCWGEPLSADFSPQEGDLQTNNVDLVLAADCVYLEKAFPL
Sbjct: 121 PLLKRNIELDKVQYEVLARELCWGEPLSADFSPQEGDLQTNNVDLVLAADCVYLEKAFPL 180

Query: 181 LEKTLLDLTDCVSPPVILMAYKKRRKADKHFFNKIKRNFDVLEISNFSKFDYYLKQRTHL 240
           LEKTLLDLTDCVSPPVILMAYKKRRKADKHFFNKIKRNFDVLEISNFSKFDYYLKQRTHL
Sbjct: 181 LEKTLLDLTDCVSPPVILMAYKKRRKADKHFFNKIKRNFDVLEISNFSKFDYYLKQRTHL 240

Query: 241 FQLIRK 246
           FQLIRK
Sbjct: 241 FQLIRK 246

>YNL024C Chr14 complement(587107..587847) [741 bp, 246 aa] {ON}
           Putative methyltransferase; has seven beta-strand
           methyltransferase motif; green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm; despite
           similarity to methyltransferases, null mutant does not
           display alterations in lysine methylation pattern
          Length = 246

 Score =  428 bits (1101), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 209/246 (84%), Positives = 224/246 (91%)

Query: 1   MDSIFGGFGDLVVPRPKEHLGQTDLSFSGKLLPALKICEDGGESGCGGKVWIAGELLCEY 60
           M+SIFGGFGDLVVPRPKEHLGQTDLSF GKLLPALKICEDGGESGCGGKVWIAGELLCEY
Sbjct: 1   MESIFGGFGDLVVPRPKEHLGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEY 60

Query: 61  ILEKSVDHLLSKTVDGKKRFKKVLEXXXXXXXXXXXXXXXEKNVYHDGTKVYVTDIDKLV 120
           ILEKSVDHLLSKTV+G K+FKKVLE               EKN +HDGTKVYVTDIDKL+
Sbjct: 61  ILEKSVDHLLSKTVNGTKQFKKVLELGSGTGLVGLCVGLLEKNTFHDGTKVYVTDIDKLI 120

Query: 121 PLLKRNIELDKVQYEVLARELCWGEPLSADFSPQEGDLQTNNVDLVLAADCVYLEKAFPL 180
           PLLKRNIELD+VQYEVLAREL WGEPLSADFSPQEG +Q NNVDLVLAADCVYLE+AFPL
Sbjct: 121 PLLKRNIELDEVQYEVLARELWWGEPLSADFSPQEGAMQANNVDLVLAADCVYLEEAFPL 180

Query: 181 LEKTLLDLTDCVSPPVILMAYKKRRKADKHFFNKIKRNFDVLEISNFSKFDYYLKQRTHL 240
           LEKTLLDLT C++PPVILMAYKKRRKADKHFFNKIKRNFDVLEI++FSKF++YLK+RTHL
Sbjct: 181 LEKTLLDLTHCINPPVILMAYKKRRKADKHFFNKIKRNFDVLEITDFSKFEHYLKERTHL 240

Query: 241 FQLIRK 246
           FQLIRK
Sbjct: 241 FQLIRK 246

>Skud_14.305 Chr14 complement(557846..558595) [750 bp, 249 aa] {ON}
           YNL024C (REAL)
          Length = 249

 Score =  418 bits (1075), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 204/246 (82%), Positives = 220/246 (89%)

Query: 1   MDSIFGGFGDLVVPRPKEHLGQTDLSFSGKLLPALKICEDGGESGCGGKVWIAGELLCEY 60
           MD+IFGGF DLVVPR  EHLGQTDLSF GKLLPALKICEDGGESGCGGKVWIAGELLCEY
Sbjct: 1   MDTIFGGFEDLVVPRATEHLGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEY 60

Query: 61  ILEKSVDHLLSKTVDGKKRFKKVLEXXXXXXXXXXXXXXXEKNVYHDGTKVYVTDIDKLV 120
           ILEKS+ HLLS+   G+++FKKVLE               EKN +HDG+KVYVTDIDKLV
Sbjct: 61  ILEKSLHHLLSEATHGRRQFKKVLELGSGTGLVGLCVGLLEKNTFHDGSKVYVTDIDKLV 120

Query: 121 PLLKRNIELDKVQYEVLARELCWGEPLSADFSPQEGDLQTNNVDLVLAADCVYLEKAFPL 180
           PLL+RNIELDKVQYEVLAREL WGEPLS DFSPQEGDLQTNNVDLVLAADCVYLEKAFPL
Sbjct: 121 PLLERNIELDKVQYEVLARELWWGEPLSVDFSPQEGDLQTNNVDLVLAADCVYLEKAFPL 180

Query: 181 LEKTLLDLTDCVSPPVILMAYKKRRKADKHFFNKIKRNFDVLEISNFSKFDYYLKQRTHL 240
           LE+TLLDLT+C+SPPVILMAYKKRRKADKHFF+KIKRNFDVLEI++FSKFD+YLKQRTHL
Sbjct: 181 LERTLLDLTNCISPPVILMAYKKRRKADKHFFSKIKRNFDVLEITDFSKFDHYLKQRTHL 240

Query: 241 FQLIRK 246
           FQLIRK
Sbjct: 241 FQLIRK 246

>Suva_14.323 Chr14 complement(569944..570705) [762 bp, 253 aa] {ON}
           YNL024C (REAL)
          Length = 253

 Score =  405 bits (1040), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 202/246 (82%), Positives = 213/246 (86%)

Query: 1   MDSIFGGFGDLVVPRPKEHLGQTDLSFSGKLLPALKICEDGGESGCGGKVWIAGELLCEY 60
           MD IFGGF DLVVPR KEH GQTDLSF GKLLPALKICEDGGESGCGGKVWIAGELLCEY
Sbjct: 1   MDGIFGGFEDLVVPRLKEHFGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEY 60

Query: 61  ILEKSVDHLLSKTVDGKKRFKKVLEXXXXXXXXXXXXXXXEKNVYHDGTKVYVTDIDKLV 120
           ILEKS DHLLS+TV  K+ F KVLE               EKN +HD TKVYVTDID+LV
Sbjct: 61  ILEKSDDHLLSETVHEKRPFMKVLELGSGTGLVGLCVGLLEKNKFHDNTKVYVTDIDRLV 120

Query: 121 PLLKRNIELDKVQYEVLARELCWGEPLSADFSPQEGDLQTNNVDLVLAADCVYLEKAFPL 180
           PL++RNIELDKVQYEVLAREL WGEPLS DFSPQEGDLQ NNVDLVLAADCVYLEKAFPL
Sbjct: 121 PLMERNIELDKVQYEVLARELWWGEPLSGDFSPQEGDLQVNNVDLVLAADCVYLEKAFPL 180

Query: 181 LEKTLLDLTDCVSPPVILMAYKKRRKADKHFFNKIKRNFDVLEISNFSKFDYYLKQRTHL 240
           LEKTLLDLT+C+SPPVILMAYKKRRKADK FFNKIKRNFDVLEI +F KFDYYLKQ+THL
Sbjct: 181 LEKTLLDLTNCISPPVILMAYKKRRKADKQFFNKIKRNFDVLEIKDFIKFDYYLKQKTHL 240

Query: 241 FQLIRK 246
           FQL+RK
Sbjct: 241 FQLVRK 246

>NCAS0G03850 Chr7 (713255..714010) [756 bp, 251 aa] {ON}
          Length = 251

 Score =  306 bits (783), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 157/250 (62%), Positives = 189/250 (75%), Gaps = 4/250 (1%)

Query: 1   MDSIFGGFGDLVVPRPKEHLGQTDLSFSGKLLPALKICEDGGESGCGGKVWIAGELLCEY 60
           MD IFG F  LVVPRP EHLG +DLSF GKL   LKI EDGGESGCGGKVWIAGELLC++
Sbjct: 1   MDGIFGDFEGLVVPRPVEHLGNSDLSFGGKLRSPLKIHEDGGESGCGGKVWIAGELLCDF 60

Query: 61  ILEKS-VDHLLSK-TVDGKKRFKKVLEXXXXXXXXXXXXXXXEKNVYHDGTKVYVTDIDK 118
           ILEKS  + LL+K   DG++RF+ VLE               EKN +H    V++TDID+
Sbjct: 61  ILEKSGTEDLLNKWPHDGERRFRNVLELGSGTGLVGLCVGLLEKNRFHKNIGVHITDIDQ 120

Query: 119 LVPLLKRNIELDKVQYEVLARELCWGEPLSADFSPQEGD--LQTNNVDLVLAADCVYLEK 176
           LVPL++RNIEL+ V  EV+A  L WGEPL   F+P   D   +TN VDL+LAADCVYLE 
Sbjct: 121 LVPLMQRNIELNGVSKEVVAEGLWWGEPLLESFAPSTVDNLPKTNVVDLILAADCVYLED 180

Query: 177 AFPLLEKTLLDLTDCVSPPVILMAYKKRRKADKHFFNKIKRNFDVLEISNFSKFDYYLKQ 236
           AFPLLE+TLLDLT+  +PPVILM+Y+KRRKADKHFFNKIK+NFDV+E+ +F+K++ YLK 
Sbjct: 181 AFPLLERTLLDLTESETPPVILMSYRKRRKADKHFFNKIKKNFDVIEVKDFTKYEMYLKM 240

Query: 237 RTHLFQLIRK 246
           RTHLFQL R+
Sbjct: 241 RTHLFQLARR 250

>NCAS0G03770 Chr7 complement(694471..695226) [756 bp, 251 aa] {ON}
           Anc_2.289 YNL024C
          Length = 251

 Score =  306 bits (783), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 157/250 (62%), Positives = 189/250 (75%), Gaps = 4/250 (1%)

Query: 1   MDSIFGGFGDLVVPRPKEHLGQTDLSFSGKLLPALKICEDGGESGCGGKVWIAGELLCEY 60
           MD IFG F  LVVPRP EHLG +DLSF GKL   LKI EDGGESGCGGKVWIAGELLC++
Sbjct: 1   MDGIFGDFEGLVVPRPVEHLGNSDLSFGGKLRSPLKIHEDGGESGCGGKVWIAGELLCDF 60

Query: 61  ILEKS-VDHLLSK-TVDGKKRFKKVLEXXXXXXXXXXXXXXXEKNVYHDGTKVYVTDIDK 118
           ILEKS  + LL+K   DG++RF+ VLE               EKN +H    V++TDID+
Sbjct: 61  ILEKSGTEDLLNKWPHDGERRFRNVLELGSGTGLVGLCVGLLEKNRFHKNIGVHITDIDQ 120

Query: 119 LVPLLKRNIELDKVQYEVLARELCWGEPLSADFSPQEGD--LQTNNVDLVLAADCVYLEK 176
           LVPL++RNIEL+ V  EV+A  L WGEPL   F+P   D   +TN VDL+LAADCVYLE 
Sbjct: 121 LVPLMQRNIELNGVSKEVVAEGLWWGEPLLESFAPSTVDNLPKTNVVDLILAADCVYLED 180

Query: 177 AFPLLEKTLLDLTDCVSPPVILMAYKKRRKADKHFFNKIKRNFDVLEISNFSKFDYYLKQ 236
           AFPLLE+TLLDLT+  +PPVILM+Y+KRRKADKHFFNKIK+NFDV+E+ +F+K++ YLK 
Sbjct: 181 AFPLLERTLLDLTESETPPVILMSYRKRRKADKHFFNKIKKNFDVIEVKDFTKYEMYLKM 240

Query: 237 RTHLFQLIRK 246
           RTHLFQL R+
Sbjct: 241 RTHLFQLARR 250

>NDAI0G00680 Chr7 (150212..150979) [768 bp, 255 aa] {ON} Anc_2.289
           YNL024C
          Length = 255

 Score =  303 bits (775), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 155/255 (60%), Positives = 186/255 (72%), Gaps = 9/255 (3%)

Query: 1   MDSIFG-GFGDLVVPRPKEHLGQTDLSFSGKLLPALKICEDGGESGCGGKVWIAGELLCE 59
           MD IFG GF DLVV RP EHLG +DLSF G+L   LKI EDGGESGCGGKVWIAGELLCE
Sbjct: 1   MDDIFGSGFDDLVVARPLEHLGNSDLSFGGRLKNPLKIHEDGGESGCGGKVWIAGELLCE 60

Query: 60  YILEKS-VDHLLSKTVDGKKRFKKVLEXXXXXXXXXXXXXXXEKNVYHDGTKVYVTDIDK 118
           +ILEKS  D LL+      K+F+K++E               EKN +H     Y+TDID+
Sbjct: 61  FILEKSNSDDLLNGWASNSKQFRKIVELGSGTGLVGLCIGLLEKNNFHKDIDAYITDIDQ 120

Query: 119 LVPLLKRNIELDKVQYEVLARELCWGEPLSADFSPQEGDL-------QTNNVDLVLAADC 171
           +VPL+K+NI+L+ ++ EV A EL WGEPL   F+P E          +   VDL+LAADC
Sbjct: 121 IVPLMKQNIQLNGIENEVSAEELWWGEPLRKTFAPSEHSRDKEEDFREEKKVDLILAADC 180

Query: 172 VYLEKAFPLLEKTLLDLTDCVSPPVILMAYKKRRKADKHFFNKIKRNFDVLEISNFSKFD 231
           VYLEKAFPLLEKTLLDLT+  +PP ILMAY+KRRKADKHFF KIK+NFD++EI +F K++
Sbjct: 181 VYLEKAFPLLEKTLLDLTEGETPPTILMAYRKRRKADKHFFQKIKKNFDIVEIKDFEKYE 240

Query: 232 YYLKQRTHLFQLIRK 246
           YYLKQRTHLFQLIR+
Sbjct: 241 YYLKQRTHLFQLIRQ 255

>KNAG0H01980 Chr8 complement(348806..349555) [750 bp, 249 aa] {ON}
           Anc_2.289 YNL024C
          Length = 249

 Score =  300 bits (767), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 150/249 (60%), Positives = 183/249 (73%), Gaps = 3/249 (1%)

Query: 1   MDSIFGGFGDLVVPRPKEHLGQTDLSFSGKLLPALKICEDGGESGCGGKVWIAGELLCEY 60
           M+ IFG FGDLVV RP EH G  D+SF G+L PAL+I EDGGESGCGGKVW+AGELLC+Y
Sbjct: 1   MNEIFGSFGDLVVARPIEHCGSHDMSFGGRLNPALQIHEDGGESGCGGKVWVAGELLCDY 60

Query: 61  ILEKSVDHLLSKTVDGKK--RFKKVLEXXXXXXXXXXXXXXXEKNVYHDGTKVYVTDIDK 118
           I+EKS +  L    D  K  +F+ ++E               EK  +H G KV +TDID+
Sbjct: 61  IVEKSDEDDLLANWDTSKVQKFRNIIELGSGTGLVGLCVALLEKQFFHKGIKVTITDIDQ 120

Query: 119 LVPLLKRNIELDKVQYEVLARELCWGEPLSADFSPQ-EGDLQTNNVDLVLAADCVYLEKA 177
           LVPL+++NIEL+ V  E++A EL WGEPLS  F+P  EG  +  +VDL+LAADCVYLEKA
Sbjct: 121 LVPLMQKNIELNCVNTEMIAEELWWGEPLSGAFAPHSEGLSKVTSVDLILAADCVYLEKA 180

Query: 178 FPLLEKTLLDLTDCVSPPVILMAYKKRRKADKHFFNKIKRNFDVLEISNFSKFDYYLKQR 237
           FPLLEKTLLDLT+C  PPVILMAY+KRR ADK FF KI ++F V EI++FS +D YLKQR
Sbjct: 181 FPLLEKTLLDLTNCSKPPVILMAYRKRRNADKRFFRKIGKHFTVREITDFSTYDQYLKQR 240

Query: 238 THLFQLIRK 246
           THLF+LIR 
Sbjct: 241 THLFELIRN 249

>CAGL0M06897g Chr13 complement(702211..702957) [747 bp, 248 aa] {ON}
           similar to uniprot|P53970 Saccharomyces cerevisiae
           YNL024c
          Length = 248

 Score =  290 bits (742), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 146/243 (60%), Positives = 180/243 (74%), Gaps = 3/243 (1%)

Query: 7   GFGDLVVPRPKEHLGQTDLSFSGKLLPALKICEDGGESGCGGKVWIAGELLCEYILEKSV 66
           GFGDL+  RP EH+GQ+DL+F+G L+P LKI EDGGESGCGGKVWIAGELLCE+ILEKS 
Sbjct: 6   GFGDLIESRPVEHMGQSDLTFNGMLVPGLKIYEDGGESGCGGKVWIAGELLCEFILEKSR 65

Query: 67  DHLLSK--TVDGKKRFKKVLEXXXXXXXXXXXXXXXEKNVYHDGTKVYVTDIDKLVPLLK 124
           D  L K    D    F  VLE                K       K Y+TDID+LVPL++
Sbjct: 66  DGELLKDWINDDSVSFGNVLELGSGTGLVGLCVGLVTKKQSQRMVKTYITDIDQLVPLME 125

Query: 125 RNIELDKVQYEVLARELCWGEPLSADFSP-QEGDLQTNNVDLVLAADCVYLEKAFPLLEK 183
           +N+EL+ +  +V A+EL WGE L  +F+P + G   T+++DLVLAADCVYLEKAFPLLEK
Sbjct: 126 KNVELNLIDQQVFAKELLWGEALPIEFAPVKTGHATTSSLDLVLAADCVYLEKAFPLLEK 185

Query: 184 TLLDLTDCVSPPVILMAYKKRRKADKHFFNKIKRNFDVLEISNFSKFDYYLKQRTHLFQL 243
           TLLDLT+C +PPVILMAY+KRRKADKHFF KI++NF+V+ I++F  +D YLKQRTHLFQL
Sbjct: 186 TLLDLTECDNPPVILMAYRKRRKADKHFFQKIRKNFNVIVINDFKNYDQYLKQRTHLFQL 245

Query: 244 IRK 246
           +RK
Sbjct: 246 VRK 248

>SAKL0E07612g Chr5 complement(614835..615593) [759 bp, 252 aa] {ON}
           similar to uniprot|P53970 Saccharomyces cerevisiae
           YNL024C Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 252

 Score =  277 bits (708), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 143/243 (58%), Positives = 173/243 (71%), Gaps = 7/243 (2%)

Query: 8   FGDLVVPRPKEHLGQTDLSFSGKLLPALKICEDGGESGCGGKVWIAGELLCEYILEKSVD 67
           F DLV  RP EHLG +DLSF GKL P LKI EDGGESGCGGKVWIAGELLCE++LEKS  
Sbjct: 11  FNDLVPSRPTEHLGDSDLSFGGKLSPPLKIHEDGGESGCGGKVWIAGELLCEFLLEKSDQ 70

Query: 68  HLLSKTVDGKKRF----KKVLEXXXXXXXXXXXXXXXEKNVYHDGTKVYVTDIDKLVPLL 123
             L    +   RF    KK++E                K        +YVTDID+LV L+
Sbjct: 71  QGLFSQWNSDTRFQSPIKKIVELGSGTGLVGLCLGLLNKQNKLKDVDIYVTDIDQLVTLM 130

Query: 124 KRNIELDKVQYEVLARELCWGEPLSADFSPQEGDLQTNNVDLVLAADCVYLEKAFPLLEK 183
            RNI+L+++++ V  +EL WGEPL  +F+P   +     VDL+LAADCVYLEKAFPLLE 
Sbjct: 131 DRNIKLNELEH-VFPKELWWGEPLKPEFAPTRSN--QRQVDLILAADCVYLEKAFPLLEV 187

Query: 184 TLLDLTDCVSPPVILMAYKKRRKADKHFFNKIKRNFDVLEISNFSKFDYYLKQRTHLFQL 243
           TLLDLT C  PP+ILM+YKKRRKADKHFF +IK+NFDVLEI+ F++FD+YLKQ+THLFQL
Sbjct: 188 TLLDLTSCKDPPIILMSYKKRRKADKHFFKQIKKNFDVLEINEFTRFDHYLKQKTHLFQL 247

Query: 244 IRK 246
           +RK
Sbjct: 248 VRK 250

>KAFR0H03290 Chr8 complement(626525..627262) [738 bp, 245 aa] {ON}
           Anc_2.289 YNL024C
          Length = 245

 Score =  261 bits (667), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 137/250 (54%), Positives = 174/250 (69%), Gaps = 9/250 (3%)

Query: 1   MDSIFGGFGDLVVPRPKEHLGQTDLSFSGKLLPALKICEDGGESGCGGKVWIAGELLCEY 60
           M+ +FG +  L+  RP EHLG  DLSF G+L PA+KI EDGG SGCGGKVWIAGELLCEY
Sbjct: 1   MNEVFGEYVGLIDTRPIEHLGSADLSFDGQLSPAMKIYEDGGASGCGGKVWIAGELLCEY 60

Query: 61  ILEKS-VDHLLSKTVDGKKRFKKVLEXXXXXXXXXXXXXXXEKNVYHDGTKVYVTDIDKL 119
           ++EKS  ++LL    DG    K +LE               EK  +H   KV +TDI  L
Sbjct: 61  LIEKSDSENLL---CDGS--IKNILELGSGTGLVGICVGLMEKQRFHKDIKVSITDIGGL 115

Query: 120 VPLLKRNIELDKVQYEVLARELCWGEPLSADFSPQEGDLQ---TNNVDLVLAADCVYLEK 176
           VPL++RNI L+K+    +A+EL WG+ L +++     D      +NVDLV+AADCVY EK
Sbjct: 116 VPLMERNILLNKIADATVAKELMWGQQLPSEYMTTSVDGNCDNVSNVDLVVAADCVYAEK 175

Query: 177 AFPLLEKTLLDLTDCVSPPVILMAYKKRRKADKHFFNKIKRNFDVLEISNFSKFDYYLKQ 236
           AFPLLEK LLDLT+C +PP+ILMAY+KRRKADK FF +I++NFDV+EI +FS  + Y+KQ
Sbjct: 176 AFPLLEKILLDLTNCDNPPIILMAYRKRRKADKRFFVRIRKNFDVIEIDDFSSHEKYMKQ 235

Query: 237 RTHLFQLIRK 246
           RTHLF+L RK
Sbjct: 236 RTHLFELKRK 245

>Kwal_27.11513 s27 complement(832028..832783) [756 bp, 251 aa] {ON}
           YNL024C - Hypothetical ORF [contig 27] FULL
          Length = 251

 Score =  251 bits (640), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 131/242 (54%), Positives = 170/242 (70%), Gaps = 8/242 (3%)

Query: 8   FGDLVVPRPKEHLGQTDLSFSGKLLPALKICEDGGESGCGGKVWIAGELLCEYILEKS-V 66
           F DLV  RP EHLG +DLSF G++ PALKI EDGGE+GCGGK+W+AGELLC+Y+LE S  
Sbjct: 11  FIDLVPSRPVEHLGDSDLSFGGQVEPALKIHEDGGENGCGGKLWVAGELLCDYLLENSDA 70

Query: 67  DHLLSK---TVDGKKRFKKVLEXXXXXXXXXXXXXXXEKNVYHDGTKVYVTDIDKLVPLL 123
             +LSK    +D K  F  +LE                + ++ D TKVY+TDID+LV L+
Sbjct: 71  KGILSKRMVEMDVKAPFLNILELGSGTGLVGLCAGSVAQ-LHGDRTKVYITDIDRLVGLM 129

Query: 124 KRNIELDKVQYEVLARELCWGEPLSADFSPQEGDLQTNNVDLVLAADCVYLEKAFPLLEK 183
           + N+ L+ +   V    L WGEPL   F P   D + + VDLVLAADCVYLE AFPLLEK
Sbjct: 130 ETNVNLNHLAETVSVEILSWGEPLKEKFGP---DAKADKVDLVLAADCVYLETAFPLLEK 186

Query: 184 TLLDLTDCVSPPVILMAYKKRRKADKHFFNKIKRNFDVLEISNFSKFDYYLKQRTHLFQL 243
           TLLDLT+  +PP +LM+Y+KRRKADK+FF  I++NF ++ I+NF ++DYYLK++THLFQL
Sbjct: 187 TLLDLTEGDTPPAVLMSYRKRRKADKNFFRLIRKNFKIVPITNFIRYDYYLKKQTHLFQL 246

Query: 244 IR 245
           +R
Sbjct: 247 VR 248

>KLTH0G10428g Chr7 (883191..883946) [756 bp, 251 aa] {ON} similar to
           uniprot|P53970 Saccharomyces cerevisiae YNL024C Putative
           S-adenosylmethionine-dependent methyltransferase of the
           seven beta-strand family
          Length = 251

 Score =  248 bits (632), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 133/242 (54%), Positives = 169/242 (69%), Gaps = 8/242 (3%)

Query: 8   FGDLVVPRPKEHLGQTDLSFSGKLLPALKICEDGGESGCGGKVWIAGELLCEYILEKSVD 67
           F DLV  RP EH G +DL+F G++ PALKI EDGGESGCGGK+WIAGELLCEY+LE S D
Sbjct: 11  FTDLVPSRPLEHFGDSDLTFGGRIFPALKIHEDGGESGCGGKLWIAGELLCEYLLENSDD 70

Query: 68  H-LLSKTVD--GK-KRFKKVLEXXXXXXXXXXXXXXXEKNVYHDGTKVYVTDIDKLVPLL 123
           + +LSK ++  G+ K F  +LE                +       KV++TDID+LV L+
Sbjct: 71  NGILSKQMNLLGRDKPFVNILELGSGTGLVGLCAGSLAR-ANGGNAKVHITDIDQLVRLM 129

Query: 124 KRNIELDKVQYEVLARELCWGEPLSADFSPQEGDLQTNNVDLVLAADCVYLEKAFPLLEK 183
           + N+EL+ +   V A +L WGEPL  +F P   D  +N  DLVLAADCVYLE AFPLLEK
Sbjct: 130 EGNVELNGLASVVSAEKLWWGEPLKYEFGP---DAISNKTDLVLAADCVYLETAFPLLEK 186

Query: 184 TLLDLTDCVSPPVILMAYKKRRKADKHFFNKIKRNFDVLEISNFSKFDYYLKQRTHLFQL 243
           TLLDLT   +PPV+LM+Y+KRRKAD+ FF  I++NF V+ I++F + D +LKQRTHLFQL
Sbjct: 187 TLLDLTKGETPPVVLMSYRKRRKADRIFFKAIRKNFKVVPITSFDRCDDFLKQRTHLFQL 246

Query: 244 IR 245
           IR
Sbjct: 247 IR 248

>Ecym_3328 Chr3 (629428..630192) [765 bp, 254 aa] {ON} similar to
           Ashbya gossypii ADL212W
          Length = 254

 Score =  239 bits (611), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 132/251 (52%), Positives = 172/251 (68%), Gaps = 12/251 (4%)

Query: 1   MDSIFGG-FGDLVVPRPKEHLGQTDLSFSGKLLPALKICEDGGESGCGGKVWIAGELLCE 59
           M  +F   F +LV   P EHLG +DLSF G+L P LKI EDGGESGCGGKVWIAGELLC+
Sbjct: 1   MTDVFASVFEELVPTPPIEHLGASDLSFQGRLDPPLKIYEDGGESGCGGKVWIAGELLCD 60

Query: 60  YILEKSVD-HLLSKTVDGKKRFKKVLEXXXXXXXXXXXXXXXEKNVYH--DGTKVYVTDI 116
           ++LEKS D  LLSK V   K+F KVLE                 N+ H  +   VY+TDI
Sbjct: 61  FLLEKSKDGQLLSKFVKNGKQFNKVLELGSGTGLVGLCIGM--HNIMHEVNDMDVYITDI 118

Query: 117 DKLVPLLKRNIELDKVQYEVLARELCWGEPLSADFSPQEGDLQTNNVDLVLAADCVYLEK 176
           D L PL+ RN+ ++ ++  V  REL WG+ L A+F  ++     + VDL+LAADCVYLEK
Sbjct: 119 DTLCPLMARNVRMNNLEGRVHPRELFWGDELPAEFRNKD-----SPVDLILAADCVYLEK 173

Query: 177 AFPLLEKTLLDLT-DCVSPPVILMAYKKRRKADKHFFNKIKRNFDVLEISNFSKFDYYLK 235
           AFPLLE  LL+LT +    PV+LM+Y+KRRKADK FF KIK++F + E+++F ++D Y+K
Sbjct: 174 AFPLLEMKLLELTANQEVQPVVLMSYRKRRKADKKFFLKIKKHFVITELTDFKRYDEYIK 233

Query: 236 QRTHLFQLIRK 246
           QRTH+FQL+R+
Sbjct: 234 QRTHIFQLVRR 244

>ADL212W Chr4 (332487..333242) [756 bp, 251 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL024C
          Length = 251

 Score =  239 bits (609), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 135/240 (56%), Positives = 169/240 (70%), Gaps = 8/240 (3%)

Query: 8   FGDLVVPRPKEHLGQTDLSFSGKLLPALKICEDGGESGCGGKVWIAGELLCEYILEKSVD 67
           F DLV PRP EHLGQ+DLS+ G+L P LKI EDGGESGCGGKVWIAG LLCE+ILEKS D
Sbjct: 9   FEDLVEPRPIEHLGQSDLSYQGQLDPPLKIHEDGGESGCGGKVWIAGNLLCEFILEKSKD 68

Query: 68  -HLLSKTVDGKKRFKKVLEXXXXXXXXXXXXXXXEKNVYHDGTKVYVTDIDKLVPLLKRN 126
             +LS+    +++FK ++E                K      T VY+TDI+ L PL+++N
Sbjct: 69  GRVLSQFPGYERQFKNIIELGSGTGLVGLCVGLHGKYNGATDTNVYITDIEGLCPLMQKN 128

Query: 127 IELDKVQYEVLARELCWGEPLSADFSPQEGDLQTNNVDLVLAADCVYLEKAFPLLEKTLL 186
           +EL+ +   V  R L WGEPLS +F+ Q        +DLVLAADCVYLEKAFPLLEKTLL
Sbjct: 129 VELNGLDGMVHPRPLFWGEPLSDEFTRQP-------IDLVLAADCVYLEKAFPLLEKTLL 181

Query: 187 DLTDCVSPPVILMAYKKRRKADKHFFNKIKRNFDVLEISNFSKFDYYLKQRTHLFQLIRK 246
           DLT   S P++LM+YKKRRKADK FF KIK+ FD++EI +F  ++ Y +QRT+LFQL+RK
Sbjct: 182 DLTAGESQPLVLMSYKKRRKADKKFFIKIKKEFDIIEIKDFKSYEDYRRQRTYLFQLVRK 241

>KLLA0E08295g Chr5 complement(746166..746966) [801 bp, 266 aa] {ON}
           similar to uniprot|P53970 Saccharomyces cerevisiae
           YNL024C Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 266

 Score =  218 bits (556), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 135/241 (56%), Positives = 165/241 (68%), Gaps = 11/241 (4%)

Query: 8   FGDLVVPRPKEHLGQTDLSFSGKLLPALKICEDGGESGCGGKVWIAGELLCEYILEKS-V 66
           F +LV  RP EHLG+ D+SF+GKL   L I EDGGESGCGGKVWIAGELLCEYILEKS  
Sbjct: 34  FEELVPARPIEHLGKIDMSFNGKLPSPLIINEDGGESGCGGKVWIAGELLCEYILEKSDK 93

Query: 67  DHLLSKTV-DGKKRFKKVLEXXXXXXXXXXXXXXXEKNVYHDGTKVYVTDIDKLVPLLKR 125
           +HLLS    DG      VLE               ++   +   +VY++DID+L+ L++ 
Sbjct: 94  EHLLSHLFPDGN--CNSVLELGSGTGLVGLCVGLMDQANEYSDREVYISDIDQLLGLMES 151

Query: 126 NIELDKVQYEVLARELCWGEPLSADFSPQEGDLQTNNVDLVLAADCVYLEKAFPLLEKTL 185
           NI+++ +  +V A  L WG PL   F  +        VDLVLAADCVYLE AFPLLEKTL
Sbjct: 152 NIQVNGLDDKVHAEVLWWGNPLPDVFVKKP-------VDLVLAADCVYLEAAFPLLEKTL 204

Query: 186 LDLTDCVSPPVILMAYKKRRKADKHFFNKIKRNFDVLEISNFSKFDYYLKQRTHLFQLIR 245
           L+LTD  + P+ILMAYKKRRKADKHFF KIK+NF ++EI +F  FD YLKQRTHLFQL+R
Sbjct: 205 LELTDGENVPIILMAYKKRRKADKHFFQKIKKNFKIVEIRDFINFDKYLKQRTHLFQLMR 264

Query: 246 K 246
           +
Sbjct: 265 E 265

>Smik_2.414 Chr2 (730531..731784) [1254 bp, 417 aa] {ON} YBR271W
           (REAL)
          Length = 417

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/133 (31%), Positives = 62/133 (46%), Gaps = 15/133 (11%)

Query: 47  GGKVWIAGELLCEYILEKSVDHLLSKTVD-----GKKRFKKVLEXXXXXXXXXXXXXXXE 101
           G K W +  +L + +    VD L +  +D     G KR K VLE                
Sbjct: 219 GWKTWGSSLILSQLV----VDRLHTADMDFVANRGTKRIK-VLELGSGTGLVGLSWASKW 273

Query: 102 KNVYH-DGTKVYVTDIDKLVPLLKRNIELDKVQYEVLARELCWGEPLSADFSPQEGDLQT 160
           K +Y  D T+++VTD+  +V  LK+N+ L+ +Q  V A  L W  P S  F  + G    
Sbjct: 274 KELYGIDNTEIFVTDLPDIVTNLKKNVSLNNLQDFVQAEILDWTNPQS--FIDRFG--YE 329

Query: 161 NNVDLVLAADCVY 173
           N  D++L AD +Y
Sbjct: 330 NEFDIILIADPIY 342

>Skud_2.403 Chr2 (713779..715032) [1254 bp, 417 aa] {ON} YBR271W
           (REAL)
          Length = 417

 Score = 42.0 bits (97), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 61/132 (46%), Gaps = 13/132 (9%)

Query: 47  GGKVW----IAGELLCEYILEKSVDHLLSKTVDGKKRFKKVLEXXXXXXXXXXXXXXXEK 102
           G K W    I  +LL +Y+    V H+   T    ++  KVLE                K
Sbjct: 219 GWKTWGSSLILSQLLVDYLHTVGV-HI---TASCNQKKIKVLELGSGTGLVGLSWASKWK 274

Query: 103 NVY-HDGTKVYVTDIDKLVPLLKRNIELDKVQYEVLARELCWGEPLSADFSPQEGDLQTN 161
            +Y  D  +++VTD+ ++V  LK+N+ L+ +Q  V A  L W  P   DF  + G    N
Sbjct: 275 ELYGTDKMEIFVTDLPEIVTNLKKNVSLNNLQDFVQAEILDWTNP--QDFIDRFG--HEN 330

Query: 162 NVDLVLAADCVY 173
             D++L AD +Y
Sbjct: 331 EFDIILVADPIY 342

>AER240W Chr5 (1080474..1081646) [1173 bp, 390 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YBR271W
          Length = 390

 Score = 39.3 bits (90), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 37/117 (31%), Positives = 55/117 (47%), Gaps = 10/117 (8%)

Query: 69  LLSKTVDGKKRFKKVLEXXXXXXXXXXXXXXXEKNVYHDGTKVYVTDIDKLVPLLKRNIE 128
           LLS+ V G    K+VLE                 N+  D   V+VTD+ ++VP L+ N+ 
Sbjct: 218 LLSRRVAGFTGKKRVLELGAGTGLVGIAYAL--ANI--DADDVFVTDLPEIVPNLRHNLA 273

Query: 129 LDKVQYEVLARELCWGEPLSADFSPQEGDLQTNNVDLVLAADCVYLEKAFPLLEKTL 185
           L+ +   V A  L W +P S  F  + G+LQ    D +  AD +Y      LL +T+
Sbjct: 274 LNNLT-NVRASVLDWSDPTS--FLHEHGELQ---FDAIFVADPIYSPNHPQLLVQTV 324

>KNAG0C01800 Chr3 (352309..353574) [1266 bp, 421 aa] {ON} Anc_1.325
           YBR271W
          Length = 421

 Score = 38.5 bits (88), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 41/64 (64%), Gaps = 4/64 (6%)

Query: 110 KVYVTDIDKLVPLLKRNIELDKVQYEVLARELCWGEPLSADFSPQEGDLQTNNVDLVLAA 169
           ++Y+TD+ ++V  LK+N++L+K+++ V+A  L W  P   +F  +    Q+   DL+L A
Sbjct: 286 QIYLTDLPEIVDNLKKNVQLNKLEHAVVADVLDWTNPY--NFIERYNGEQS--FDLILVA 341

Query: 170 DCVY 173
           D +Y
Sbjct: 342 DPIY 345

>SAKL0D06798g Chr4 complement(564525..565790) [1266 bp, 421 aa] {ON}
           similar to uniprot|P38347 YBR271W Saccharomyces
           cerevisiae Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 421

 Score = 38.1 bits (87), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 48/82 (58%), Gaps = 10/82 (12%)

Query: 110 KVYVTDIDKLVPLLKRNIELDKVQYE----VLARELCWGEPLSADFSPQEGDLQTNNVDL 165
           ++Y+TD+ ++VP L++N+E++ +  +    V A  L W  P+S  F+ + GD   +  D+
Sbjct: 280 EMYLTDLPEIVPNLQKNVEINNLNSQSGLAVCADVLDWTNPVS--FTEKYGD---DKFDV 334

Query: 166 VLAADCVYLEKAFPLLEKTLLD 187
           +L AD +Y     P+   T++D
Sbjct: 335 ILIADPIY-SPQHPVWVVTMID 355

>Skud_10.352 Chr10 complement(622581..623591) [1011 bp, 336 aa] {ON}
           YJR129C (REAL)
          Length = 336

 Score = 36.2 bits (82), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 47/199 (23%), Positives = 78/199 (39%), Gaps = 25/199 (12%)

Query: 41  GGESGCGGKVWIAGELLCEYILEKSVDHLLSKTVDGKKRFKKVLEXXXXXXXXXXXXXXX 100
              S  G + W A   + ++++ K +  L     + +K+   VLE               
Sbjct: 127 SAASTTGFRTWEAALYMGDFLINKPLQQLALMQKEDRKKLN-VLEIGAGTGIVSLVLLEK 185

Query: 101 EKNVYHDGTKVYVTDIDK--LVPLLKRNIELDKVQYE----VLARELCWGEPLSADFSPQ 154
            +   +   ++YVTD D   +   LKRN EL+    E    V  + L WG          
Sbjct: 186 YREFVN---RMYVTDGDSNLVERQLKRNFELNDALCENGPDVKLQRLWWG---------- 232

Query: 155 EGDLQTNNVDLVLAADCVYLEKAFPLLEKTLLDLTDCVSPPVILMAYKKRRKADKHFF-- 212
             D   +++DLV+AAD  Y    FP L + L +        + L++   R ++    F  
Sbjct: 233 -SDRIPDDIDLVVAADVTYDSTIFPELCQCLAECLAISRCKMCLLSATIRSESTDKLFAQ 291

Query: 213 --NKIKRNFDVLEISNFSK 229
             NKI  N+ V+  +   K
Sbjct: 292 ECNKIGLNYTVVSSTEHDK 310

>Suva_4.532 Chr4 (916493..917743) [1251 bp, 416 aa] {ON} YBR271W
           (REAL)
          Length = 416

 Score = 35.8 bits (81), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 38/133 (28%), Positives = 61/133 (45%), Gaps = 15/133 (11%)

Query: 47  GGKVWIAGELLCEYILEKSVDHLLSKTVD-----GKKRFKKVLEXXXXXXXXXXXXXXXE 101
           G K W +  +L + +    VD+L +  +      G KR K VLE                
Sbjct: 218 GWKTWGSSLILSQLL----VDYLHTTGMPPAANCGTKRIK-VLELGSGTGLVGLSWAAKW 272

Query: 102 KNVYH-DGTKVYVTDIDKLVPLLKRNIELDKVQYEVLARELCWGEPLSADFSPQEGDLQT 160
           K +Y     ++YVTD+ ++V  LK+N+ L+ ++  V A  L W  P   +F  Q G    
Sbjct: 273 KELYGIHNIEIYVTDLPEIVTNLKKNVLLNNLEDFVQAEVLDWTNP--QNFINQFG--HE 328

Query: 161 NNVDLVLAADCVY 173
            + D++L AD +Y
Sbjct: 329 MDFDIILVADPIY 341

>YBR271W Chr2 (744852..746111) [1260 bp, 419 aa] {ON}
           EFM2S-adenosylmethionine-dependent methyltransferase;
           methylates translation elongation factors EF2 (Eft1p and
           Eft2p) and EF3A (Yef3p); belongs to the seven
           beta-strand family; green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm;
           predicted to be involved in ribosome biogenesis
          Length = 419

 Score = 35.4 bits (80), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 35/132 (26%), Positives = 62/132 (46%), Gaps = 10/132 (7%)

Query: 47  GGKVWIAGELLCEYILEKSVDHLLSKTVD----GKKRFKKVLEXXXXXXXXXXXXXXXEK 102
           G K W +  +L + +++  +D+L +  V+       +  KVLE                K
Sbjct: 218 GWKTWGSSLILSQLVVDH-LDYLHTTNVNMLANSDIKQIKVLELGAGTGLVGLSWALKWK 276

Query: 103 NVY-HDGTKVYVTDIDKLVPLLKRNIELDKVQYEVLARELCWGEPLSADFSPQEGDLQTN 161
            +Y  +  +++VTD+ ++V  LK+N+ L+ +   V A  L W  P   DF  + G    N
Sbjct: 277 ELYGTENIEIFVTDLPEIVTNLKKNVSLNNLGDFVQAEILDWTNP--HDFIDKFG--HEN 332

Query: 162 NVDLVLAADCVY 173
             D++L AD +Y
Sbjct: 333 EFDVILIADPIY 344

>NDAI0J02860 Chr10 complement(713765..714808) [1044 bp, 347 aa] {ON}
           Anc_4.352 YJR129C
          Length = 347

 Score = 35.4 bits (80), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 45/189 (23%), Positives = 70/189 (37%), Gaps = 35/189 (18%)

Query: 41  GGESGCGGKVWIAGELLCEYILEKSVDHLLSKTVDGKKRFKKVLEXXXXXXXXX--XXXX 98
            G+S  G + W     L ++++     +L+ KT         V+E               
Sbjct: 136 SGKSTTGFRTWEGAVYLSKFLINNCEKYLIEKT--------DVIELGAGTGLVSLCILEN 187

Query: 99  XXEKNVYHDGTKVYVTDIDK--LVPLLKRNIELDKVQYE---VLARELCWGEPLSADFSP 153
             +K +  D  KVYVTD D   +  +L +N EL+ V  E   V+ R+L W +P       
Sbjct: 188 DLQKGIKRD--KVYVTDGDSELVSSILNKNFELNNVNIEDENVILRKLWWNDPNEKIAGE 245

Query: 154 QEGDLQTNNVDLVLAADCVYLEKAFPLLEKTLLDLTDCVSPPVILMAYKKRRKADKHFFN 213
             G      + LV+ AD  Y     P       DL  C      L  +  + +  K   +
Sbjct: 246 DNG-----KIGLVVGADITYDNSVIP-------DLCAC------LKQFMDKNRDCKAIIS 287

Query: 214 KIKRNFDVL 222
              RN D +
Sbjct: 288 ATVRNIDTI 296

>KAFR0C04250 Chr3 (844020..845195) [1176 bp, 391 aa] {ON} Anc_1.325
           YBR271W
          Length = 391

 Score = 35.4 bits (80), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 40/70 (57%), Gaps = 5/70 (7%)

Query: 107 DGTKVYVTDIDKLVPLLKRNIELDKVQYEVLARELCWGEPLSADFSPQEGDLQTNNVDLV 166
           D  ++Y+TD+ ++V  L++NI ++++   V++  L W  P S  F    GD +    D++
Sbjct: 250 DEYEIYLTDLPEIVTNLEKNISINQLANRVVSDVLDWTNPES--FVSNYGDTR---FDVL 304

Query: 167 LAADCVYLEK 176
           L +D +Y  K
Sbjct: 305 LISDPIYSSK 314

>KNAG0B06720 Chr2 complement(1329424..1330275) [852 bp, 283 aa] {ON}
           Anc_4.352 YJR129C
          Length = 283

 Score = 34.7 bits (78), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 51/106 (48%), Gaps = 18/106 (16%)

Query: 110 KVYVTDIDK--LVPLLKRNIELDKVQYEVLARELCWGEPLSADFSPQEGDLQTNNVDLVL 167
           K+YVTD D   L  +   N+ L+KV+ +V  + L W    S D  P  GD     +D+V+
Sbjct: 155 KLYVTDGDTGILSEVTTPNLSLNKVERDVQCQRLVWA---SEDRVP--GD-----IDVVV 204

Query: 168 AADCVYLEKAFPLLEKTLLDLTDCVSPP---VILMAYKKRRKADKH 210
            AD  Y    FP L  T LD  +C+  P     ++A  +R +   H
Sbjct: 205 GADITYDPTVFPEL-CTCLD--ECLQQPKCQCAILACTERNRETVH 247

>Smik_10.422 Chr10 complement(653045..654067) [1023 bp, 340 aa] {ON}
           YJR129C (REAL)
          Length = 340

 Score = 34.3 bits (77), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 41/178 (23%), Positives = 70/178 (39%), Gaps = 18/178 (10%)

Query: 41  GGESGCGGKVWIAGELLCEYILEKSVDHLLSKTVDGKKRFKKVLEXXXXXXXXXXXXXXX 100
              S  G + W A   + ++++ K +  L + T + ++  KK L                
Sbjct: 127 SAASTTGFRTWEAALYMGDFLINKPLQEL-ALTQEEQEEDKKKLNVLEIGAGTGIVSLVL 185

Query: 101 EKNVYHDGTKVYVTDIDK--LVPLLKRNIELDKVQYE----VLARELCWGEPLSADFSPQ 154
            +N  +   K+YVTD D   +   LK+N EL+    E    +  + L WG          
Sbjct: 186 SQNYRNFVNKMYVTDGDSDLVERQLKKNFELNDALSEHKPDIRFQRLWWG---------- 235

Query: 155 EGDLQTNNVDLVLAADCVYLEKAFPLLEKTLLDLTDCVSPPVILMAYKKRRKADKHFF 212
             D   +++DLV+ AD  Y    FP L K L +        + L++   R ++    F
Sbjct: 236 -SDKVPDDIDLVVGADVTYDSTIFPELCKCLAECLAINRCKMCLLSATIRSESTDKLF 292

>NCAS0B07410 Chr2 complement(1401275..1402519) [1245 bp, 414 aa]
           {ON} Anc_1.325 YBR271W
          Length = 414

 Score = 33.9 bits (76), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 56/129 (43%), Gaps = 12/129 (9%)

Query: 47  GGKVWIAGELLCEYILEKSVDHLLSKTVDGKKRFK-KVLEXXXXXXXXXXXXXXXEKNVY 105
           G K W A       IL + V +LL K  D K     +VLE                +  +
Sbjct: 221 GWKTWGAS-----LILSQKVVNLLEKNKDQKHIHPLRVLELGSGTGLVGIAWASKWRQSF 275

Query: 106 -HDGTKVYVTDIDKLVPLLKRNIELDKVQYEVLARELCWGEPLSADFSPQEGDLQTNNVD 164
             +  +++VTD+  +V  LK+N++ + +   V A  L W  P   DF  + GD      D
Sbjct: 276 GTENIEMFVTDLPDIVANLKKNVQTNDLTTFVEADILDWTNP--DDFIEKHGD---EKFD 330

Query: 165 LVLAADCVY 173
           ++L AD +Y
Sbjct: 331 VILVADPIY 339

>TDEL0D01940 Chr4 (376261..377478) [1218 bp, 405 aa] {ON} Anc_1.325
           YBR271W
          Length = 405

 Score = 33.5 bits (75), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 33/128 (25%), Positives = 58/128 (45%), Gaps = 13/128 (10%)

Query: 47  GGKVWIAGELLCEYILEKSVDHLLSKTVDGKKRFKKVLEXXXXXXXXXXXXXXXEKNVYH 106
           G K W A  +L +    K ++ L   T + K R   VLE                   Y 
Sbjct: 214 GWKTWGASFILSQ----KLINVLAESTFNFKPR---VLELGSGTGLAGISWLCKWVQKYG 266

Query: 107 DG-TKVYVTDIDKLVPLLKRNIELDKVQYEVLARELCWGEPLSADFSPQEGDLQTNNVDL 165
           +G T++++TD+  +V  L++N+E++KV+       L W +P   DF     D   +  D+
Sbjct: 267 NGHTEIFLTDLPVIVANLQKNVEVNKVESFATVSALDWTDP--TDFINSYTD---DEFDI 321

Query: 166 VLAADCVY 173
           ++ +D +Y
Sbjct: 322 LIVSDPIY 329

>Suva_12.220 Chr12 complement(343489..344502) [1014 bp, 337 aa] {ON}
           YJR129C (REAL)
          Length = 337

 Score = 33.1 bits (74), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 51/112 (45%), Gaps = 22/112 (19%)

Query: 109 TKVYVTDIDK--LVPLLKRNIELDKVQYE----VLARELCWGEPLSADFSPQEGDLQTNN 162
           +K+YVTD D   +   L+RN EL+    E    +  + L WG    +D  P E       
Sbjct: 191 SKMYVTDGDSDLVETQLRRNFELNDAWREQSPDIRLQRLWWG----SDRVPDE------- 239

Query: 163 VDLVLAADCVYLEKAFPLLEKTL---LDLTDCVSPPVILMAYKKRRKADKHF 211
           V+LV+AAD  Y    FP L + L   L ++ C     +L A  +    DK F
Sbjct: 240 VNLVVAADVTYDSTIFPELCQCLAECLAMSHC--KVCLLSATIRSYSTDKEF 289

>KAFR0E04280 Chr5 complement(864926..865873) [948 bp, 315 aa] {ON}
           Anc_4.352 YJR129C
          Length = 315

 Score = 32.7 bits (73), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 53/201 (26%), Positives = 83/201 (41%), Gaps = 28/201 (13%)

Query: 44  SGCGGKVWIAGELLCEYILEKSVDHLLSKTVDGKKRFKKVLEXXXXXXXXXXXXXXXEKN 103
           S  G + W A   LC+YI   +VD   +++++G      VLE               +  
Sbjct: 113 STTGFRTWEAASYLCDYI--SNVD---TESLNG---CSTVLE--LGAGTGLCSLTLLKGK 162

Query: 104 VYHDGTKVYVTDIDK--LVPLLKRNIELDKVQYE----VLARELCWGEPLSADFSPQEGD 157
              D  KVYVTD D   +   L  N +L+++++E    V  + L WGE           D
Sbjct: 163 FQDDLKKVYVTDGDTELISGQLLSNFKLNEMEHEIGQKVKLQRLLWGE-----------D 211

Query: 158 LQTNNVDLVLAADCVYLEKAFPLLEKTLLDLTDCVSPPVILMAYKKRR-KADKHFFNKIK 216
              N++D V+ AD  Y +  F  L K L    +  S  + L+A   R  + D+ F     
Sbjct: 212 SIPNDIDCVIGADVTYDDTLFDDLFKCLRQCFEIESCKMCLIASTIRNVETDRKFLEHCH 271

Query: 217 RNFDVLEISNFSKFDYYLKQR 237
            +   +EI   ++ D   K R
Sbjct: 272 DSDFKVEIIQSTELDPQSKAR 292

>TBLA0D05200 Chr4 complement(1278210..1279409) [1200 bp, 399 aa]
           {ON} Anc_1.325 YBR271W
          Length = 399

 Score = 32.0 bits (71), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 37/67 (55%), Gaps = 7/67 (10%)

Query: 109 TKVYVTDIDKLVPLLKRNIELD--KVQYEVLARELCWGEPLSADFSPQEGDLQTNNVDLV 166
           ++V++TD+ ++VP L+ N +L+       V+A  L W       F  + GD+Q    D++
Sbjct: 260 SQVFLTDLPEIVPNLRTNAKLNDLSTHNSVIADVLDWTN--HDSFVEKYGDIQ---FDII 314

Query: 167 LAADCVY 173
           L AD +Y
Sbjct: 315 LIADPIY 321

>KNAG0E01900 Chr5 (393289..394416) [1128 bp, 375 aa] {ON} Anc_2.259
           YIL110W
          Length = 375

 Score = 31.6 bits (70), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 38/86 (44%), Gaps = 14/86 (16%)

Query: 122 LLKRNIELDKVQYEVLARELCWGEPLS---ADFSPQ-EGDLQTNNVDLVLAADCVYLEKA 177
           L +R++ LD V          WG   +       PQ EG   T    LVL ++ +Y  + 
Sbjct: 260 LAERHVTLDFVSG-------SWGRKFTDIVHSLLPQCEG---TTAASLVLTSETIYQPEN 309

Query: 178 FPLLEKTLLDLTDCVSPPVILMAYKK 203
            PL+ +TLLDL   +  P  ++   K
Sbjct: 310 LPLITETLLDLKGYIGGPTTVLVAAK 335

>Ecym_5513 Chr5 (1042019..1043209) [1191 bp, 396 aa] {ON} similar to
           Ashbya gossypii AER240W
          Length = 396

 Score = 31.6 bits (70), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 37/64 (57%), Gaps = 6/64 (9%)

Query: 110 KVYVTDIDKLVPLLKRNIELDKVQYEVLARELCWGEPLSADFSPQEGDLQTNNVDLVLAA 169
           ++ +TD+  +VP L+ NI+L+ ++  V A EL W +   + F  Q G    +  D++L +
Sbjct: 264 QIILTDLPDIVPNLRSNIKLNNLK-NVHAAELDWTD--HSTFIAQHGG---DKFDMILVS 317

Query: 170 DCVY 173
           D +Y
Sbjct: 318 DPIY 321

>CAGL0I09438g Chr9 (904886..906106) [1221 bp, 406 aa] {ON} similar
           to uniprot|P38347 Saccharomyces cerevisiae YBR271w
          Length = 406

 Score = 30.8 bits (68), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 37/65 (56%), Gaps = 5/65 (7%)

Query: 109 TKVYVTDIDKLVPLLKRNIELDKVQYEVLARELCWGEPLSADFSPQEGDLQTNNVDLVLA 168
           T++Y+TD+ ++V  LK N++++ +Q    A  L W  P +  F+ + G+      D ++ 
Sbjct: 271 TEIYLTDLPEIVDNLKDNVKINNLQDIATADVLDWTNPDT--FTEKYGN---ERFDYIVI 325

Query: 169 ADCVY 173
           AD +Y
Sbjct: 326 ADPIY 330

>Kwal_14.2550 s14 complement(809874..811130) [1257 bp, 418 aa] {ON}
           YBR271W - Hypothetical ORF [contig 224] FULL
          Length = 418

 Score = 30.8 bits (68), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 37/68 (54%), Gaps = 9/68 (13%)

Query: 110 KVYVTDIDKLVPLLKRNIELDKV----QYEVLARELCWGEPLSADFSPQEGDLQTNNVDL 165
           +V++TD+  +VP L++N++L+K       EV    L W +P S  F  + G       D+
Sbjct: 278 RVHLTDLPDIVPNLQKNVDLNKCNREPNVEVAVDVLDWTDPSS--FQEKYG---YKKFDV 332

Query: 166 VLAADCVY 173
           +L AD +Y
Sbjct: 333 LLIADPIY 340

>NDAI0B04730 Chr2 complement(1171595..1172893) [1299 bp, 432 aa]
           {ON} Anc_1.325 YBR271W
          Length = 432

 Score = 30.4 bits (67), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 30/128 (23%), Positives = 58/128 (45%), Gaps = 9/128 (7%)

Query: 47  GGKVWIAGELLCEYILEKSVDHLLSKTVDGKKRFKKVLEXXXXXXXXXXXXXXXEKNVY- 105
           G K W +  +L + ++    D   +K     K  ++VLE                + +Y 
Sbjct: 233 GWKTWGSSLILSQELVN---DLETNKNNKKSKSIRRVLELGAGTGLVGIAWACKWRQLYG 289

Query: 106 HDGTKVYVTDIDKLVPLLKRNIELDKVQYEVLARELCWGEPLSADFSPQEGDLQTNNVDL 165
           ++  +++VTD+  +V  L++N++ + +   V+A  L W  P   DF  +  D +    D 
Sbjct: 290 NESIEMFVTDLPDIVTNLRKNVQNNDLDDFVVADVLDWTNP--EDFIKKYSDEK---FDT 344

Query: 166 VLAADCVY 173
           +L AD +Y
Sbjct: 345 ILIADPIY 352

>Kpol_1066.17 s1066 complement(28462..29769) [1308 bp, 435 aa] {ON}
           complement(28462..29769) [1308 nt, 436 aa]
          Length = 435

 Score = 30.0 bits (66), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 37/71 (52%), Gaps = 9/71 (12%)

Query: 108 GTKVYVTDIDKLVPLLKRNIELDKVQYEVLARELCWGEPLS--ADFSPQEGDLQTNNVDL 165
            T++ +TD+ ++V  L+RNI ++ +     A  L W  P S   ++S ++        D+
Sbjct: 298 NTEIILTDLPEIVGNLQRNISINNLNDIARASVLDWTNPKSFIQEYSNEK-------FDI 350

Query: 166 VLAADCVYLEK 176
           +L AD +Y  K
Sbjct: 351 ILVADPIYSPK 361

>TPHA0L00340 Chr12 (45910..46935) [1026 bp, 341 aa] {ON} Anc_4.352
           YJR129C
          Length = 341

 Score = 30.0 bits (66), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 39/83 (46%), Gaps = 15/83 (18%)

Query: 109 TKVYVTDIDK--LVPLLKRNIELDKVQYE--VLARELCWGEPLSADFSPQEGDLQTNNVD 164
           T +Y+TD D   L   L RN+ L+ +     V  ++L W E    D  P       +N+D
Sbjct: 193 TTLYITDGDSQLLEGQLSRNVMLNGIDSSDSVKLQKLRWNE----DHIP-------DNLD 241

Query: 165 LVLAADCVYLEKAFPLLEKTLLD 187
           L++AAD  Y     P L   +LD
Sbjct: 242 LIVAADVTYDSSVIPSLCHCILD 264

>ZYRO0G20548g Chr7 complement(1693797..1694990) [1194 bp, 397 aa]
           {ON} similar to uniprot|P38347 YBR271W Saccharomyces
           cerevisiae Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 397

 Score = 29.6 bits (65), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 15/68 (22%), Positives = 36/68 (52%), Gaps = 5/68 (7%)

Query: 106 HDGTKVYVTDIDKLVPLLKRNIELDKVQYEVLARELCWGEPLSADFSPQEGDLQTNNVDL 165
           +   +++ TD+ ++VP L++N+E++ +    +   L W  P   DF  +     +   D+
Sbjct: 258 NSNIEMFFTDLQEIVPNLRKNVEINGISDNSVVDTLDWTCP--EDFVDK---YSSEKFDI 312

Query: 166 VLAADCVY 173
           ++ +D +Y
Sbjct: 313 IIVSDPIY 320

>TBLA0G02490 Chr7 complement(647049..648155) [1107 bp, 368 aa] {ON}
           Anc_2.259 YIL110W
          Length = 368

 Score = 29.6 bits (65), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 37/81 (45%), Gaps = 11/81 (13%)

Query: 122 LLKRNIELDKVQYEVLARELCWGEPLSADFSPQEGDLQTNNVDLVLAADCVYLEKAFPLL 181
           L +RNI ++ V          WG      FS    ++  N+ +LVL ++ +Y     P++
Sbjct: 249 LKRRNITIELVSG-------SWGRK----FSNLTENILKNSSNLVLTSETIYQPITLPVV 297

Query: 182 EKTLLDLTDCVSPPVILMAYK 202
            +T+LD         IL+A K
Sbjct: 298 AETILDYLRIAKDSQILVAAK 318

>AGR214C Chr7 complement(1158449..1159300) [852 bp, 283 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL107W
          Length = 283

 Score = 29.3 bits (64), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 27/63 (42%), Gaps = 4/63 (6%)

Query: 149 ADFSPQEGDLQTNNVDLVLAADCVYLEKAFPLLEKTLLDLTDCVSPPVILMAYKK----R 204
           ADF P   DL   N+   L A   +LE   PL    L    D   P  ++ A K+    R
Sbjct: 177 ADFDPPIRDLDEANIPESLRAQKQHLEHREPLKVAALFGARDAPLPKAVIEAKKRHLAAR 236

Query: 205 RKA 207
           RKA
Sbjct: 237 RKA 239

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.141    0.422 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 26,114,691
Number of extensions: 1093225
Number of successful extensions: 2789
Number of sequences better than 10.0: 45
Number of HSP's gapped: 2806
Number of HSP's successfully gapped: 45
Length of query: 246
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 139
Effective length of database: 41,212,137
Effective search space: 5728487043
Effective search space used: 5728487043
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 64 (29.3 bits)