Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_14.3062.291ON72723761e-48
YNL024C-A (KSH1)2.291ON72723761e-48
Suva_14.3222.291ON72723715e-48
Cgla_YGOB_Anc_2.2912.291ON72723491e-44
NCAS0G037602.291ON72723482e-44
NDAI0G006902.291ON72723456e-44
Skud_14.3042.291ON72723352e-42
KNAG0H019702.291ON72723352e-42
TBLA0B069702.291ON72713301e-41
SAKL0E07568g2.291ON72723282e-41
Kpol_1003.412.291ON72723231e-40
KLLA0E08251g2.291ON72723125e-39
TPHA0C034302.291ON72723048e-38
ADL210W2.291ON72723022e-37
TDEL0G022102.291ON72723013e-37
KAFR0H032802.291ON72722943e-36
ZYRO0A01980g2.291ON72722935e-36
Kwal_YGOB_Anc_2.2912.291ON72722849e-35
KLTH0G10472g2.291ON72722813e-34
Ecym_33302.291ON72722475e-29
TBLA0I00320singletonON24141611.3
NDAI0I010706.215ON48023602.0
CAGL0H03553g6.215ON49523602.0
TBLA0B053106.215ON52623602.0
Kpol_1033.516.215ON44023602.3
Kpol_1002.536.215ON45923602.3
SAKL0A04444g6.215ON47423602.3
Kwal_56.240646.215ON47523602.3
KLTH0H04158g6.215ON48423602.3
KLLA0D03168g6.215ON50523602.3
TPHA0E028306.215ON51923602.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_14.306
         (72 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_14.306 Chr14 complement(548999..549214) [216 bp, 72 aa] {ON...   149   1e-48
YNL024C-A Chr14 complement(586602..586820) [219 bp, 72 aa] {ON} ...   149   1e-48
Suva_14.322 Chr14 complement(569440..569655) [216 bp, 72 aa] {ON...   147   5e-48
Cgla_YGOB_Anc_2.291 Chr13 complement(701547..701765) [219 bp, 72...   139   1e-44
NCAS0G03760 Chr7 complement(693645..693863) [219 bp, 72 aa] {ON}...   138   2e-44
NDAI0G00690 Chr7 (151360..151578) [219 bp, 72 aa] {ON} Anc_2.291...   137   6e-44
Skud_14.304 Chr14 complement(557335..557550) [216 bp, 72 aa] {ON...   133   2e-42
KNAG0H01970 Chr8 complement(347994..348212) [219 bp, 72 aa] {ON}...   133   2e-42
TBLA0B06970 Chr2 (1648736..1648954) [219 bp, 72 aa] {ON} Anc_2.2...   131   1e-41
SAKL0E07568g Chr5 complement(613454..613672) [219 bp, 72 aa] {ON...   130   2e-41
Kpol_1003.41 s1003 (99502..99720) [219 bp, 72 aa] {ON} (99502..9...   129   1e-40
KLLA0E08251g Chr5 complement(744523..744741) [219 bp, 72 aa] {ON...   124   5e-39
TPHA0C03430 Chr3 (751723..751941) [219 bp, 72 aa] {ON} Anc_2.291...   121   8e-38
ADL210W Chr4 (334320..334538) [219 bp, 72 aa] {ON} Syntenic homo...   120   2e-37
TDEL0G02210 Chr7 (434303..434521) [219 bp, 72 aa] {ON} Anc_2.291...   120   3e-37
KAFR0H03280 Chr8 complement(626054..626272) [219 bp, 72 aa] {ON}...   117   3e-36
ZYRO0A01980g Chr1 (164037..164255) [219 bp, 72 aa] {ON} highly s...   117   5e-36
Kwal_YGOB_Anc_2.291 s27 complement(830525..830743) [219 bp, 72 a...   114   9e-35
KLTH0G10472g Chr7 (885262..885480) [219 bp, 72 aa] {ON} highly s...   112   3e-34
Ecym_3330 Chr3 (631388..631606) [219 bp, 72 aa] {ON} similar to ...   100   5e-29
TBLA0I00320 Chr9 complement(51013..51738) [726 bp, 241 aa] {ON}        28   1.3  
NDAI0I01070 Chr9 (259836..261278) [1443 bp, 480 aa] {ON} Anc_6.215     28   2.0  
CAGL0H03553g Chr8 complement(328668..330155) [1488 bp, 495 aa] {...    28   2.0  
TBLA0B05310 Chr2 complement(1251914..1253494) [1581 bp, 526 aa] ...    28   2.0  
Kpol_1033.51 s1033 complement(127843..129165) [1323 bp, 440 aa] ...    28   2.3  
Kpol_1002.53 s1002 (150289..151668) [1380 bp, 459 aa] {ON} (1502...    28   2.3  
SAKL0A04444g Chr1 (412103..413527) [1425 bp, 474 aa] {ON} highly...    28   2.3  
Kwal_56.24064 s56 complement(831165..832592) [1428 bp, 475 aa] {...    28   2.3  
KLTH0H04158g Chr8 (378344..379798) [1455 bp, 484 aa] {ON} simila...    28   2.3  
KLLA0D03168g Chr4 (265761..267278) [1518 bp, 505 aa] {ON} simila...    28   2.3  
TPHA0E02830 Chr5 (591805..593364) [1560 bp, 519 aa] {ON} Anc_6.2...    28   2.3  

>Smik_14.306 Chr14 complement(548999..549214) [216 bp, 72 aa] {ON}
          YNL024C-A (REAL)
          Length = 72

 Score =  149 bits (376), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 72/72 (100%), Positives = 72/72 (100%)

Query: 1  MSALFNFRSLLQVILLLICSCSYVHGQWPSLLDRYKNHEVLGAFWKMARVGERASPYVSL 60
          MSALFNFRSLLQVILLLICSCSYVHGQWPSLLDRYKNHEVLGAFWKMARVGERASPYVSL
Sbjct: 1  MSALFNFRSLLQVILLLICSCSYVHGQWPSLLDRYKNHEVLGAFWKMARVGERASPYVSL 60

Query: 61 ACILMAISQFNS 72
          ACILMAISQFNS
Sbjct: 61 ACILMAISQFNS 72

>YNL024C-A Chr14 complement(586602..586820) [219 bp, 72 aa] {ON}
          KSH1Essential protein suggested to function early in
          the secretory pathway; inviability is suppressed by
          overexpression of Golgi protein Tvp23p; ortholog of
          human Kish
          Length = 72

 Score =  149 bits (376), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 72/72 (100%), Positives = 72/72 (100%)

Query: 1  MSALFNFRSLLQVILLLICSCSYVHGQWPSLLDRYKNHEVLGAFWKMARVGERASPYVSL 60
          MSALFNFRSLLQVILLLICSCSYVHGQWPSLLDRYKNHEVLGAFWKMARVGERASPYVSL
Sbjct: 1  MSALFNFRSLLQVILLLICSCSYVHGQWPSLLDRYKNHEVLGAFWKMARVGERASPYVSL 60

Query: 61 ACILMAISQFNS 72
          ACILMAISQFNS
Sbjct: 61 ACILMAISQFNS 72

>Suva_14.322 Chr14 complement(569440..569655) [216 bp, 72 aa] {ON}
          YNL024C-A (REAL)
          Length = 72

 Score =  147 bits (371), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 70/72 (97%), Positives = 71/72 (98%)

Query: 1  MSALFNFRSLLQVILLLICSCSYVHGQWPSLLDRYKNHEVLGAFWKMARVGERASPYVSL 60
          MSALFNFRSLLQVILLLICSCSYVHGQWPSLLDRYKNHEV GAFWKMAR+GERASPYVSL
Sbjct: 1  MSALFNFRSLLQVILLLICSCSYVHGQWPSLLDRYKNHEVFGAFWKMARIGERASPYVSL 60

Query: 61 ACILMAISQFNS 72
          ACILMAISQFNS
Sbjct: 61 ACILMAISQFNS 72

>Cgla_YGOB_Anc_2.291 Chr13 complement(701547..701765) [219 bp, 72
          aa] {ON} ANNOTATED BY YGOB -
          Length = 72

 Score =  139 bits (349), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 63/72 (87%), Positives = 70/72 (97%)

Query: 1  MSALFNFRSLLQVILLLICSCSYVHGQWPSLLDRYKNHEVLGAFWKMARVGERASPYVSL 60
          MSALFNF SLLQVILLLICSC+Y+H QWPSLLDRYKNH++LGAFWKMAR+GERASPYVS+
Sbjct: 1  MSALFNFASLLQVILLLICSCTYIHTQWPSLLDRYKNHDILGAFWKMARIGERASPYVSV 60

Query: 61 ACILMAISQFNS 72
          ACILMAI+QFNS
Sbjct: 61 ACILMAINQFNS 72

>NCAS0G03760 Chr7 complement(693645..693863) [219 bp, 72 aa] {ON}
          Anc_2.291 YNL024C-A
          Length = 72

 Score =  138 bits (348), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 64/72 (88%), Positives = 69/72 (95%)

Query: 1  MSALFNFRSLLQVILLLICSCSYVHGQWPSLLDRYKNHEVLGAFWKMARVGERASPYVSL 60
          MSALFNF SLLQVILLLICSC+YVH QWPSLLDRYK+HE LGAFWKMAR+GERASPYVSL
Sbjct: 1  MSALFNFSSLLQVILLLICSCTYVHTQWPSLLDRYKDHEALGAFWKMARIGERASPYVSL 60

Query: 61 ACILMAISQFNS 72
          ACI+MAI+QFNS
Sbjct: 61 ACIIMAINQFNS 72

>NDAI0G00690 Chr7 (151360..151578) [219 bp, 72 aa] {ON} Anc_2.291
          YNL024C-A
          Length = 72

 Score =  137 bits (345), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 63/72 (87%), Positives = 69/72 (95%)

Query: 1  MSALFNFRSLLQVILLLICSCSYVHGQWPSLLDRYKNHEVLGAFWKMARVGERASPYVSL 60
          MSALFNFRSLLQVILLLICSC+YVH QWPS+LDRYK+H  LGAFWKMAR+GERASPYVSL
Sbjct: 1  MSALFNFRSLLQVILLLICSCTYVHSQWPSILDRYKDHGALGAFWKMARIGERASPYVSL 60

Query: 61 ACILMAISQFNS 72
          ACI+MAI+QFNS
Sbjct: 61 ACIIMAINQFNS 72

>Skud_14.304 Chr14 complement(557335..557550) [216 bp, 72 aa] {ON}
          YNL024C-A (REAL)
          Length = 72

 Score =  133 bits (335), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 70/72 (97%), Positives = 72/72 (100%)

Query: 1  MSALFNFRSLLQVILLLICSCSYVHGQWPSLLDRYKNHEVLGAFWKMARVGERASPYVSL 60
          MSALFNFRSLLQV+LLLICSCSYVHGQWPSLLDRYKNHEVLGAFWKMAR+GERASPYVSL
Sbjct: 1  MSALFNFRSLLQVLLLLICSCSYVHGQWPSLLDRYKNHEVLGAFWKMARIGERASPYVSL 60

Query: 61 ACILMAISQFNS 72
          ACILMAISQFNS
Sbjct: 61 ACILMAISQFNS 72

>KNAG0H01970 Chr8 complement(347994..348212) [219 bp, 72 aa] {ON}
          Anc_2.291 YNL024C-A
          Length = 72

 Score =  133 bits (335), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 63/72 (87%), Positives = 67/72 (93%)

Query: 1  MSALFNFRSLLQVILLLICSCSYVHGQWPSLLDRYKNHEVLGAFWKMARVGERASPYVSL 60
          MSALFNF SLLQVILLLICSC+YVH QWPSLLDRYK HE LGAFWKMAR+GERASPYVSL
Sbjct: 1  MSALFNFSSLLQVILLLICSCTYVHTQWPSLLDRYKEHEALGAFWKMARLGERASPYVSL 60

Query: 61 ACILMAISQFNS 72
          ACILMA++QF S
Sbjct: 61 ACILMALNQFMS 72

>TBLA0B06970 Chr2 (1648736..1648954) [219 bp, 72 aa] {ON}
          Anc_2.291 YNL024C-A
          Length = 72

 Score =  131 bits (330), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 61/71 (85%), Positives = 66/71 (92%)

Query: 1  MSALFNFRSLLQVILLLICSCSYVHGQWPSLLDRYKNHEVLGAFWKMARVGERASPYVSL 60
          MSALF+FRS+LQVILLLICS +Y+H QWPSLLDRYKNH  LGAFWKMAR+GERASPYVSL
Sbjct: 1  MSALFSFRSMLQVILLLICSSTYIHCQWPSLLDRYKNHSTLGAFWKMARIGERASPYVSL 60

Query: 61 ACILMAISQFN 71
          ACI MAISQFN
Sbjct: 61 ACIAMAISQFN 71

>SAKL0E07568g Chr5 complement(613454..613672) [219 bp, 72 aa] {ON}
          similar to uniprot|Q8TGJ3 Saccharomyces cerevisiae
          YNL024C-A Identified by gene-trapping, microarray-based
          expression analysis, and genome-wide homology searching
          Length = 72

 Score =  130 bits (328), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 65/72 (90%)

Query: 1  MSALFNFRSLLQVILLLICSCSYVHGQWPSLLDRYKNHEVLGAFWKMARVGERASPYVSL 60
          MSALFNFRSLLQVILLLICSC+Y+H QWPSLLDRYKNH +L  FWK ARVGERASPYVSL
Sbjct: 1  MSALFNFRSLLQVILLLICSCTYIHTQWPSLLDRYKNHGMLNVFWKFARVGERASPYVSL 60

Query: 61 ACILMAISQFNS 72
          ACI MAISQF S
Sbjct: 61 ACICMAISQFKS 72

>Kpol_1003.41 s1003 (99502..99720) [219 bp, 72 aa] {ON}
          (99502..99720) [219 nt, 73 aa]
          Length = 72

 Score =  129 bits (323), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 58/72 (80%), Positives = 66/72 (91%)

Query: 1  MSALFNFRSLLQVILLLICSCSYVHGQWPSLLDRYKNHEVLGAFWKMARVGERASPYVSL 60
          MSALFNF SLLQVILLLICS +Y+H QWPS LDRYK+  VLGAFWK+AR+GERASPYVSL
Sbjct: 1  MSALFNFTSLLQVILLLICSSTYIHSQWPSFLDRYKDQSVLGAFWKLARIGERASPYVSL 60

Query: 61 ACILMAISQFNS 72
          ACI+MA++QFNS
Sbjct: 61 ACIIMAVNQFNS 72

>KLLA0E08251g Chr5 complement(744523..744741) [219 bp, 72 aa] {ON}
          highly similar to uniprot|Q8TGJ3 Saccharomyces
          cerevisiae YNL024C-A Identified by gene-trapping
          microarray-based expression analysis and genome-wide
          homology searching
          Length = 72

 Score =  124 bits (312), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 57/72 (79%), Positives = 64/72 (88%)

Query: 1  MSALFNFRSLLQVILLLICSCSYVHGQWPSLLDRYKNHEVLGAFWKMARVGERASPYVSL 60
          MSALFNF+SLLQVILL ICSC+Y+H Q PSLLDRYK+  +LG FWK AR+GERASPYVSL
Sbjct: 1  MSALFNFKSLLQVILLFICSCTYIHAQRPSLLDRYKDSGILGVFWKFARIGERASPYVSL 60

Query: 61 ACILMAISQFNS 72
          ACI MA+SQFNS
Sbjct: 61 ACIAMAVSQFNS 72

>TPHA0C03430 Chr3 (751723..751941) [219 bp, 72 aa] {ON} Anc_2.291
          YNL024C-A
          Length = 72

 Score =  121 bits (304), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 64/72 (88%)

Query: 1  MSALFNFRSLLQVILLLICSCSYVHGQWPSLLDRYKNHEVLGAFWKMARVGERASPYVSL 60
          MSALFNF SLLQVILLLICS +Y+H QWPSL DRYK+  VL  FWK++R+GERASPYVS+
Sbjct: 1  MSALFNFSSLLQVILLLICSSTYIHSQWPSLFDRYKDTGVLSTFWKLSRIGERASPYVSI 60

Query: 61 ACILMAISQFNS 72
          ACI+MA++QFNS
Sbjct: 61 ACIIMAVNQFNS 72

>ADL210W Chr4 (334320..334538) [219 bp, 72 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YNL024CX; YNL024CX
          was overlooked in Saccharomyces cerevisiae
          Length = 72

 Score =  120 bits (302), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 56/72 (77%), Positives = 62/72 (86%)

Query: 1  MSALFNFRSLLQVILLLICSCSYVHGQWPSLLDRYKNHEVLGAFWKMARVGERASPYVSL 60
          MSALF F +LLQVILLLICS +YVH QWPSLL+RYK H VLG FWK AR+GERASPYVS+
Sbjct: 1  MSALFKFSALLQVILLLICSSTYVHAQWPSLLERYKEHSVLGIFWKFARIGERASPYVSI 60

Query: 61 ACILMAISQFNS 72
          ACI MAI+Q NS
Sbjct: 61 ACIAMAINQINS 72

>TDEL0G02210 Chr7 (434303..434521) [219 bp, 72 aa] {ON} Anc_2.291
          YNL024C-A
          Length = 72

 Score =  120 bits (301), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 63/72 (87%), Positives = 69/72 (95%)

Query: 1  MSALFNFRSLLQVILLLICSCSYVHGQWPSLLDRYKNHEVLGAFWKMARVGERASPYVSL 60
          MSALFNF+SLLQVILLL+CSC+YVH QWPSLLDRYK+H V GAFWKMARVGERASPYVS+
Sbjct: 1  MSALFNFKSLLQVILLLLCSCTYVHAQWPSLLDRYKDHGVFGAFWKMARVGERASPYVSV 60

Query: 61 ACILMAISQFNS 72
          ACILMAI+QFNS
Sbjct: 61 ACILMAINQFNS 72

>KAFR0H03280 Chr8 complement(626054..626272) [219 bp, 72 aa] {ON}
          Anc_2.291 YNL024C-A
          Length = 72

 Score =  117 bits (294), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 60/72 (83%), Positives = 67/72 (93%)

Query: 1  MSALFNFRSLLQVILLLICSCSYVHGQWPSLLDRYKNHEVLGAFWKMARVGERASPYVSL 60
          MSALFNF SLLQV+LLLICSC+Y+H QWPSLL+RYK+HE LG FWKMARVGER SPYVSL
Sbjct: 1  MSALFNFSSLLQVLLLLICSCTYIHTQWPSLLERYKDHEALGIFWKMARVGERGSPYVSL 60

Query: 61 ACILMAISQFNS 72
          ACILMA++QFNS
Sbjct: 61 ACILMAVNQFNS 72

>ZYRO0A01980g Chr1 (164037..164255) [219 bp, 72 aa] {ON} highly
          similar to uniprot|Q8TGJ3 Saccharomyces cerevisiae
          YNL024C-A Identified by gene-trapping microarray-based
          expression analysis and genome-wide homology searching
          Length = 72

 Score =  117 bits (293), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 63/72 (87%), Positives = 67/72 (93%)

Query: 1  MSALFNFRSLLQVILLLICSCSYVHGQWPSLLDRYKNHEVLGAFWKMARVGERASPYVSL 60
          MSALFNF+SLLQVILLL+CSC+YVH QWPSLLDRYK H VL AFWKMARVGERASPYVSL
Sbjct: 1  MSALFNFKSLLQVILLLLCSCTYVHAQWPSLLDRYKGHGVLSAFWKMARVGERASPYVSL 60

Query: 61 ACILMAISQFNS 72
          ACILMA+SQ NS
Sbjct: 61 ACILMALSQLNS 72

>Kwal_YGOB_Anc_2.291 s27 complement(830525..830743) [219 bp, 72
          aa] {ON} ANNOTATED BY YGOB -
          Length = 72

 Score =  114 bits (284), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 56/72 (77%), Positives = 68/72 (94%)

Query: 1  MSALFNFRSLLQVILLLICSCSYVHGQWPSLLDRYKNHEVLGAFWKMARVGERASPYVSL 60
          MSALFNF++LLQV+LLLICSC+Y+H QWPSLLDRYK+H +LGAFWK AR+GERASPYVSL
Sbjct: 1  MSALFNFQALLQVLLLLICSCTYIHSQWPSLLDRYKDHSMLGAFWKCARIGERASPYVSL 60

Query: 61 ACILMAISQFNS 72
          ACI+MA++QF +
Sbjct: 61 ACIIMAVNQFQT 72

>KLTH0G10472g Chr7 (885262..885480) [219 bp, 72 aa] {ON} highly
          similar to uniprot|Q8TGJ3 Saccharomyces cerevisiae
          YNL024C-A Identified by gene-trapping microarray-based
          expression analysis and genome-wide homology searching
          Length = 72

 Score =  112 bits (281), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 67/72 (93%)

Query: 1  MSALFNFRSLLQVILLLICSCSYVHGQWPSLLDRYKNHEVLGAFWKMARVGERASPYVSL 60
          MSALFNF++LLQV+LLLICSC+Y+H QWPSLLDRYK H +LGAFWK AR+GERASPYVS+
Sbjct: 1  MSALFNFQALLQVLLLLICSCTYIHSQWPSLLDRYKEHSMLGAFWKCARIGERASPYVSI 60

Query: 61 ACILMAISQFNS 72
          ACI+MA++QF +
Sbjct: 61 ACIIMAVNQFQT 72

>Ecym_3330 Chr3 (631388..631606) [219 bp, 72 aa] {ON} similar to
          Ashbya gossypii ADL210W
          Length = 72

 Score = 99.8 bits (247), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 61/72 (84%)

Query: 1  MSALFNFRSLLQVILLLICSCSYVHGQWPSLLDRYKNHEVLGAFWKMARVGERASPYVSL 60
          MSALF F SLLQ+ILLLICS +YVH QWPSLL+RYK H VL  FWK AR+GERASPYVSL
Sbjct: 1  MSALFKFSSLLQIILLLICSSTYVHCQWPSLLERYKQHGVLSIFWKFARIGERASPYVSL 60

Query: 61 ACILMAISQFNS 72
          ACI+M  +QFNS
Sbjct: 61 ACIVMVANQFNS 72

>TBLA0I00320 Chr9 complement(51013..51738) [726 bp, 241 aa] {ON} 
          Length = 241

 Score = 28.1 bits (61), Expect = 1.3,   Method: Composition-based stats.
 Identities = 15/41 (36%), Positives = 23/41 (56%), Gaps = 1/41 (2%)

Query: 16  LLICSCSYVHGQWPSLLDRYKNH-EVLGAFWKMARVGERAS 55
           +L+   + V G +P    R K+  E++GA WK   + ERAS
Sbjct: 73  ILVAKFADVDGNYPREYRRRKDEGEIVGAVWKDIAMKERAS 113

>NDAI0I01070 Chr9 (259836..261278) [1443 bp, 480 aa] {ON} Anc_6.215
          Length = 480

 Score = 27.7 bits (60), Expect = 2.0,   Method: Composition-based stats.
 Identities = 8/23 (34%), Positives = 17/23 (73%)

Query: 5   FNFRSLLQVILLLICSCSYVHGQ 27
           F+F++++ + L +IC   Y+HG+
Sbjct: 100 FSFKTVIMLALQMICRVQYIHGR 122

>CAGL0H03553g Chr8 complement(328668..330155) [1488 bp, 495 aa] {ON}
           highly similar to uniprot|P29295 Saccharomyces
           cerevisiae YPL204w HRR25
          Length = 495

 Score = 27.7 bits (60), Expect = 2.0,   Method: Composition-based stats.
 Identities = 8/23 (34%), Positives = 17/23 (73%)

Query: 5   FNFRSLLQVILLLICSCSYVHGQ 27
           F+F++++ + L +IC   Y+HG+
Sbjct: 100 FSFKTVIMLALQMICRVQYIHGR 122

>TBLA0B05310 Chr2 complement(1251914..1253494) [1581 bp, 526 aa]
           {ON} Anc_6.215 YPL204W
          Length = 526

 Score = 27.7 bits (60), Expect = 2.0,   Method: Composition-based stats.
 Identities = 8/23 (34%), Positives = 17/23 (73%)

Query: 5   FNFRSLLQVILLLICSCSYVHGQ 27
           F+F++++ + L +IC   Y+HG+
Sbjct: 100 FSFKTVIMLALQMICRVQYIHGR 122

>Kpol_1033.51 s1033 complement(127843..129165) [1323 bp, 440 aa]
          {ON} complement(127843..129165) [1323 nt, 441 aa]
          Length = 440

 Score = 27.7 bits (60), Expect = 2.3,   Method: Composition-based stats.
 Identities = 8/23 (34%), Positives = 17/23 (73%)

Query: 5  FNFRSLLQVILLLICSCSYVHGQ 27
          F+F++++ + L +IC   Y+HG+
Sbjct: 21 FSFKTVIMLALQMICRIQYIHGR 43

>Kpol_1002.53 s1002 (150289..151668) [1380 bp, 459 aa] {ON}
           (150289..151668) [1380 nt, 460 aa]
          Length = 459

 Score = 27.7 bits (60), Expect = 2.3,   Method: Composition-based stats.
 Identities = 8/23 (34%), Positives = 17/23 (73%)

Query: 5   FNFRSLLQVILLLICSCSYVHGQ 27
           F+F++++ + L +IC   Y+HG+
Sbjct: 100 FSFKTVIMLALQMICRIQYIHGR 122

>SAKL0A04444g Chr1 (412103..413527) [1425 bp, 474 aa] {ON} highly
           similar to uniprot|P29295 Saccharomyces cerevisiae
           YPL204W HRR25 Protein kinase involved in regulating
           diverse events including vesicular trafficking gene
           expression DNA repair and chromosome segregation binds
           the CTD of RNA pol II homolog of mammalian casein kinase
           1delta (CK1delta)
          Length = 474

 Score = 27.7 bits (60), Expect = 2.3,   Method: Composition-based stats.
 Identities = 8/23 (34%), Positives = 17/23 (73%)

Query: 5   FNFRSLLQVILLLICSCSYVHGQ 27
           F+F++++ + L +IC   Y+HG+
Sbjct: 100 FSFKTVIMLALQMICRIQYIHGR 122

>Kwal_56.24064 s56 complement(831165..832592) [1428 bp, 475 aa] {ON}
           YPL204W (HRR25) - casein kinase I isoform [contig 166]
           FULL
          Length = 475

 Score = 27.7 bits (60), Expect = 2.3,   Method: Composition-based stats.
 Identities = 8/23 (34%), Positives = 17/23 (73%)

Query: 5   FNFRSLLQVILLLICSCSYVHGQ 27
           F+F++++ + L +IC   Y+HG+
Sbjct: 100 FSFKTVIMLALQMICRIQYIHGR 122

>KLTH0H04158g Chr8 (378344..379798) [1455 bp, 484 aa] {ON} similar
           to uniprot|P29295 Saccharomyces cerevisiae YPL204W HRR25
           Protein kinase involved in regulating diverse events
           including vesicular trafficking gene expression DNA
           repair and chromosome segregation binds the CTD of RNA
           pol II homolog of mammalian casein kinase 1delta
           (CK1delta)
          Length = 484

 Score = 27.7 bits (60), Expect = 2.3,   Method: Composition-based stats.
 Identities = 8/23 (34%), Positives = 17/23 (73%)

Query: 5   FNFRSLLQVILLLICSCSYVHGQ 27
           F+F++++ + L +IC   Y+HG+
Sbjct: 100 FSFKTVIMLALQMICRIQYIHGR 122

>KLLA0D03168g Chr4 (265761..267278) [1518 bp, 505 aa] {ON} similar
           to uniprot|P29295 Saccharomyces cerevisiae YPL204W HRR25
           Protein kinase involved in regulating diverse events
           including vesicular trafficking gene expression DNA
           repair and chromosome segregation binds the CTD of RNA
           pol II homolog of mammalian casein kinase 1delta
           (CK1delta)
          Length = 505

 Score = 27.7 bits (60), Expect = 2.3,   Method: Composition-based stats.
 Identities = 8/23 (34%), Positives = 17/23 (73%)

Query: 5   FNFRSLLQVILLLICSCSYVHGQ 27
           F+F++++ + L +IC   Y+HG+
Sbjct: 100 FSFKTVIMLALQMICRIQYIHGR 122

>TPHA0E02830 Chr5 (591805..593364) [1560 bp, 519 aa] {ON} Anc_6.215
           YPL204W
          Length = 519

 Score = 27.7 bits (60), Expect = 2.3,   Method: Composition-based stats.
 Identities = 8/23 (34%), Positives = 17/23 (73%)

Query: 5   FNFRSLLQVILLLICSCSYVHGQ 27
           F+F++++ + L +IC   Y+HG+
Sbjct: 100 FSFKTVIMLALQMICRIQYIHGR 122

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.330    0.137    0.441 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 6,347,546
Number of extensions: 181972
Number of successful extensions: 523
Number of sequences better than 10.0: 31
Number of HSP's gapped: 523
Number of HSP's successfully gapped: 31
Length of query: 72
Length of database: 53,481,399
Length adjustment: 45
Effective length of query: 27
Effective length of database: 48,321,429
Effective search space: 1304678583
Effective search space used: 1304678583
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 59 (27.3 bits)