Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_14.2962.283ON38938919610.0
YNL035C2.283ON38938916980.0
Skud_14.2982.283ON38938916780.0
Suva_14.3112.283ON38938916310.0
NDAI0G006302.283ON39736012691e-174
KLTH0G10296g2.283ON42634112721e-174
Kpol_1003.342.283ON38836612661e-174
ZYRO0A01804g2.283ON37636012551e-172
KNAG0H020402.283ON39936412551e-172
NCAS0G038702.283ON38934612491e-171
KAFR0H033402.283ON36734112381e-170
TDEL0G021402.283ON39234712381e-170
Ecym_33212.283ON40936312151e-166
Kwal_27.115502.283ON40734112091e-165
SAKL0E07766g2.283ON39834312081e-165
KLLA0E08449g2.283ON42234712061e-164
ADL218C2.283ON40334311781e-160
TBLA0B059202.283ON40333611751e-160
TPHA0C033702.283ON41335111361e-154
CAGL0G01628g2.283ON37634711011e-149
CAGL0B03575g6.9ON4191981514e-10
KLTH0C11550g6.9ON398931249e-07
Kpol_1045.786.9ON3921121241e-06
ACR017W6.9ON4231831241e-06
ZYRO0F00462g6.9ON3931771231e-06
NDAI0K029006.9ON4382041231e-06
SAKL0E00814g6.9ON3982041203e-06
KLLA0D00814g6.9ON4081851176e-06
KNAG0E009806.9ON4141901178e-06
KAFR0L003206.9ON3911861168e-06
TBLA0H036508.548ON4191841151e-05
KLLA0E04819g7.534ON4591411151e-05
TBLA0A071206.9ON4072121132e-05
KNAG0F038707.534ON4651081132e-05
Smik_11.2981.247ON6621151114e-05
Skud_5.336.9ON4012051105e-05
SAKL0F08404g7.231ON6431771106e-05
TBLA0D041307.231ON5741721097e-05
ZYRO0A08690g2.401ON5161951098e-05
Suva_11.2681.247ON6451781072e-04
KLLA0E07085g3.25ON4521421052e-04
Suva_5.126.9ON4011291043e-04
TBLA0H030601.247ON730681043e-04
TDEL0D013101.247ON7091401043e-04
Kpol_1041.202.401ON5151941034e-04
SAKL0C13266g3.25ON4591361025e-04
YEL056W (HAT2)6.9ON4011261007e-04
KLTH0E12694g8.548ON418751008e-04
KNAG0D016907.231ON6541721009e-04
KLTH0F16192g5.429ON4621661000.001
Kwal_55.220763.22ON1286631000.001
AGL234W6.363ON629159990.001
Kpol_1028.236.363ON744179990.001
Ecym_30126.9ON397174980.001
ZYRO0D03828g1.247ON726140990.001
TDEL0A077806.363ON657161990.001
Kwal_23.64296.363ON750158990.001
Kwal_27.120708.548ON41873980.002
SAKL0C13332g3.22ON135364990.002
KLTH0D10648g8.651ON449118980.002
TPHA0P014903.25ON459136970.002
Smik_5.316.9ON427120970.002
KLLA0E23541g8.548ON417166970.002
CAGL0G04345g1.247ON711117970.002
NDAI0H027502.401ON512189960.003
TPHA0M020006.363ON699164960.003
KAFR0A064804.122ON568138960.003
TDEL0H003707.534ON465108950.003
CAGL0H08932g6.239ON902171960.003
KNAG0E021802.401ON517195950.003
Ecym_25236.363ON646159950.004
NCAS0C044503.25ON461136950.004
TPHA0G026502.401ON516212950.004
KNAG0D027205.49ON1541176950.004
TPHA0B042501.107ON507164940.004
YPR178W (PRP4)7.534ON465108940.004
NCAS0A151707.534ON474161940.005
NCAS0F019702.401ON511194940.005
Suva_10.3168.435ON818107940.006
KNAG0B016101.247ON674129940.006
ZYRO0A09636g8.435ON808109940.006
Smik_16.4427.534ON470108930.006
TPHA0M001906.9ON391188930.006
Kpol_1028.546.325ON905184930.008
CAGL0J01265g2.469ON517111920.008
KNAG0C014101.247ON653100920.008
KNAG0A012503.25ON452129920.009
TBLA0F005206.363ON663158920.010
KLLA0A08822g4.122ON582185920.010
Sklu_YGOB_Anc_2.4012.401ON520189910.010
Kwal_27.126671.247ON721196910.011
Kwal_55.214505.429ON503166910.012
NCAS0A055206.363ON671158910.013
Kwal_26.87008.651ON381165900.013
KLTH0A07282g6.363ON725158900.014
NDAI0K023506.363ON793157900.015
KLTH0E09394g2.401ON522189900.016
Skud_2.2293.344ON545217900.016
TPHA0G018408.631ON43159890.018
ZYRO0D01122g7.534ON466124890.018
Kpol_1014.193.25ON452143890.018
Suva_13.3112.401ON510195890.018
KLTH0F19338g3.22ON129063900.019
YER107C (GLE2)7.405ON365149880.020
TBLA0B087303.25ON461132890.020
Smik_12.2798.435ON817107890.023
Ecym_70428.548ON414107880.024
YLR222C (UTP13)8.435ON817107890.024
Kpol_1031.361.247ON706131880.025
CAGL0L00781g7.231ON673171880.025
Ecym_20243.22ON131760890.026
ADL186C3.22ON136160880.027
TBLA0G014904.122ON732109880.029
NCAS0E037507.310ON1276184880.029
TPHA0E017905.429ON441189870.030
Skud_12.2858.435ON817107880.031
KLTH0D05346g2.469ON507102870.032
KLTH0E15576g1.247ON723140870.034
KLLA0F21406g1.247ON705130870.035
SAKL0D04796g1.247ON769142870.035
ZYRO0B10450g5.201ON482366870.038
AAR057W6.325ON922212870.038
TBLA0F042406.363ON727157870.038
Suva_6.1871.247ON714138870.039
Skud_11.2711.247ON646197870.040
KLLA0C08976g6.325ON911183870.044
Suva_4.3483.344ON548198860.044
KLLA0E21187g5.429ON429170860.044
KLLA0F19734g8.288ON113357870.044
KLLA0F17237g2.401ON523182860.045
TDEL0G033402.401ON514195860.046
SAKL0F15972g7.534ON470155850.053
NCAS0A096101.247ON695135850.060
KLTH0F19294g3.25ON451134850.060
YLL011W (SOF1)5.201ON489191850.063
ADR242C2.401ON521213850.066
KLLA0E20967g3.22ON132160850.069
TPHA0B011201.247ON719191850.071
AGR180W8.435ON806230850.071
CAGL0A00561g4.119ON41252840.074
Ecym_80901.247ON716139850.074
ZYRO0G02618g2.450ON88087850.074
Kpol_1018.1037.405ON359148830.078
SAKL0A00660g6.363ON660157840.080
Suva_16.5107.534ON465163840.080
TBLA0B046805.49ON1549176850.082
Kwal_47.178272.401ON523189840.083
CAGL0K03861g2.401ON513193840.083
Smik_14.143.25ON466142840.084
YBR103W (SIF2)3.344ON535194840.084
ZYRO0D17292g6.363ON718161840.094
Kwal_55.220673.25ON451134830.10
Kpol_1041.354.77ON70181830.10
CAGL0B01529g8.316ON36996830.10
Skud_12.565.201ON489191830.11
ACR097W8.631ON46797830.11
KAFR0A033801.247ON666128830.11
KNAG0I010508.288ON115956830.11
Suva_14.223.25ON469142830.11
ZYRO0D06556g8.288ON1147131830.11
KNAG0C034907.405ON362146820.12
KAFR0A069906.239ON885156830.12
AEL314W1.247ON715132830.12
SAKL0A03872g6.239ON878120830.12
CAGL0K09284g6.325ON911216830.12
CAGL0K03377g2.450ON97844830.13
Skud_14.223.25ON467142820.13
Kwal_56.24399na 1ON369139820.13
TBLA0D048701.399ON327108810.13
TPHA0A003803.22ON131084820.14
TPHA0L021305.49ON1508161820.15
YJL112W (MDV1)1.247ON714129820.15
Skud_7.5615.104ON59362820.15
Kpol_2001.657.322ON1206159820.16
TPHA0C011507.231ON687173820.16
TDEL0A075506.340ON515161810.16
TPHA0D038306.325ON912216820.17
TPHA0L010808.435ON835111820.17
SAKL0H09900g8.548ON425123810.17
Kwal_26.77362.469ON507102810.17
TPHA0D045007.322ON1208159820.18
Suva_5.2287.405ON365136810.18
YMR131C (RRB1)2.401ON511195810.18
KAFR0I018807.231ON591172810.18
Smik_2.2433.344ON541206810.18
ABL024W2.450ON73464810.18
YDL139C (SCM3)7.312ON22370790.18
Skud_5.2327.405ON365139800.19
Ecym_42558.324ON937124810.19
Smik_13.3292.401ON509195810.19
TPHA0F005204.77ON713101810.19
SAKL0A01738g6.325ON909184810.20
KAFR0I028403.25ON456129800.20
Skud_4.1097.322ON1201155810.20
NCAS0F014502.450ON90859810.20
NDAI0A033104.106ON81749810.20
KNAG0A036708.548ON426111800.21
Smik_4.907.322ON1201155810.21
Kpol_1038.203.22ON131357810.22
ZYRO0G10406g4.119ON39134800.22
NCAS0F001906.9ON411123800.23
YDL145C (COP1)7.322ON1201155810.23
Suva_4.997.322ON1201155800.26
Kwal_56.241636.239ON729120800.26
ZYRO0E07392g6.239ON897155800.27
Skud_13.2912.401ON509190800.27
NDAI0A020907.322ON1200155800.28
Kpol_1045.337.405ON361113790.28
YCR057C (PWP2)6.325ON923233800.28
Suva_3.936.325ON920233800.29
Kwal_47.173108.133ON553101790.29
Ecym_60672.401ON522195790.30
TBLA0B092502.401ON526188790.30
Smik_5.2537.405ON365139790.30
TDEL0E054806.239ON881103800.30
Kpol_1028.416.340ON512172790.31
AFL118W6.239ON832120790.31
SAKL0E03520g2.450ON96652790.31
YNL317W (PFS2)3.25ON465142790.31
Smik_15.163.22ON132697800.31
KLTH0D11132g8.672ON437146790.32
ZYRO0F05808g7.310ON1282174790.32
Ecym_34813.344ON50458790.33
Smik_16.1065.139ON789192790.33
Suva_16.606.276ON52671790.33
Ecym_62288.721ON445164790.34
Smik_3.1576.325ON924233790.35
TDEL0A068906.276ON44757780.36
NDAI0E015008.631ON42859780.37
Ecym_71055.201ON484221780.38
SAKL0G19536g2.657ON328167780.39
NCAS0A018504.77ON70181780.40
Skud_10.1021.247ON708162780.41
YCR084C (TUP1)6.363ON713158780.42
Kpol_1013.377.534ON468106780.43
KAFR0F025901.247ON700207780.45
YBR097W (VPS15)3.339ON1454241780.45
NDAI0I021805.201ON479206780.46
TDEL0C023607.310ON1264176780.46
Skud_3.1336.325ON916233780.47
NCAS0A139407.322ON1205153780.47
Kwal_27.122398.585ON31665770.47
NCAS0G011206.276ON49451770.47
KLTH0H03608g6.239ON875103780.48
TDEL0G012805.104ON63581780.48
TPHA0L016908.544ON832164780.49
YHR186C (KOG1)5.49ON1557199780.49
ZYRO0G03146g2.469ON510111770.50
Ecym_42808.288ON1132174780.51
Suva_4.537.310ON127159780.51
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_14.296
         (389 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_14.296 Chr14 complement(535060..536229) [1170 bp, 389 aa] {...   759   0.0  
YNL035C Chr14 complement(568522..569691) [1170 bp, 389 aa] {ON} ...   658   0.0  
Skud_14.298 Chr14 complement(546083..547252) [1170 bp, 389 aa] {...   650   0.0  
Suva_14.311 Chr14 complement(553987..555156) [1170 bp, 389 aa] {...   632   0.0  
NDAI0G00630 Chr7 complement(137826..139019) [1194 bp, 397 aa] {O...   493   e-174
KLTH0G10296g Chr7 complement(869990..871270) [1281 bp, 426 aa] {...   494   e-174
Kpol_1003.34 s1003 complement(85833..86999) [1167 bp, 388 aa] {O...   492   e-174
ZYRO0A01804g Chr1 complement(150103..151233) [1131 bp, 376 aa] {...   488   e-172
KNAG0H02040 Chr8 (366384..367583) [1200 bp, 399 aa] {ON} Anc_2.2...   488   e-172
NCAS0G03870 Chr7 (717809..718978) [1170 bp, 389 aa] {ON} Anc_2.283    485   e-171
KAFR0H03340 Chr8 (637913..639016) [1104 bp, 367 aa] {ON} Anc_2.2...   481   e-170
TDEL0G02140 Chr7 complement(420388..421566) [1179 bp, 392 aa] {O...   481   e-170
Ecym_3321 Chr3 complement(615730..616959) [1230 bp, 409 aa] {ON}...   472   e-166
Kwal_27.11550 s27 (845458..846681) [1224 bp, 407 aa] {ON} YNL035...   470   e-165
SAKL0E07766g Chr5 (628373..629569) [1197 bp, 398 aa] {ON} simila...   469   e-165
KLLA0E08449g Chr5 (759718..760986) [1269 bp, 422 aa] {ON} simila...   469   e-164
ADL218C Chr4 complement(319674..320885) [1212 bp, 403 aa] {ON} S...   458   e-160
TBLA0B05920 Chr2 complement(1390257..1391468) [1212 bp, 403 aa] ...   457   e-160
TPHA0C03370 Chr3 complement(738736..739977) [1242 bp, 413 aa] {O...   442   e-154
CAGL0G01628g Chr7 complement(151262..152392) [1131 bp, 376 aa] {...   428   e-149
CAGL0B03575g Chr2 complement(357525..358784) [1260 bp, 419 aa] {...    63   4e-10
KLTH0C11550g Chr3 (949063..950259) [1197 bp, 398 aa] {ON} simila...    52   9e-07
Kpol_1045.78 s1045 (183044..184222) [1179 bp, 392 aa] {ON} (1830...    52   1e-06
ACR017W Chr3 (387122..388393) [1272 bp, 423 aa] {ON} Syntenic ho...    52   1e-06
ZYRO0F00462g Chr6 complement(46021..47202) [1182 bp, 393 aa] {ON...    52   1e-06
NDAI0K02900 Chr11 (657436..658752) [1317 bp, 438 aa] {ON} Anc_6.9      52   1e-06
SAKL0E00814g Chr5 complement(59724..60920) [1197 bp, 398 aa] {ON...    51   3e-06
KLLA0D00814g Chr4 complement(76687..77913) [1227 bp, 408 aa] {ON...    50   6e-06
KNAG0E00980 Chr5 complement(186207..187451) [1245 bp, 414 aa] {O...    50   8e-06
KAFR0L00320 Chr12 (56449..57624) [1176 bp, 391 aa] {ON} Anc_6.9 ...    49   8e-06
TBLA0H03650 Chr8 (888840..890099) [1260 bp, 419 aa] {ON} Anc_8.5...    49   1e-05
KLLA0E04819g Chr5 (428278..429657) [1380 bp, 459 aa] {ON} simila...    49   1e-05
TBLA0A07120 Chr1 complement(1765718..1766941) [1224 bp, 407 aa] ...    48   2e-05
KNAG0F03870 Chr6 complement(731884..733281) [1398 bp, 465 aa] {O...    48   2e-05
Smik_11.298 Chr11 complement(497968..499956) [1989 bp, 662 aa] {...    47   4e-05
Skud_5.33 Chr5 (46184..47389) [1206 bp, 401 aa] {ON} YEL056W (REAL)    47   5e-05
SAKL0F08404g Chr6 complement(640436..642367) [1932 bp, 643 aa] {...    47   6e-05
TBLA0D04130 Chr4 (1027726..1029450) [1725 bp, 574 aa] {ON} Anc_7...    47   7e-05
ZYRO0A08690g Chr1 (691253..692803) [1551 bp, 516 aa] {ON} highly...    47   8e-05
Suva_11.268 Chr11 complement(492639..494576) [1938 bp, 645 aa] {...    46   2e-04
KLLA0E07085g Chr5 (645766..647124) [1359 bp, 452 aa] {ON} simila...    45   2e-04
Suva_5.12 Chr5 (23273..24478) [1206 bp, 401 aa] {ON} YEL056W (REAL)    45   3e-04
TBLA0H03060 Chr8 complement(748221..750413) [2193 bp, 730 aa] {O...    45   3e-04
TDEL0D01310 Chr4 complement(251119..253248) [2130 bp, 709 aa] {O...    45   3e-04
Kpol_1041.20 s1041 complement(56019..57566) [1548 bp, 515 aa] {O...    44   4e-04
SAKL0C13266g Chr3 complement(1171961..1173340) [1380 bp, 459 aa]...    44   5e-04
YEL056W Chr5 (47168..48373) [1206 bp, 401 aa] {ON}  HAT2Subunit ...    43   7e-04
KLTH0E12694g Chr5 (1126940..1128196) [1257 bp, 418 aa] {ON} simi...    43   8e-04
KNAG0D01690 Chr4 (286791..288755) [1965 bp, 654 aa] {ON} Anc_7.2...    43   9e-04
KLTH0F16192g Chr6 (1312331..1313719) [1389 bp, 462 aa] {ON} simi...    43   0.001
Kwal_55.22076 s55 (1098857..1102717) [3861 bp, 1286 aa] {ON} YOL...    43   0.001
AGL234W Chr7 (257969..259858) [1890 bp, 629 aa] {ON} Syntenic ho...    43   0.001
Kpol_1028.23 s1028 (63032..65266) [2235 bp, 744 aa] {ON} (63032....    43   0.001
Ecym_3012 Chr3 complement(24573..25766) [1194 bp, 397 aa] {ON} s...    42   0.001
ZYRO0D03828g Chr4 (310049..312229) [2181 bp, 726 aa] {ON} simila...    43   0.001
TDEL0A07780 Chr1 complement(1352017..1353990) [1974 bp, 657 aa] ...    43   0.001
Kwal_23.6429 s23 complement(1577398..1579650) [2253 bp, 750 aa] ...    43   0.001
Kwal_27.12070 s27 (1071472..1072728) [1257 bp, 418 aa] {ON} YBR1...    42   0.002
SAKL0C13332g Chr3 (1177358..1181419) [4062 bp, 1353 aa] {ON} sim...    43   0.002
KLTH0D10648g Chr4 (875331..875337,875409..876751) [1350 bp, 449 ...    42   0.002
TPHA0P01490 Chr16 complement(302996..304375) [1380 bp, 459 aa] {...    42   0.002
Smik_5.31 Chr5 (49406..50689) [1284 bp, 427 aa] {ON} YEL056W (REAL)    42   0.002
KLLA0E23541g Chr5 (2095246..2096499) [1254 bp, 417 aa] {ON} simi...    42   0.002
CAGL0G04345g Chr7 (408842..410977) [2136 bp, 711 aa] {ON} simila...    42   0.002
NDAI0H02750 Chr8 (677299..678837) [1539 bp, 512 aa] {ON} Anc_2.4...    42   0.003
TPHA0M02000 Chr13 complement(414262..416361) [2100 bp, 699 aa] {...    42   0.003
KAFR0A06480 Chr1 complement(1312834..1314540) [1707 bp, 568 aa] ...    42   0.003
TDEL0H00370 Chr8 complement(57487..58884) [1398 bp, 465 aa] {ON}...    41   0.003
CAGL0H08932g Chr8 (871668..871685,872089..874779) [2709 bp, 902 ...    42   0.003
KNAG0E02180 Chr5 (440039..441592) [1554 bp, 517 aa] {ON} Anc_2.4...    41   0.003
Ecym_2523 Chr2 complement(1021566..1023506) [1941 bp, 646 aa] {O...    41   0.004
NCAS0C04450 Chr3 (912688..914073) [1386 bp, 461 aa] {ON} Anc_3.25      41   0.004
TPHA0G02650 Chr7 (558370..559920) [1551 bp, 516 aa] {ON} Anc_2.4...    41   0.004
KNAG0D02720 Chr4 complement(489642..494267) [4626 bp, 1541 aa] {...    41   0.004
TPHA0B04250 Chr2 complement(995664..997187) [1524 bp, 507 aa] {O...    41   0.004
YPR178W Chr16 (892332..893729) [1398 bp, 465 aa] {ON}  PRP4Splic...    41   0.004
NCAS0A15170 Chr1 (2984221..2985645) [1425 bp, 474 aa] {ON} Anc_7...    41   0.005
NCAS0F01970 Chr6 complement(396326..397861) [1536 bp, 511 aa] {O...    41   0.005
Suva_10.316 Chr10 complement(551612..554068) [2457 bp, 818 aa] {...    41   0.006
KNAG0B01610 Chr2 (294433..296457) [2025 bp, 674 aa] {ON} Anc_1.2...    41   0.006
ZYRO0A09636g Chr1 (779501..781927) [2427 bp, 808 aa] {ON} highly...    41   0.006
Smik_16.442 Chr16 (754983..756395) [1413 bp, 470 aa] {ON} YPR178...    40   0.006
TPHA0M00190 Chr13 complement(38571..39746) [1176 bp, 391 aa] {ON...    40   0.006
Kpol_1028.54 s1028 (125940..128657) [2718 bp, 905 aa] {ON} (1259...    40   0.008
CAGL0J01265g Chr10 complement(118375..119928) [1554 bp, 517 aa] ...    40   0.008
KNAG0C01410 Chr3 (277054..279015) [1962 bp, 653 aa] {ON} Anc_1.2...    40   0.008
KNAG0A01250 Chr1 (23559..24917) [1359 bp, 452 aa] {ON} Anc_3.25 ...    40   0.009
TBLA0F00520 Chr6 complement(134791..136782) [1992 bp, 663 aa] {O...    40   0.010
KLLA0A08822g Chr1 (772565..774313) [1749 bp, 582 aa] {ON} simila...    40   0.010
Sklu_YGOB_Anc_2.401 Chr5 complement(385202..386764) [1563 bp, 52...    40   0.010
Kwal_27.12667 s27 complement(1325822..1327987) [2166 bp, 721 aa]...    40   0.011
Kwal_55.21450 s55 (842483..843994) [1512 bp, 503 aa] {ON} YDR364...    40   0.012
NCAS0A05520 Chr1 complement(1085200..1087215) [2016 bp, 671 aa] ...    40   0.013
Kwal_26.8700 s26 (902915..904060) [1146 bp, 381 aa] {ON} YOR229W...    39   0.013
KLTH0A07282g Chr1 complement(604949..607126) [2178 bp, 725 aa] {...    39   0.014
NDAI0K02350 Chr11 complement(524551..526932) [2382 bp, 793 aa] {...    39   0.015
KLTH0E09394g Chr5 complement(853592..855160) [1569 bp, 522 aa] {...    39   0.016
Skud_2.229 Chr2 (415869..417506) [1638 bp, 545 aa] {ON} YBR103W ...    39   0.016
TPHA0G01840 Chr7 complement(379782..381077) [1296 bp, 431 aa] {O...    39   0.018
ZYRO0D01122g Chr4 complement(86927..88327) [1401 bp, 466 aa] {ON...    39   0.018
Kpol_1014.19 s1014 complement(30466..31824) [1359 bp, 452 aa] {O...    39   0.018
Suva_13.311 Chr13 complement(511812..513344) [1533 bp, 510 aa] {...    39   0.018
KLTH0F19338g Chr6 (1564555..1568427) [3873 bp, 1290 aa] {ON} sim...    39   0.019
YER107C Chr5 complement(373448..374545) [1098 bp, 365 aa] {ON}  ...    39   0.020
TBLA0B08730 Chr2 complement(2077729..2079114) [1386 bp, 461 aa] ...    39   0.020
Smik_12.279 Chr12 complement(526367..528820) [2454 bp, 817 aa] {...    39   0.023
Ecym_7042 Chr7 (86859..88103) [1245 bp, 414 aa] {ON} similar to ...    39   0.024
YLR222C Chr12 complement(579318..581771) [2454 bp, 817 aa] {ON} ...    39   0.024
Kpol_1031.36 s1031 complement(87105..89225) [2121 bp, 706 aa] {O...    39   0.025
CAGL0L00781g Chr12 (97503..99524) [2022 bp, 673 aa] {ON} similar...    39   0.025
Ecym_2024 Chr2 complement(35886..39839) [3954 bp, 1317 aa] {ON} ...    39   0.026
ADL186C Chr4 complement(369320..373405) [4086 bp, 1361 aa] {ON} ...    39   0.027
TBLA0G01490 Chr7 (389958..392156) [2199 bp, 732 aa] {ON} Anc_4.1...    39   0.029
NCAS0E03750 Chr5 complement(736672..740502) [3831 bp, 1276 aa] {...    39   0.029
TPHA0E01790 Chr5 (359679..361004) [1326 bp, 441 aa] {ON} Anc_5.4...    38   0.030
Skud_12.285 Chr12 complement(525831..528284) [2454 bp, 817 aa] {...    39   0.031
KLTH0D05346g Chr4 complement(475917..477440) [1524 bp, 507 aa] {...    38   0.032
KLTH0E15576g Chr5 complement(1384027..1386198) [2172 bp, 723 aa]...    38   0.034
KLLA0F21406g Chr6 complement(1996260..1998377) [2118 bp, 705 aa]...    38   0.035
SAKL0D04796g Chr4 (372598..374907) [2310 bp, 769 aa] {ON} simila...    38   0.035
ZYRO0B10450g Chr2 complement(825240..826688) [1449 bp, 482 aa] {...    38   0.038
AAR057W Chr1 (442821..445589) [2769 bp, 922 aa] {ON} Syntenic ho...    38   0.038
TBLA0F04240 Chr6 (1043577..1045760) [2184 bp, 727 aa] {ON} Anc_6...    38   0.038
Suva_6.187 Chr6 complement(344709..346853) [2145 bp, 714 aa] {ON...    38   0.039
Skud_11.271 Chr11 complement(490869..492809) [1941 bp, 646 aa] {...    38   0.040
KLLA0C08976g Chr3 (784536..787271) [2736 bp, 911 aa] {ON} highly...    38   0.044
Suva_4.348 Chr4 (616802..618448) [1647 bp, 548 aa] {ON} YBR103W ...    38   0.044
KLLA0E21187g Chr5 (1892524..1893813) [1290 bp, 429 aa] {ON} simi...    38   0.044
KLLA0F19734g Chr6 (1826828..1830229) [3402 bp, 1133 aa] {ON} sim...    38   0.044
KLLA0F17237g Chr6 (1577197..1578768) [1572 bp, 523 aa] {ON} high...    38   0.045
TDEL0G03340 Chr7 (618276..619820) [1545 bp, 514 aa] {ON} Anc_2.4...    38   0.046
SAKL0F15972g Chr6 (1291625..1293037) [1413 bp, 470 aa] {ON} simi...    37   0.053
NCAS0A09610 Chr1 complement(1920171..1922258) [2088 bp, 695 aa] ...    37   0.060
KLTH0F19294g Chr6 complement(1560167..1561522) [1356 bp, 451 aa]...    37   0.060
YLL011W Chr12 (127523..128992) [1470 bp, 489 aa] {ON}  SOF1Essen...    37   0.063
ADR242C Chr4 complement(1126441..1128006) [1566 bp, 521 aa] {ON}...    37   0.066
KLLA0E20967g Chr5 (1872227..1876192) [3966 bp, 1321 aa] {ON} sim...    37   0.069
TPHA0B01120 Chr2 (254017..256176) [2160 bp, 719 aa] {ON} Anc_1.2...    37   0.071
AGR180W Chr7 (1090641..1093061) [2421 bp, 806 aa] {ON} Syntenic ...    37   0.071
CAGL0A00561g Chr1 complement(63710..64948) [1239 bp, 412 aa] {ON...    37   0.074
Ecym_8090 Chr8 (194643..196793) [2151 bp, 716 aa] {ON} similar t...    37   0.074
ZYRO0G02618g Chr7 (201987..204629) [2643 bp, 880 aa] {ON} simila...    37   0.074
Kpol_1018.103 s1018 complement(268887..269966) [1080 bp, 359 aa]...    37   0.078
SAKL0A00660g Chr1 (71855..73837) [1983 bp, 660 aa] {ON} some sim...    37   0.080
Suva_16.510 Chr16 (874866..876263) [1398 bp, 465 aa] {ON} YPR178...    37   0.080
TBLA0B04680 Chr2 complement(1095348..1099997) [4650 bp, 1549 aa]...    37   0.082
Kwal_47.17827 s47 complement(570622..572193) [1572 bp, 523 aa] {...    37   0.083
CAGL0K03861g Chr11 complement(360277..361818) [1542 bp, 513 aa] ...    37   0.083
Smik_14.14 Chr14 (25114..26514) [1401 bp, 466 aa] {ON} YNL317W (...    37   0.084
YBR103W Chr2 (447709..449316) [1608 bp, 535 aa] {ON}  SIF2WD40 r...    37   0.084
ZYRO0D17292g Chr4 complement(1424965..1427121) [2157 bp, 718 aa]...    37   0.094
Kwal_55.22067 s55 complement(1094600..1095955) [1356 bp, 451 aa]...    37   0.10 
Kpol_1041.35 s1041 complement(87507..89612) [2106 bp, 701 aa] {O...    37   0.10 
CAGL0B01529g Chr2 (137174..138283) [1110 bp, 369 aa] {ON} highly...    37   0.10 
Skud_12.56 Chr12 (118914..120383) [1470 bp, 489 aa] {ON} YLL011W...    37   0.11 
ACR097W Chr3 (529784..531187) [1404 bp, 467 aa] {ON} Syntenic ho...    37   0.11 
KAFR0A03380 Chr1 (690272..692272) [2001 bp, 666 aa] {ON} Anc_1.2...    37   0.11 
KNAG0I01050 Chr9 complement(200338..203817) [3480 bp, 1159 aa] {...    37   0.11 
Suva_14.22 Chr14 (36853..38262) [1410 bp, 469 aa] {ON} YNL317W (...    37   0.11 
ZYRO0D06556g Chr4 complement(564778..568221) [3444 bp, 1147 aa] ...    37   0.11 
KNAG0C03490 Chr3 (684848..685936) [1089 bp, 362 aa] {ON} Anc_7.4...    36   0.12 
KAFR0A06990 Chr1 complement(1405904..1408543,1408655..1408672) [...    37   0.12 
AEL314W Chr5 (52978..55125) [2148 bp, 715 aa] {ON} Syntenic homo...    37   0.12 
SAKL0A03872g Chr1 (361507..361524,361720..364338) [2637 bp, 878 ...    37   0.12 
CAGL0K09284g Chr11 (915766..918501) [2736 bp, 911 aa] {ON} highl...    37   0.12 
CAGL0K03377g Chr11 complement(307358..310294) [2937 bp, 978 aa] ...    37   0.13 
Skud_14.22 Chr14 (34087..35490) [1404 bp, 467 aa] {ON} YNL317W (...    36   0.13 
Kwal_56.24399 s56 (981153..982262) [1110 bp, 369 aa] {ON} [conti...    36   0.13 
TBLA0D04870 Chr4 complement(1194448..1195431) [984 bp, 327 aa] {...    36   0.13 
TPHA0A00380 Chr1 complement(55881..59813) [3933 bp, 1310 aa] {ON...    36   0.14 
TPHA0L02130 Chr12 complement(441224..445750) [4527 bp, 1508 aa] ...    36   0.15 
YJL112W Chr10 (205305..207449) [2145 bp, 714 aa] {ON}  MDV1Perip...    36   0.15 
Skud_7.561 Chr7 (920014..921196,921300..921898) [1782 bp, 593 aa...    36   0.15 
Kpol_2001.65 s2001 (178299..181919) [3621 bp, 1206 aa] {ON} (178...    36   0.16 
TPHA0C01150 Chr3 (263944..266007) [2064 bp, 687 aa] {ON} Anc_7.2...    36   0.16 
TDEL0A07550 Chr1 complement(1314676..1316223) [1548 bp, 515 aa] ...    36   0.16 
TPHA0D03830 Chr4 complement(802754..805492) [2739 bp, 912 aa] {O...    36   0.17 
TPHA0L01080 Chr12 (226790..229297) [2508 bp, 835 aa] {ON} Anc_8....    36   0.17 
SAKL0H09900g Chr8 complement(847975..849252) [1278 bp, 425 aa] {...    36   0.17 
Kwal_26.7736 s26 complement(491687..493210) [1524 bp, 507 aa] {O...    36   0.17 
TPHA0D04500 Chr4 (978756..982382) [3627 bp, 1208 aa] {ON} Anc_7....    36   0.18 
Suva_5.228 Chr5 complement(347755..348852) [1098 bp, 365 aa] {ON...    36   0.18 
YMR131C Chr13 complement(533163..534698) [1536 bp, 511 aa] {ON} ...    36   0.18 
KAFR0I01880 Chr9 (386694..388469) [1776 bp, 591 aa] {ON} Anc_7.2...    36   0.18 
Smik_2.243 Chr2 (432627..434252) [1626 bp, 541 aa] {ON} YBR103W ...    36   0.18 
ABL024W Chr2 (353682..355886) [2205 bp, 734 aa] {ON} Syntenic ho...    36   0.18 
YDL139C Chr4 complement(211375..212046) [672 bp, 223 aa] {ON}  S...    35   0.18 
Skud_5.232 Chr5 complement(369506..370603) [1098 bp, 365 aa] {ON...    35   0.19 
Ecym_4255 Chr4 (529455..532268) [2814 bp, 937 aa] {ON} similar t...    36   0.19 
Smik_13.329 Chr13 complement(515612..517141) [1530 bp, 509 aa] {...    36   0.19 
TPHA0F00520 Chr6 (121962..124103) [2142 bp, 713 aa] {ON} Anc_4.7...    36   0.19 
SAKL0A01738g Chr1 (157360..160089) [2730 bp, 909 aa] {ON} highly...    36   0.20 
KAFR0I02840 Chr9 complement(570039..571409) [1371 bp, 456 aa] {O...    35   0.20 
Skud_4.109 Chr4 complement(190191..193796) [3606 bp, 1201 aa] {O...    36   0.20 
NCAS0F01450 Chr6 complement(287070..289796) [2727 bp, 908 aa] {O...    36   0.20 
NDAI0A03310 Chr1 (750920..753373) [2454 bp, 817 aa] {ON} Anc_4.106     36   0.20 
KNAG0A03670 Chr1 complement(472849..474129) [1281 bp, 426 aa] {O...    35   0.21 
Smik_4.90 Chr4 complement(171469..175074) [3606 bp, 1201 aa] {ON...    36   0.21 
Kpol_1038.20 s1038 complement(43719..47660) [3942 bp, 1313 aa] {...    36   0.22 
ZYRO0G10406g Chr7 complement(839502..840677) [1176 bp, 391 aa] {...    35   0.22 
NCAS0F00190 Chr6 complement(29012..30247) [1236 bp, 411 aa] {ON}...    35   0.23 
YDL145C Chr4 complement(194571..198176) [3606 bp, 1201 aa] {ON} ...    36   0.23 
Suva_4.99 Chr4 complement(182425..186030) [3606 bp, 1201 aa] {ON...    35   0.26 
Kwal_56.24163 s56 complement(879667..881856) [2190 bp, 729 aa] {...    35   0.26 
ZYRO0E07392g Chr5 complement(564166..566841,567011..567028) [269...    35   0.27 
Skud_13.291 Chr13 complement(506764..508293) [1530 bp, 509 aa] {...    35   0.27 
NDAI0A02090 Chr1 complement(466744..470346) [3603 bp, 1200 aa] {...    35   0.28 
Kpol_1045.33 s1045 (77282..78367) [1086 bp, 361 aa] {ON} (77284....    35   0.28 
YCR057C Chr3 complement(220457..223228) [2772 bp, 923 aa] {ON}  ...    35   0.28 
Suva_3.93 Chr3 complement(133524..136286) [2763 bp, 920 aa] {ON}...    35   0.29 
Kwal_47.17310 s47 (345235..346896) [1662 bp, 553 aa] {ON} YER124...    35   0.29 
Ecym_6067 Chr6 (124870..126438) [1569 bp, 522 aa] {ON} similar t...    35   0.30 
TBLA0B09250 Chr2 (2194005..2195585) [1581 bp, 526 aa] {ON} Anc_2...    35   0.30 
Smik_5.253 Chr5 complement(382390..383487) [1098 bp, 365 aa] {ON...    35   0.30 
TDEL0E05480 Chr5 complement(1002913..1005540,1005640..1005657) [...    35   0.30 
Kpol_1028.41 s1028 (100720..102258) [1539 bp, 512 aa] {ON} (1007...    35   0.31 
AFL118W Chr6 (216252..216269,216423..218903) [2499 bp, 832 aa] {...    35   0.31 
SAKL0E03520g Chr5 complement(283754..286654) [2901 bp, 966 aa] {...    35   0.31 
YNL317W Chr14 (40619..42016) [1398 bp, 465 aa] {ON}  PFS2Integra...    35   0.31 
Smik_15.16 Chr15 complement(29410..33390) [3981 bp, 1326 aa] {ON...    35   0.31 
KLTH0D11132g Chr4 (910259..911572) [1314 bp, 437 aa] {ON} simila...    35   0.32 
ZYRO0F05808g Chr6 complement(479060..482908) [3849 bp, 1282 aa] ...    35   0.32 
Ecym_3481 Chr3 complement(897444..898958) [1515 bp, 504 aa] {ON}...    35   0.33 
Smik_16.106 Chr16 (194195..196564) [2370 bp, 789 aa] {ON} YGR200...    35   0.33 
Suva_16.60 Chr16 complement(91552..93132) [1581 bp, 526 aa] {ON}...    35   0.33 
Ecym_6228 Chr6 (425765..427102) [1338 bp, 445 aa] {ON} similar t...    35   0.34 
Smik_3.157 Chr3 complement(218522..221296) [2775 bp, 924 aa] {ON...    35   0.35 
TDEL0A06890 Chr1 (1202790..1204133) [1344 bp, 447 aa] {ON} Anc_6...    35   0.36 
NDAI0E01500 Chr5 complement(295871..297157) [1287 bp, 428 aa] {O...    35   0.37 
Ecym_7105 Chr7 complement(205465..206919) [1455 bp, 484 aa] {ON}...    35   0.38 
SAKL0G19536g Chr7 complement(1683650..1684636) [987 bp, 328 aa] ...    35   0.39 
NCAS0A01850 Chr1 complement(356138..358243) [2106 bp, 701 aa] {O...    35   0.40 
Skud_10.102 Chr10 (173179..175305) [2127 bp, 708 aa] {ON} YJL112...    35   0.41 
YCR084C Chr3 complement(260311..262452) [2142 bp, 713 aa] {ON}  ...    35   0.42 
Kpol_1013.37 s1013 complement(88637..88936,88986..88994,89037..9...    35   0.43 
KAFR0F02590 Chr6 complement(504740..506842) [2103 bp, 700 aa] {O...    35   0.45 
YBR097W Chr2 (436951..441315) [4365 bp, 1454 aa] {ON}  VPS15Myri...    35   0.45 
NDAI0I02180 Chr9 complement(499955..501394) [1440 bp, 479 aa] {O...    35   0.46 
TDEL0C02360 Chr3 (412482..416276) [3795 bp, 1264 aa] {ON} Anc_7....    35   0.46 
Skud_3.133 Chr3 complement(204741..207488) [2748 bp, 916 aa] {ON...    35   0.47 
NCAS0A13940 Chr1 (2740150..2743767) [3618 bp, 1205 aa] {ON} Anc_...    35   0.47 
Kwal_27.12239 s27 complement(1143763..1144713) [951 bp, 316 aa] ...    34   0.47 
NCAS0G01120 Chr7 complement(199561..201045) [1485 bp, 494 aa] {O...    34   0.47 
KLTH0H03608g Chr8 (327747..327764,327941..330550) [2628 bp, 875 ...    35   0.48 
TDEL0G01280 Chr7 complement(258957..259555,259626..260934) [1908...    35   0.48 
TPHA0L01690 Chr12 (355859..358357) [2499 bp, 832 aa] {ON} Anc_8....    35   0.49 
YHR186C Chr8 complement(475999..480672) [4674 bp, 1557 aa] {ON} ...    35   0.49 
ZYRO0G03146g Chr7 complement(238354..239886) [1533 bp, 510 aa] {...    34   0.50 
Ecym_4280 Chr4 complement(600066..603464) [3399 bp, 1132 aa] {ON...    35   0.51 
Suva_4.53 Chr4 (95619..99434) [3816 bp, 1271 aa] {ON} YDL195W (R...    35   0.51 
NCAS0D04480 Chr4 complement(851440..854187) [2748 bp, 915 aa] {O...    34   0.56 
TBLA0B04390 Chr2 (1014987..1015997) [1011 bp, 336 aa] {ON} Anc_8...    34   0.56 
Kwal_27.10785 s27 (495263..496366) [1104 bp, 367 aa] {ON} YER107...    34   0.56 
Kwal_14.906 s14 (105782..106768) [987 bp, 328 aa] {ON} YKL018W (...    34   0.57 
TDEL0C02240 Chr3 complement(388060..391665) [3606 bp, 1201 aa] {...    34   0.58 
Kwal_56.22345 s56 complement(58523..59713) [1191 bp, 396 aa] {ON...    34   0.60 
Skud_7.467 Chr7 (764555..766681) [2127 bp, 708 aa] {ON} YGR145W ...    34   0.60 
AEL246C Chr5 complement(172849..175296) [2448 bp, 815 aa] {ON} S...    34   0.64 
Skud_3.156 Chr3 complement(244873..247014) [2142 bp, 713 aa] {ON...    34   0.65 
ADR077C Chr4 complement(843169..846783) [3615 bp, 1204 aa] {ON} ...    34   0.68 
Suva_3.121 Chr3 complement(177765..179864) [2100 bp, 700 aa] {ON...    34   0.72 
KLLA0A08866g Chr1 (776960..778231) [1272 bp, 423 aa] {ON} simila...    34   0.74 
TPHA0J02540 Chr10 complement(561110..563710) [2601 bp, 866 aa] {...    34   0.76 
NDAI0G03830 Chr7 (919944..921476) [1533 bp, 510 aa] {ON} Anc_3.25      34   0.78 
Smik_3.183 Chr3 complement(259959..262088) [2130 bp, 709 aa] {ON...    34   0.79 
KNAG0B02720 Chr2 complement(523885..527499) [3615 bp, 1204 aa] {...    34   0.79 
KAFR0G01970 Chr7 complement(414143..415420) [1278 bp, 425 aa] {O...    33   0.82 
Suva_7.518 Chr7 (899625..900807,900908..901506) [1782 bp, 593 aa...    33   0.87 
KLTH0E13552g Chr5 complement(1202406..1203356) [951 bp, 316 aa] ...    33   0.88 
Skud_2.321 Chr2 complement(577912..579180) [1269 bp, 422 aa] {ON...    33   0.88 
KLTH0A02750g Chr1 complement(239284..241545) [2262 bp, 753 aa] {...    34   0.89 
Suva_7.519 Chr7 (900889..901503) [615 bp, 205 aa] {ON} YGR225W (...    33   0.90 
YGR200C Chr7 complement(899904..902270) [2367 bp, 788 aa] {ON}  ...    34   0.90 
KLTH0D10186g Chr4 (845352..846617) [1266 bp, 421 aa] {ON} simila...    33   0.99 
Smik_12.52 Chr12 (114649..116118) [1470 bp, 489 aa] {ON} YLL011W...    33   0.99 
KAFR0B05580 Chr2 (1142731..1146093) [3363 bp, 1120 aa] {ON} Anc_...    33   0.99 
Skud_4.63 Chr4 (104587..108408) [3822 bp, 1273 aa] {ON} YDL195W ...    33   1.0  
Kwal_56.23685 s56 complement(656691..659999) [3309 bp, 1102 aa] ...    33   1.0  
TDEL0C02650 Chr3 complement(460884..461978) [1095 bp, 364 aa] {O...    33   1.0  
Smik_7.135 Chr7 (244035..244445,244446..246698) [2664 bp, 887 aa...    33   1.1  
CAGL0L02761g Chr12 complement(322823..324082) [1260 bp, 419 aa] ...    33   1.1  
Skud_13.261 Chr13 complement(445193..447697) [2505 bp, 834 aa] {...    33   1.1  
Smik_16.79 Chr16 complement(149712..150310,150409..151591) [1782...    33   1.1  
YGL137W Chr7 (249869..249886,250087..252738) [2670 bp, 889 aa] {...    33   1.1  
KAFR0A00690 Chr1 complement(124349..125875) [1527 bp, 508 aa] {O...    33   1.1  
KAFR0F03630 Chr6 complement(718854..720935) [2082 bp, 693 aa] {O...    33   1.1  
Kwal_23.6240 s23 complement(1503990..1506731) [2742 bp, 913 aa] ...    33   1.1  
Smik_10.126 Chr10 (196821..198959) [2139 bp, 712 aa] {ON} YJL112...    33   1.1  
YMR102C Chr13 complement(469848..472352) [2505 bp, 834 aa] {ON} ...    33   1.2  
Smik_8.275 Chr8 complement(450898..455568) [4671 bp, 1556 aa] {O...    33   1.2  
Smik_14.235 Chr14 (431155..432357) [1203 bp, 400 aa] {ON} YNL092...    33   1.2  
Smik_13.289 Chr13 complement(454351..456864) [2514 bp, 837 aa] {...    33   1.2  
KAFR0E01230 Chr5 complement(247314..248423) [1110 bp, 369 aa] {O...    33   1.2  
TBLA0H00230 Chr8 complement(31016..35017) [4002 bp, 1333 aa] {ON...    33   1.2  
Suva_13.280 Chr13 complement(451520..454051) [2532 bp, 843 aa] {...    33   1.3  
TPHA0E03080 Chr5 complement(646691..648157) [1467 bp, 488 aa] {O...    33   1.3  
KLLA0A04653g Chr1 complement(417313..419415) [2103 bp, 700 aa] {...    33   1.3  
KAFR0I02860 Chr9 (573406..577503) [4098 bp, 1365 aa] {ON} Anc_3....    33   1.3  
YGR225W Chr7 (945145..946327,946421..947019) [1782 bp, 593 aa] {...    33   1.3  
Ecym_2401 Chr2 complement(781043..782323) [1281 bp, 426 aa] {ON}...    33   1.3  
ZYRO0B03652g Chr2 complement(301728..302804) [1077 bp, 358 aa] {...    33   1.3  
TBLA0A02310 Chr1 (557822..559417) [1596 bp, 531 aa] {ON} Anc_6.2...    33   1.3  
ZYRO0F09372g Chr6 (761606..762952) [1347 bp, 448 aa] {ON} highly...    33   1.4  
CAGL0D05588g Chr4 (533235..534668) [1434 bp, 477 aa] {ON} highly...    33   1.4  
NDAI0B05190 Chr2 complement(1269217..1271223) [2007 bp, 668 aa] ...    33   1.4  
NCAS0C05310 Chr3 complement(1079501..1080550) [1050 bp, 349 aa] ...    33   1.4  
TDEL0F04150 Chr6 (765748..769152) [3405 bp, 1134 aa] {ON} Anc_8....    33   1.4  
Skud_16.32 Chr16 complement(56168..57736) [1569 bp, 522 aa] {ON}...    33   1.5  
NDAI0F01240 Chr6 complement(302631..304205) [1575 bp, 524 aa] {O...    33   1.5  
Suva_2.29 Chr2 complement(47586..55955) [8370 bp, 2789 aa] {ON} ...    33   1.5  
ZYRO0D08558g Chr4 (736975..739713) [2739 bp, 912 aa] {ON} highly...    33   1.5  
YOR272W Chr15 (832813..834195) [1383 bp, 460 aa] {ON}  YTM1Const...    33   1.6  
AGL301C Chr7 complement(137221..138306) [1086 bp, 361 aa] {ON} S...    33   1.6  
Kpol_2000.39 s2000 complement(76168..77499) [1332 bp, 443 aa] {O...    33   1.6  
KNAG0M01750 Chr13 complement(323446..324903) [1458 bp, 485 aa] {...    33   1.6  
Skud_15.16 Chr15 complement(26552..30550) [3999 bp, 1332 aa] {ON...    33   1.6  
ZYRO0D07744g Chr4 (674077..678654) [4578 bp, 1525 aa] {ON} simil...    33   1.7  
NDAI0H02330 Chr8 complement(564240..567221) [2982 bp, 993 aa] {O...    33   1.7  
TPHA0I01880 Chr9 complement(418620..421724) [3105 bp, 1034 aa] {...    33   1.7  
Smik_6.451 Chr6 (740074..741645) [1572 bp, 523 aa] {ON} YPL247C ...    33   1.7  
ZYRO0C03124g Chr3 complement(240321..241658) [1338 bp, 445 aa] {...    33   1.7  
KAFR0A00380 Chr1 (70400..71950) [1551 bp, 516 aa] {ON} Anc_2.401...    33   1.8  
Smik_4.45 Chr4 (85422..89234) [3813 bp, 1270 aa] {ON} YDL195W (R...    33   1.8  
Suva_10.64 Chr10 (132461..133933) [1473 bp, 490 aa] {ON} YLL011W...    33   1.8  
Kwal_23.5035 s23 (975572..977806) [2235 bp, 744 aa] {ON} YFL009W...    33   1.8  
Suva_15.22 Chr15 complement(39171..43181) [4011 bp, 1336 aa] {ON...    33   1.8  
Suva_2.291 Chr2 (504722..508177) [3456 bp, 1151 aa] {ON} YDR128W...    33   1.8  
Suva_4.449 Chr4 complement(780822..782096) [1275 bp, 424 aa] {ON...    32   1.9  
CAGL0K00957g Chr11 (95657..98038) [2382 bp, 793 aa] {ON} similar...    33   1.9  
Kwal_26.7655 s26 complement(460957..463188) [2232 bp, 743 aa] {O...    33   1.9  
CAGL0E01485g Chr5 complement(139067..143077) [4011 bp, 1336 aa] ...    33   1.9  
YGR145W Chr7 (781767..783890) [2124 bp, 707 aa] {ON}  ENP2Essent...    33   1.9  
NCAS0A14470 Chr1 complement(2848835..2849923) [1089 bp, 362 aa] ...    32   1.9  
KNAG0H00220 Chr8 (32961..33944) [984 bp, 327 aa] {ON} Anc_2.657 ...    32   1.9  
TPHA0G02500 Chr7 (515975..518812) [2838 bp, 945 aa] {ON} Anc_2.4...    33   2.0  
KNAG0E02470 Chr5 (490378..491907) [1530 bp, 509 aa] {ON} Anc_2.4...    32   2.0  
TDEL0A05770 Chr1 (1018340..1019641) [1302 bp, 433 aa] {ON} Anc_8...    32   2.0  
NDAI0G03310 Chr7 complement(777538..780195) [2658 bp, 885 aa] {O...    33   2.0  
KLTH0E08162g Chr5 complement(749584..751254) [1671 bp, 556 aa] {...    32   2.0  
Kpol_1064.35 s1064 (64223..65584) [1362 bp, 453 aa] {ON} (64223....    32   2.1  
ZYRO0A12980g Chr1 (1025863..1028337) [2475 bp, 824 aa] {ON} simi...    33   2.1  
Suva_7.435 Chr7 (752189..754315) [2127 bp, 708 aa] {ON} YGR145W ...    32   2.1  
KNAG0F01840 Chr6 (348492..351227) [2736 bp, 911 aa] {ON} Anc_6.2...    33   2.1  
ACR137W Chr3 (590077..591354) [1278 bp, 425 aa] {ON} Syntenic ho...    32   2.2  
Skud_8.252 Chr8 complement(444916..449586) [4671 bp, 1556 aa] {O...    33   2.2  
AAL157C Chr1 complement(70077..71516) [1440 bp, 479 aa] {ON} Syn...    32   2.2  
AFL014C Chr6 complement(409496..411169) [1674 bp, 557 aa] {ON} S...    32   2.3  
Kwal_56.23920 s56 (776647..779460) [2814 bp, 937 aa] {ON} YLR129...    32   2.4  
KLTH0H09130g Chr8 (783260..785347) [2088 bp, 695 aa] {ON} simila...    32   2.4  
SAKL0H07656g Chr8 complement(659189..660469) [1281 bp, 426 aa] {...    32   2.4  
KAFR0J00980 Chr10 (176984..178426) [1443 bp, 480 aa] {ON} Anc_5....    32   2.4  
TBLA0A06060 Chr1 (1493832..1493849,1494107..1496755) [2667 bp, 8...    32   2.6  
KAFR0H02260 Chr8 complement(430272..433088) [2817 bp, 938 aa] {O...    32   2.6  
CAGL0K11836g Chr11 complement(1143042..1144610) [1569 bp, 522 aa...    32   2.6  
TDEL0A02450 Chr1 complement(437732..439264) [1533 bp, 510 aa] {O...    32   2.6  
Suva_15.389 Chr15 complement(680068..684735) [4668 bp, 1555 aa] ...    32   2.6  
CAGL0I03718g Chr9 complement(317565..321170) [3606 bp, 1201 aa] ...    32   2.7  
Kpol_1002.36 s1002 (110010..112229) [2220 bp, 739 aa] {ON} (1100...    32   2.7  
Kwal_33.15475 s33 complement(1123396..1125747) [2352 bp, 783 aa]...    32   2.7  
Suva_7.127 Chr7 (246249..246659,246660..248924) [2676 bp, 891 aa...    32   2.7  
KAFR0F03340 Chr6 (656751..657980) [1230 bp, 409 aa] {ON} Anc_4.1...    32   2.7  
KNAG0D03460 Chr4 (622817..624055) [1239 bp, 412 aa] {ON} Anc_4.1...    32   2.7  
NDAI0J00330 Chr10 (54580..55998) [1419 bp, 472 aa] {ON} Anc_7.534      32   2.7  
NCAS0I02490 Chr9 complement(465916..467796) [1881 bp, 626 aa] {O...    32   2.7  
SAKL0H09988g Chr8 complement(853060..855309) [2250 bp, 749 aa] {...    32   2.9  
TBLA0C03990 Chr3 (960225..961538) [1314 bp, 437 aa] {ON} Anc_4.1...    32   2.9  
TPHA0D00580 Chr4 (100671..102869) [2199 bp, 732 aa] {ON} Anc_8.6...    32   2.9  
TDEL0A00410 Chr1 complement(70940..74728) [3789 bp, 1262 aa] {ON...    32   3.0  
TBLA0I02570 Chr9 (597481..600027) [2547 bp, 848 aa] {ON} Anc_8.7...    32   3.0  
KLTH0D04466g Chr4 (413024..413560,413816..414238) [960 bp, 319 a...    32   3.0  
Kwal_26.7570 s26 (423448..424104) [657 bp, 218 aa] {ON} YMR116C ...    31   3.0  
TPHA0G02940 Chr7 (631081..633837) [2757 bp, 918 aa] {ON} Anc_2.4...    32   3.0  
CAGL0M13409g Chr13 complement(1317818..1322401) [4584 bp, 1527 a...    32   3.1  
NCAS0A07860 Chr1 (1563830..1565362) [1533 bp, 510 aa] {ON} Anc_2...    32   3.1  
KLTH0D04950g Chr4 complement(449060..451402) [2343 bp, 780 aa] {...    32   3.1  
TDEL0B03020 Chr2 complement(534847..537342) [2496 bp, 831 aa] {O...    32   3.1  
SAKL0H07150g Chr8 complement(626019..627341,627428..627430) [132...    32   3.1  
KLTH0H02134g Chr8 (191540..195439) [3900 bp, 1299 aa] {ON} simil...    32   3.2  
SAKL0H08932g Chr8 (763703..764647) [945 bp, 314 aa] {ON} similar...    32   3.2  
Kwal_27.11585 s27 (859952..862423) [2472 bp, 823 aa] {ON} YLR222...    32   3.2  
Suva_5.178 Chr5 (266333..267301) [969 bp, 322 aa] {ON} YFL009W (...    32   3.3  
Suva_7.494 Chr7 complement(856266..858641) [2376 bp, 791 aa] {ON...    32   3.3  
KLTH0C01848g Chr3 complement(165526..166121,166518..167517) [159...    32   3.3  
NCAS0B03690 Chr2 complement(657488..660925) [3438 bp, 1145 aa] {...    32   3.4  
TDEL0B02010 Chr2 complement(355418..357835) [2418 bp, 805 aa] {O...    32   3.4  
TBLA0F02230 Chr6 (551746..555396) [3651 bp, 1216 aa] {ON} Anc_7....    32   3.5  
YGL003C Chr7 complement(492474..494174) [1701 bp, 566 aa] {ON}  ...    32   3.6  
NCAS0D02730 Chr4 (523453..524880) [1428 bp, 475 aa] {ON} Anc_5.201     32   3.6  
Skud_7.135 Chr7 (254246..254263,254479..257154) [2694 bp, 897 aa...    32   3.6  
Ecym_5528 Chr5 complement(1070598..1072013) [1416 bp, 471 aa] {O...    32   3.6  
TBLA0B03570 Chr2 complement(828308..829684) [1377 bp, 458 aa] {O...    32   3.6  
TPHA0I01180 Chr9 (274330..276999) [2670 bp, 889 aa] {ON} Anc_1.3...    32   3.7  
TBLA0A03950 Chr1 (986923..989733) [2811 bp, 936 aa] {ON} Anc_8.3...    32   3.9  
KLLA0E18063g Chr5 (1608371..1609351) [981 bp, 326 aa] {ON} highl...    31   3.9  
KLLA0D02530g Chr4 complement(212703..214826) [2124 bp, 707 aa] {...    32   3.9  
YPL247C Chr16 complement(82625..84196) [1572 bp, 523 aa] {ON} Pu...    32   3.9  
Ecym_4134 Chr4 complement(280146..282578) [2433 bp, 810 aa] {ON}...    32   3.9  
Kwal_47.17567 s47 complement(459443..461215) [1773 bp, 590 aa] {...    32   4.0  
YDR128W Chr4 (709549..712995) [3447 bp, 1148 aa] {ON}  MTC5Subun...    32   4.0  
NCAS0C04430 Chr3 complement(905927..909862) [3936 bp, 1311 aa] {...    32   4.0  
Ecym_7403 Chr7 (829923..831476) [1554 bp, 517 aa] {ON} similar t...    32   4.1  
TDEL0B07520 Chr2 complement(1320439..1321422) [984 bp, 327 aa] {...    31   4.1  
Kpol_1072.41 s1072 complement(90370..91632) [1263 bp, 420 aa] {O...    32   4.1  
Kwal_26.8975 s26 (1026741..1028078) [1338 bp, 445 aa] {ON} YOR27...    32   4.1  
KLTH0A04114g Chr1 complement(344618..346594) [1977 bp, 658 aa] {...    32   4.1  
SAKL0H22396g Chr8 complement(1949474..1951141) [1668 bp, 555 aa]...    32   4.2  
Smik_6.248 Chr6 (401099..403222) [2124 bp, 707 aa] {ON} YGR145W ...    32   4.2  
Smik_2.335 Chr2 complement(596903..598171) [1269 bp, 422 aa] {ON...    31   4.2  
NDAI0I00880 Chr9 complement(203097..205763) [2667 bp, 888 aa] {O...    32   4.2  
TPHA0F00770 Chr6 (175091..176986) [1896 bp, 631 aa] {ON} Anc_4.1...    32   4.3  
Skud_16.482 Chr16 (834842..836239) [1398 bp, 465 aa] {ON} YPR178...    31   4.4  
AER255C Chr5 complement(1107932..1109335) [1404 bp, 467 aa] {ON}...    31   4.4  
KNAG0A01230 Chr1 complement(17341..21306) [3966 bp, 1321 aa] {ON...    32   4.4  
SAKL0F12782g Chr6 complement(999031..1000134) [1104 bp, 367 aa] ...    31   4.5  
CAGL0L03201g Chr12 complement(368792..370531) [1740 bp, 579 aa] ...    32   4.5  
Kwal_27.12586 s27 (1290276..1291805) [1530 bp, 509 aa] {ON} YBR1...    31   4.6  
KAFR0E03900 Chr5 complement(771649..772968) [1320 bp, 439 aa] {O...    31   5.1  
KLLA0C07513g Chr3 complement(656060..657379) [1320 bp, 439 aa] {...    31   5.2  
NCAS0B07840 Chr2 complement(1486900..1488669) [1770 bp, 589 aa] ...    31   5.2  
KLLA0F15598g Chr6 (1439610..1441046) [1437 bp, 478 aa] {ON} high...    31   5.2  
TDEL0A07400 Chr1 complement(1292494..1295199) [2706 bp, 901 aa] ...    31   5.4  
Suva_6.51 Chr6 (88465..90756) [2292 bp, 763 aa] {ON} YFL009W (REAL)    31   5.4  
TBLA0F02140 Chr6 complement(526982..530884) [3903 bp, 1300 aa] {...    31   5.4  
NDAI0G02580 Chr7 complement(590030..592906) [2877 bp, 958 aa] {O...    31   5.4  
TPHA0F03650 Chr6 (793481..795703) [2223 bp, 740 aa] {ON} Anc_1.5...    31   5.5  
Suva_8.321 Chr8 (572329..573711) [1383 bp, 460 aa] {ON} YOR272W ...    31   5.5  
Skud_4.389 Chr4 (681326..684781) [3456 bp, 1151 aa] {ON} YDR128W...    31   5.6  
NDAI0G05340 Chr7 (1301733..1303889) [2157 bp, 718 aa] {ON} Anc_1...    31   5.6  
SAKL0G12892g Chr7 complement(1102157..1103587) [1431 bp, 476 aa]...    31   5.6  
KAFR0A04110 Chr1 (826618..828000) [1383 bp, 460 aa] {ON} Anc_8.7...    31   5.7  
SAKL0F10010g Chr6 (767640..768644) [1005 bp, 334 aa] {ON} simila...    31   5.7  
KAFR0H01750 Chr8 complement(322707..325058) [2352 bp, 783 aa] {O...    31   5.8  
KLTH0B03410g Chr2 complement(276115..277548) [1434 bp, 477 aa] {...    31   5.8  
TDEL0F02230 Chr6 (407699..409369) [1671 bp, 556 aa] {ON} Anc_4.1...    31   5.8  
YDL195W Chr4 (107208..111029) [3822 bp, 1273 aa] {ON}  SEC31Comp...    31   5.8  
CAGL0K00275g Chr11 complement(26129..28276) [2148 bp, 715 aa] {O...    31   5.9  
YOL138C Chr15 complement(61325..65350) [4026 bp, 1341 aa] {ON}  ...    31   5.9  
KNAG0G02450 Chr7 (557570..560398) [2829 bp, 942 aa] {ON} Anc_8.3...    31   5.9  
NCAS0A14030 Chr1 complement(2760841..2762415) [1575 bp, 524 aa] ...    31   6.0  
KAFR0L01320 Chr12 complement(244228..247950) [3723 bp, 1240 aa] ...    31   6.1  
NDAI0B02680 Chr2 (668741..670354) [1614 bp, 537 aa] {ON}               31   6.1  
Suva_4.427 Chr4 (751909..752856) [948 bp, 315 aa] {ON} YBR175W (...    31   6.1  
Kpol_1061.6 s1061 complement(19407..20762) [1356 bp, 451 aa] {ON...    31   6.1  
ZYRO0G09372g Chr7 (747001..749052) [2052 bp, 683 aa] {ON} simila...    31   6.1  
KLLA0E19515g Chr5 complement(1733708..1735426) [1719 bp, 572 aa]...    31   6.4  
Kpol_1072.17 s1072 complement(40550..41851) [1302 bp, 433 aa] {O...    31   6.5  
TDEL0A00440 Chr1 (78820..80175) [1356 bp, 451 aa] {ON} Anc_3.25 ...    31   6.5  
KNAG0D00740 Chr4 complement(115399..116913) [1515 bp, 504 aa] {O...    31   6.6  
KLTH0E15158g Chr5 (1346780..1348309) [1530 bp, 509 aa] {ON} simi...    31   6.6  
CAGL0E02805g Chr5 complement(265374..267896) [2523 bp, 840 aa] {...    31   6.8  
Kpol_1060.24 s1060 complement(61507..62967) [1461 bp, 486 aa] {O...    31   6.9  
TDEL0A02260 Chr1 (409508..412027) [2520 bp, 839 aa] {ON} Anc_2.4...    31   7.1  
SAKL0E03080g Chr5 (253338..254885) [1548 bp, 515 aa] {ON} highly...    31   7.1  
CAGL0A00605g Chr1 complement(67281..69203) [1923 bp, 640 aa] {ON...    31   7.1  
NCAS0F03340 Chr6 complement(675569..676915) [1347 bp, 448 aa] {O...    31   7.3  
KLTH0G12276g Chr7 complement(1042617..1045430) [2814 bp, 937 aa]...    31   7.3  
KLTH0G13068g Chr7 complement(1118964..1122269) [3306 bp, 1101 aa...    31   7.3  
KLTH0E10120g Chr5 (916575..919055) [2481 bp, 826 aa] {ON} highly...    31   7.4  
Ecym_7078 Chr7 complement(156495..157436) [942 bp, 313 aa] {ON} ...    30   7.4  
ZYRO0F14960g Chr6 complement(1228479..1229438) [960 bp, 319 aa] ...    30   7.5  
Kwal_33.15136 s33 (974095..975516) [1422 bp, 473 aa] {ON} YLL011...    30   7.6  
TBLA0B04070 Chr2 complement(930877..932130) [1254 bp, 417 aa] {O...    30   7.6  
KAFR0F01060 Chr6 complement(201465..203126) [1662 bp, 553 aa] {O...    31   7.6  
NCAS0B02170 Chr2 complement(354274..355518) [1245 bp, 414 aa] {O...    30   7.7  
SAKL0F10648g Chr6 (827399..831010) [3612 bp, 1203 aa] {ON} highl...    31   7.7  
Kpol_1011.6 s1011 complement(17489..19777) [2289 bp, 762 aa] {ON...    31   7.7  
NCAS0B05510 Chr2 complement(1038543..1040039) [1497 bp, 498 aa] ...    30   7.8  
NDAI0C05770 Chr3 complement(1328677..1329684) [1008 bp, 335 aa] ...    30   7.9  
AGR207C Chr7 complement(1146704..1147666) [963 bp, 320 aa] {ON} ...    30   7.9  
KLLA0B01958g Chr2 (170646..170663,170896..173550) [2673 bp, 890 ...    31   8.1  
NDAI0H02240 Chr8 complement(545073..546617) [1545 bp, 514 aa] {O...    30   8.2  
KNAG0I02840 Chr9 (554645..556204) [1560 bp, 519 aa] {ON} Anc_6.3...    30   8.3  
KAFR0B04210 Chr2 (874621..875803,875906..876507) [1785 bp, 594 a...    30   8.6  
NCAS0B02200 Chr2 complement(359080..361548) [2469 bp, 822 aa] {O...    30   8.7  
Smik_4.374 Chr4 (670748..674206) [3459 bp, 1152 aa] {ON} YDR128W...    30   8.8  
Skud_12.198 Chr12 (382439..385270) [2832 bp, 943 aa] {ON} YLR129...    30   9.0  
NDAI0E03440 Chr5 complement(735469..738042) [2574 bp, 857 aa] {O...    30   9.0  
NCAS0D04050 Chr4 (760598..762865) [2268 bp, 755 aa] {ON}               30   9.1  
Kpol_1032.61 s1032 (141357..143825) [2469 bp, 822 aa] {ON} (1413...    30   9.1  
YBR175W Chr2 (582408..583355) [948 bp, 315 aa] {ON}  SWD3Essenti...    30   9.4  
KAFR0A04080 Chr1 (820402..821889) [1488 bp, 495 aa] {ON} Anc_8.7...    30   9.9  
SAKL0H15532g Chr8 complement(1351712..1354537) [2826 bp, 941 aa]...    30   9.9  

>Smik_14.296 Chr14 complement(535060..536229) [1170 bp, 389 aa] {ON}
           YNL035C (REAL)
          Length = 389

 Score =  759 bits (1961), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/389 (94%), Positives = 369/389 (94%)

Query: 1   MASYSLVESNFFGSENWCLKLQPSYKHGLLTGLSNGEIRLLDWATCKSLQNIKASETAIN 60
           MASYSLVESNFFGSENWCLKLQPSYKHGLLTGLSNGEIRLLDWATCKSLQNIKASETAIN
Sbjct: 1   MASYSLVESNFFGSENWCLKLQPSYKHGLLTGLSNGEIRLLDWATCKSLQNIKASETAIN 60

Query: 61  DLKVIDSDFSAGHLVSSASIDAVKVFDIRTNSCIATIQNESNSPFLSLDSRHGLLACGTE 120
           DLKVIDSDFSAGHLVSSASIDAVKVFDIRTNSCIATIQNESNSPFLSLDSRHGLLACGTE
Sbjct: 61  DLKVIDSDFSAGHLVSSASIDAVKVFDIRTNSCIATIQNESNSPFLSLDSRHGLLACGTE 120

Query: 121 LQGIDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQ 180
           LQGIDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQ
Sbjct: 121 LQGIDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQ 180

Query: 181 DEEEDALHQVINYASIHSCGWLSPKRIYTLSHMETFAIHELNDKSDELREPQPLDFGDVR 240
           DEEEDALHQVINYASIHSCGWLSPKRIYTLSHMETFAIHELNDKSDELREPQPLDFGDVR
Sbjct: 181 DEEEDALHQVINYASIHSCGWLSPKRIYTLSHMETFAIHELNDKSDELREPQPLDFGDVR 240

Query: 241 KAWDCDYVVDIYPGLIATGKTQENAGELRLIPFKNEKIYTEKCFVIPHAHGDEVVRDIFI 300
           KAWDCDYVVDIYPGLIATGKTQENAGELRLIPFKNEKIYTEKCFVIPHAHGDEVVRDIFI
Sbjct: 241 KAWDCDYVVDIYPGLIATGKTQENAGELRLIPFKNEKIYTEKCFVIPHAHGDEVVRDIFI 300

Query: 301 SAHQSDMLYSCGEDGYVKIWKSTQGPLNTPETFWDYSEKMNVLGDDSKEAFTNLEEPLII 360
           SAHQSDMLYSCGEDGYVKIWKSTQGPLNTPETFWDYSEKMNVLGDDSKEAFTNLEEPLII
Sbjct: 301 SAHQSDMLYSCGEDGYVKIWKSTQGPLNTPETFWDYSEKMNVLGDDSKEAFTNLEEPLII 360

Query: 361 QKDLAXXXXXXXXXXXXXXXXXXXXFRPY 389
           QKDLA                    FRPY
Sbjct: 361 QKDLASTKPRKEKHKKSKKHSTKSRFRPY 389

>YNL035C Chr14 complement(568522..569691) [1170 bp, 389 aa] {ON}
           Putative protein of unknown function with similarity to
           proteins containing WD-40 domains; green fluorescent
           protein (GFP)-fusion protein localizes to the nucleus;
           YNL035C is not an essential gene
          Length = 389

 Score =  658 bits (1698), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/389 (82%), Positives = 342/389 (87%)

Query: 1   MASYSLVESNFFGSENWCLKLQPSYKHGLLTGLSNGEIRLLDWATCKSLQNIKASETAIN 60
           MASYSLVESN FGSENWCLKLQPSYKHGLLTGLSNGEIRLLDW+T KS+Q IKASETAIN
Sbjct: 1   MASYSLVESNSFGSENWCLKLQPSYKHGLLTGLSNGEIRLLDWSTGKSVQKIKASETAIN 60

Query: 61  DLKVIDSDFSAGHLVSSASIDAVKVFDIRTNSCIATIQNESNSPFLSLDSRHGLLACGTE 120
           D+KVI SDFSAGHLVSSASIDAVKVFDIRTN  IA IQNE+NSPF+SLDSRHGLLACGTE
Sbjct: 61  DMKVIGSDFSAGHLVSSASIDAVKVFDIRTNDRIAQIQNEANSPFISLDSRHGLLACGTE 120

Query: 121 LQGIDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQ 180
           LQGIDAAV+IYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQ
Sbjct: 121 LQGIDAAVYIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQ 180

Query: 181 DEEEDALHQVINYASIHSCGWLSPKRIYTLSHMETFAIHELNDKSDELREPQPLDFGDVR 240
           DEEEDALHQVINYASIHSCGWLSPKRI+TLSHMETFAIHELNDKSDEL+EPQPLDFGDVR
Sbjct: 181 DEEEDALHQVINYASIHSCGWLSPKRIFTLSHMETFAIHELNDKSDELKEPQPLDFGDVR 240

Query: 241 KAWDCDYVVDIYPGLIATGKTQENAGELRLIPFKNEKIYTEKCFVIPHAHGDEVVRDIFI 300
           + W+CDYVVDIYPGLIATGKTQEN GEL L+PFK+EK+ TE   VIPHAHGDEVVRDIFI
Sbjct: 241 EIWNCDYVVDIYPGLIATGKTQENCGELCLLPFKDEKVDTENGIVIPHAHGDEVVRDIFI 300

Query: 301 SAHQSDMLYSCGEDGYVKIWKSTQGPLNTPETFWDYSEKMNVLGDDSKEAFTNLEEPLII 360
            A  S+MLYSCGEDG VKIW++ QGPL+ PE FWDYS+KMNVLGDD +E   NL+EPLII
Sbjct: 301 PAQHSNMLYSCGEDGCVKIWENKQGPLDIPENFWDYSKKMNVLGDDDREGSINLDEPLII 360

Query: 361 QKDLAXXXXXXXXXXXXXXXXXXXXFRPY 389
           QK+                      F+PY
Sbjct: 361 QKESVSTRPRKEKHKKAKKHSMKSRFKPY 389

>Skud_14.298 Chr14 complement(546083..547252) [1170 bp, 389 aa] {ON}
           YNL035C (REAL)
          Length = 389

 Score =  650 bits (1678), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/389 (78%), Positives = 344/389 (88%)

Query: 1   MASYSLVESNFFGSENWCLKLQPSYKHGLLTGLSNGEIRLLDWATCKSLQNIKASETAIN 60
           M+SYSLVESN FGSENWCLKLQPSYK+GLLTGLSNGEIRLLDW + +SLQ IKASET+IN
Sbjct: 1   MSSYSLVESNSFGSENWCLKLQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSIN 60

Query: 61  DLKVIDSDFSAGHLVSSASIDAVKVFDIRTNSCIATIQNESNSPFLSLDSRHGLLACGTE 120
           DLKVIDSDF+AGHLVSSASIDAVKVFDIRTN+C+A I NE+NSPF+SLDSRHGLLACGTE
Sbjct: 61  DLKVIDSDFAAGHLVSSASIDAVKVFDIRTNACVAKIHNEANSPFISLDSRHGLLACGTE 120

Query: 121 LQGIDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQ 180
           LQGIDAAV+IYDIR+WD PLRS+IDSHHDDVTCIKFHPSDVN+LLSGSTDGYTNIYDLKQ
Sbjct: 121 LQGIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQ 180

Query: 181 DEEEDALHQVINYASIHSCGWLSPKRIYTLSHMETFAIHELNDKSDELREPQPLDFGDVR 240
           DEEEDALHQVINYASIHSCGWLS KRIYTLSHMETFAIHELNDKSDE +EP+P DFGD+R
Sbjct: 181 DEEEDALHQVINYASIHSCGWLSQKRIYTLSHMETFAIHELNDKSDEFKEPRPADFGDIR 240

Query: 241 KAWDCDYVVDIYPGLIATGKTQENAGELRLIPFKNEKIYTEKCFVIPHAHGDEVVRDIFI 300
           +AW+CDYVVD+YPGLIATGKTQE AGELRL+PF++EK+  E   VIP AHGDEVVRD+FI
Sbjct: 241 EAWNCDYVVDVYPGLIATGKTQEGAGELRLLPFRDEKVDAENEIVIPRAHGDEVVRDVFI 300

Query: 301 SAHQSDMLYSCGEDGYVKIWKSTQGPLNTPETFWDYSEKMNVLGDDSKEAFTNLEEPLII 360
           SA QSD+LYSCGEDG+VKIWK+  GPLNTPE+FWDYSEK+NVL +D K++  +L+EP+II
Sbjct: 301 SALQSDLLYSCGEDGFVKIWKNNLGPLNTPESFWDYSEKLNVLDEDHKQSSISLKEPIII 360

Query: 361 QKDLAXXXXXXXXXXXXXXXXXXXXFRPY 389
           QK+ A                    F+PY
Sbjct: 361 QKESAVTKPRKEKHKKSNKLSTKSRFKPY 389

>Suva_14.311 Chr14 complement(553987..555156) [1170 bp, 389 aa] {ON}
           YNL035C (REAL)
          Length = 389

 Score =  632 bits (1631), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/389 (77%), Positives = 338/389 (86%)

Query: 1   MASYSLVESNFFGSENWCLKLQPSYKHGLLTGLSNGEIRLLDWATCKSLQNIKASETAIN 60
           M SYSLV+ N FGSENWCLKLQP+YKHGLLTGLSNGEI LLDW T K LQ I+ASETAIN
Sbjct: 1   MNSYSLVDLNSFGSENWCLKLQPAYKHGLLTGLSNGEICLLDWNTGKPLQKIRASETAIN 60

Query: 61  DLKVIDSDFSAGHLVSSASIDAVKVFDIRTNSCIATIQNESNSPFLSLDSRHGLLACGTE 120
           D+K+IDSDF AG+L+SSASID+VKVFDIR+N C+A I NE+NSPFLSLDSRHGLLACGTE
Sbjct: 61  DMKIIDSDFVAGNLISSASIDSVKVFDIRSNDCVAKINNETNSPFLSLDSRHGLLACGTE 120

Query: 121 LQGIDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQ 180
           LQGIDAA+HIYD+RKWD PLRSL+DSHHDDVTCIKFHPSDVN+LLSGSTDGYTNIYDLKQ
Sbjct: 121 LQGIDAAIHIYDVRKWDAPLRSLVDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQ 180

Query: 181 DEEEDALHQVINYASIHSCGWLSPKRIYTLSHMETFAIHELNDKSDELREPQPLDFGDVR 240
           D+EEDALHQVINYASIHSCGWLSPKRIYTLSHMETF+IHELNDKSDEL+EPQPLDFGD+R
Sbjct: 181 DDEEDALHQVINYASIHSCGWLSPKRIYTLSHMETFSIHELNDKSDELKEPQPLDFGDIR 240

Query: 241 KAWDCDYVVDIYPGLIATGKTQENAGELRLIPFKNEKIYTEKCFVIPHAHGDEVVRDIFI 300
           KAW+CDYVVD+YPG IATGKTQE AGELRL+PFK+EKI T    VIPHAHGDEVVRD+F+
Sbjct: 241 KAWNCDYVVDVYPGFIATGKTQEGAGELRLLPFKDEKIDTGNGIVIPHAHGDEVVRDVFV 300

Query: 301 SAHQSDMLYSCGEDGYVKIWKSTQGPLNTPETFWDYSEKMNVLGDDSKEAFTNLEEPLII 360
           S   +D+LYSCGEDG VKIWK++ G LNTP +FWDYSE+++VL D++KEA T+LEEPLII
Sbjct: 301 SEQNTDVLYSCGEDGCVKIWKNSLGCLNTPASFWDYSERISVLEDENKEAPTSLEEPLII 360

Query: 361 QKDLAXXXXXXXXXXXXXXXXXXXXFRPY 389
           QK+                      F+PY
Sbjct: 361 QKESVATKPRKEKHKKTKKHSKKSRFKPY 389

>NDAI0G00630 Chr7 complement(137826..139019) [1194 bp, 397 aa] {ON}
           Anc_2.283 YNL035C
          Length = 397

 Score =  493 bits (1269), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 235/360 (65%), Positives = 290/360 (80%), Gaps = 4/360 (1%)

Query: 1   MASYSLVESNFFGSENWCLKLQPSYK-HGLLTGLSNGEIRLLDWATCKSLQNIKASETAI 59
           ++ YSL+ S+ FGS NWC K QP  K +GLL  LSNGEI  LD+ TC+S Q+I+ S  +I
Sbjct: 3   ISPYSLLNSHSFGSNNWCFKFQPLDKANGLLLSLSNGEIHCLDFGTCQSKQSIRVSNLSI 62

Query: 60  NDLKVIDSDFSAGHLVSSASIDAVKVFDIRTNSC-IATIQNESNSPFLSLDSRHGLLACG 118
           NDLK+++SDF  G L S+A+ ++VK+FDI +N+  IAT+ N+ N PFLSLDSRHGLLA G
Sbjct: 63  NDLKILNSDFHCGSLFSTATAESVKIFDINSNNGPIATLHNDKNVPFLSLDSRHGLLAMG 122

Query: 119 TELQGIDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDL 178
           TELQG+DA ++IYDIRKWDTPLRSLIDSHHDDVT +KFHPSD  +LLSGSTDGYTN+YDL
Sbjct: 123 TELQGVDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDL 182

Query: 179 KQDEEEDALHQVINYASIHSCGWLSPKRIYTLSHMETFAIHELNDKSDELREPQPLDFGD 238
            Q +E+DALHQV+NYASIHSCGWLSP RI+TLSHMETFAIHELNDKS+EL+EPQPLDFGD
Sbjct: 183 TQQDEDDALHQVMNYASIHSCGWLSPNRIFTLSHMETFAIHELNDKSEELKEPQPLDFGD 242

Query: 239 VRKAWDCDYVVDIYPGLIATGKTQENAGELRLIPFKNEKIYTEKCFVIPHAHGDEVVRDI 298
           VR+ W CDYV+D+YPG IA GK+QE  G+L+LIP   E I  +   VIP AHGDEV+RD+
Sbjct: 243 VREKWGCDYVIDVYPGYIAAGKSQEGNGQLKLIPTNGENISVKDSVVIPSAHGDEVIRDV 302

Query: 299 FISAHQSDMLYSCGEDGYVKIWKSTQGPLNTPETFWDYSEK-MNVL-GDDSKEAFTNLEE 356
           FI    S+++YSCGEDG+V +WK+  G LN PE FWDYS++ M+VL GD S E+   +E+
Sbjct: 303 FIPPSHSELVYSCGEDGFVNLWKNNNGALNVPEQFWDYSKRTMHVLDGDFSLESGNEVEK 362

>KLTH0G10296g Chr7 complement(869990..871270) [1281 bp, 426 aa] {ON}
           similar to uniprot|P53962 Saccharomyces cerevisiae
           YNL035C Hypothetical ORF
          Length = 426

 Score =  494 bits (1272), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 220/341 (64%), Positives = 273/341 (80%)

Query: 3   SYSLVESNFFGSENWCLKLQPSYKHGLLTGLSNGEIRLLDWATCKSLQNIKASETAINDL 62
           SYS +ES  FG  NWCLKLQP Y  GLLT LSNG + L+DWAT KS+  I+   T++ND+
Sbjct: 21  SYSKLESIEFGPNNWCLKLQPIYNSGLLTSLSNGRVELIDWATHKSILQIQTHATSVNDM 80

Query: 63  KVIDSDFSAGHLVSSASIDAVKVFDIRTNSCIATIQNESNSPFLSLDSRHGLLACGTELQ 122
            +I++D   G L+++A+ DAVK++D+++N C+AT++N  ++PFLSLDSRHGLL CGTEL 
Sbjct: 81  VIINNDRMNGSLIATAAEDAVKIYDLKSNDCVATLKNGKSAPFLSLDSRHGLLGCGTELS 140

Query: 123 GIDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQDE 182
           G+DA +H+YDIR W  PLRSL+DSHHDD+T IKFHPSD N+LLSGSTDGY NIYDL Q E
Sbjct: 141 GVDAELHVYDIRSWQQPLRSLVDSHHDDITSIKFHPSDPNVLLSGSTDGYVNIYDLTQQE 200

Query: 183 EEDALHQVINYASIHSCGWLSPKRIYTLSHMETFAIHELNDKSDELREPQPLDFGDVRKA 242
           E+DALHQVIN+ASIHSCGWLSPKRIYTLSHMET+ IHELNDK DE  EP+P+DFGDVRK 
Sbjct: 201 EDDALHQVINFASIHSCGWLSPKRIYTLSHMETYGIHELNDKRDEPTEPKPVDFGDVRKP 260

Query: 243 WDCDYVVDIYPGLIATGKTQENAGELRLIPFKNEKIYTEKCFVIPHAHGDEVVRDIFISA 302
           WDC+YV+D+YPG IATGK++E  GEL+LIP  +EK   +    IP AH DEVVRD+ +  
Sbjct: 261 WDCNYVIDVYPGFIATGKSEEGRGELKLIPLDHEKPELQSAITIPSAHDDEVVRDVLVPF 320

Query: 303 HQSDMLYSCGEDGYVKIWKSTQGPLNTPETFWDYSEKMNVL 343
              D+LYSCGEDG +K+WKS+ GPLN P+ FW YSEK++V 
Sbjct: 321 QHEDLLYSCGEDGSLKVWKSSAGPLNVPQEFWQYSEKIDVF 361

>Kpol_1003.34 s1003 complement(85833..86999) [1167 bp, 388 aa] {ON}
           complement(85833..86999) [1167 nt, 389 aa]
          Length = 388

 Score =  492 bits (1266), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 231/366 (63%), Positives = 280/366 (76%), Gaps = 7/366 (1%)

Query: 1   MASYSLVESNFFGSENWCLKLQPSYKHGLLTGLSNGEIRLLDWATCKSLQNIKASETAIN 60
           M+SYSL+ SN  G  +WCL+LQP Y+HGLL+ LSNG++ LLDW T   ++ +KA  T+IN
Sbjct: 1   MSSYSLLHSNSLGRTDWCLELQPLYRHGLLSSLSNGDVNLLDWNTGNCIRTVKAGNTSIN 60

Query: 61  DLKVIDSDFSAGHLVSSASIDAVKVFDIRT--NSCIATIQNESNSPFLSLDSRHGLLACG 118
            ++V+DSD+  G + S A  DAVKV D+R   NS +A + NE  +PFLSLDSRHG+LACG
Sbjct: 61  RMRVLDSDYDNGSVFSVAMNDAVKVLDLRVQGNSIVAELNNEKKTPFLSLDSRHGMLACG 120

Query: 119 TELQGIDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDL 178
           TEL G+DA +HIYDIR +D P+R L+DSHHDDVT IKFHPSD N+LLSGSTDGYTN+YDL
Sbjct: 121 TELSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDL 180

Query: 179 KQDEEEDALHQVINYASIHSCGWLSPKRIYTLSHMETFAIHELNDKSDELREPQPLDFGD 238
            Q EEEDALHQVINY S+HSCGWLSPKRIYTLSHMETFAIHELN+KSDEL EP+PLDFGD
Sbjct: 181 TQVEEEDALHQVINYESVHSCGWLSPKRIYTLSHMETFAIHELNNKSDELTEPKPLDFGD 240

Query: 239 VRKAWDCDYVVDIYPGLIATGKTQENAGELRLIPFKNEKIYTEKCFVIPHAHGDEVVRDI 298
           +R  WDCDYVVD+YPG IA GK++EN G L++IPF NE +       IP+AHGDEVVRD+
Sbjct: 241 IRGTWDCDYVVDVYPGYIAVGKSEENNGNLKIIPFHNELLNINDSISIPNAHGDEVVRDV 300

Query: 299 FISAHQSDMLYSCGEDGYVKIWKSTQGPLNTPETFWDYSEKMNVLGDDSKE-----AFTN 353
           FIS    +++YSCGEDG VK WK     L  P  FWDYS ++NVL D+  E     +  N
Sbjct: 301 FISPKSQNIMYSCGEDGSVKTWKIENNSLQVPPGFWDYSTQINVLDDNIDEQNIEQSTRN 360

Query: 354 LEEPLI 359
           + EP I
Sbjct: 361 ISEPSI 366

>ZYRO0A01804g Chr1 complement(150103..151233) [1131 bp, 376 aa] {ON}
           similar to uniprot|P53962 Saccharomyces cerevisiae
           YNL035C Hypothetical ORF
          Length = 376

 Score =  488 bits (1255), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 220/360 (61%), Positives = 285/360 (79%), Gaps = 10/360 (2%)

Query: 3   SYSLVESNFFGSENWCLKLQPSYKHGLLTGLSNGEIRLLDWATCKSLQNIKASETAINDL 62
           SYSLV S  FG+ NWCL LQP+Y+H LL  LSNG++  LDW T KS+ +IK  E A+N L
Sbjct: 2   SYSLVNSESFGNNNWCLNLQPAYQHSLLASLSNGQVHQLDWQTGKSIAHIKTGEVAVNKL 61

Query: 63  KVIDSDFSAGHLVSSASIDAVKVFDIRTNSCIATIQNESNSPFLSLDSRHGLLACGTELQ 122
           K+I++D       ++A++ AVK++DIR+N+C+ATI N+ N+PFLSLDSRH +LACGTEL 
Sbjct: 62  KLINNDHENESTYATATMGAVKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTELS 121

Query: 123 GIDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQDE 182
           G DA +HIYD+RKWD+PLRSL+DSHHDD+T I FHPSD N+L+SGSTDGYTNIYDL+Q E
Sbjct: 122 GSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAE 181

Query: 183 EEDALHQVINYASIHSCGWLSPKRIYTLSHMETFAIHELNDKSDELREPQPLDFGDVRKA 242
           EEDALHQVIN+ASIHSCGWL+P+RI+TLSHMETF+IHELNDKSDE +EP+P++F DVR++
Sbjct: 182 EEDALHQVINFASIHSCGWLAPRRIFTLSHMETFSIHELNDKSDEAKEPRPVEFNDVRES 241

Query: 243 WDCDYVVDIYPGLIATGKTQENAGELRLIPFKNEKIYTEKCFVIPHAHGDEVVRDIFISA 302
           W CDYVVDI+PG +A G +QE  G+LR++PF+ E++ T     I  AHGDEVVRD+F+ A
Sbjct: 242 WGCDYVVDIHPGYVACGNSQEGIGKLRILPFQGEQVDTNNAIDINAAHGDEVVRDVFVPA 301

Query: 303 HQSDMLYSCGEDGYVKIWKSTQGPLNTPETFWDYSEKMNVLGDDSKEAFTNLEEPLIIQK 362
             S +LYSCGEDG VK W++  GPLN  + FWDYS+ +NVL           E+P+++++
Sbjct: 302 RNSKLLYSCGEDGSVKTWENKSGPLNVTDEFWDYSQLLNVLD----------EQPVVVEE 351

>KNAG0H02040 Chr8 (366384..367583) [1200 bp, 399 aa] {ON} Anc_2.283
           YNL035C
          Length = 399

 Score =  488 bits (1255), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 224/364 (61%), Positives = 288/364 (79%), Gaps = 3/364 (0%)

Query: 1   MASYSLVESNFFGSENWCLKLQPSYKHGLLTGLSNGEIRLLDWATCKSLQNIKASETAIN 60
           M+  S + S FFGSENWC ++QP YK G+LT LSNGE+ L+DW + KS+   K+ ETAIN
Sbjct: 1   MSQCSQIGSYFFGSENWCFQIQPLYKAGILTSLSNGEVHLMDWKSNKSINKFKSDETAIN 60

Query: 61  DLKVIDSDFSAGHLVSSASIDAVKVFDIRTNSCIATIQNESNSPFLSLDSRHGLLACGTE 120
            L+++++D+       +AS+ AVK+FD+R+N+CI TI NE  +PFLSLDSR+  +ACGTE
Sbjct: 61  ALQIVNTDWHNETRFITASMHAVKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGTE 120

Query: 121 LQGIDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQ 180
           L+G+DA +HI+D+RK D P +SL+DSHHDD+T IKFHPSD N+LLSGSTDGYTNIYDL Q
Sbjct: 121 LKGVDAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQ 180

Query: 181 DEEEDALHQVINYASIHSCGWLSPKRIYTLSHMETFAIHELNDKSDELREPQPLDFGDVR 240
           +EE+D+LHQVIN+ SIHSCGW++PKRIYTLSHMETFAIHELN+KSDEL EPQPLDFGD+R
Sbjct: 181 EEEDDSLHQVINFTSIHSCGWVNPKRIYTLSHMETFAIHELNNKSDELTEPQPLDFGDIR 240

Query: 241 KAWDCDYVVDIYPGLIATGKT-QENAGELRLIPFKNEKIYTEKCFVIPHAHGDEVVRDIF 299
            AW CDYVVDIYPG +ATGK+ +E  GEL+LIP K E +  +    IP AHGDEV+RD+F
Sbjct: 241 AAWGCDYVVDIYPGYVATGKSHEEGKGELKLIPLKGENVVIDNTISIPSAHGDEVIRDVF 300

Query: 300 ISAHQSDMLYSCGEDGYVKIWKSTQGPLNTPETFWDYSEKMNVLGDDSKEAFTNLEEPLI 359
           I    S+++YSCGEDGY+ IW++  GPLN PE FW+Y   MNVL D+S ++F   + P+ 
Sbjct: 301 IPEQNSEVVYSCGEDGYLNIWRNNSGPLNVPEKFWNYDIPMNVL-DESLDSFAG-QPPIS 358

Query: 360 IQKD 363
           +Q +
Sbjct: 359 LQSE 362

>NCAS0G03870 Chr7 (717809..718978) [1170 bp, 389 aa] {ON} Anc_2.283
          Length = 389

 Score =  485 bits (1249), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 223/346 (64%), Positives = 281/346 (81%), Gaps = 2/346 (0%)

Query: 2   ASYSLVESNFFGSENWCLKLQPSY--KHGLLTGLSNGEIRLLDWATCKSLQNIKASETAI 59
           +SYSLV S  FGS NW LKLQP     +GLLT LSNGE+  LD +T  ++Q    SET+I
Sbjct: 3   SSYSLVNSRSFGSNNWALKLQPLQHGNNGLLTSLSNGEVHYLDPSTLTTIQKYNISETSI 62

Query: 60  NDLKVIDSDFSAGHLVSSASIDAVKVFDIRTNSCIATIQNESNSPFLSLDSRHGLLACGT 119
           NDL++I+ + ++  L ++A+ ++VK+FDI +   +ATI ++ N PF SLDSRHGLLACGT
Sbjct: 63  NDLQLINHNPTSSPLFTTATSNSVKIFDIHSTKEVATIHSQGNVPFPSLDSRHGLLACGT 122

Query: 120 ELQGIDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLK 179
           EL+G+DAA++IYDIRKWD P+RSL+DSHHDDVTC+K+HP+D NILLSGSTDGYTN+YDL 
Sbjct: 123 ELKGVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLS 182

Query: 180 QDEEEDALHQVINYASIHSCGWLSPKRIYTLSHMETFAIHELNDKSDELREPQPLDFGDV 239
           + EEED+LHQVIN+ASIHSCGWLSP+RI+TLSHMETFAIHELNDKSD L+EPQP+D GDV
Sbjct: 183 EAEEEDSLHQVINFASIHSCGWLSPRRIFTLSHMETFAIHELNDKSDTLKEPQPIDMGDV 242

Query: 240 RKAWDCDYVVDIYPGLIATGKTQENAGELRLIPFKNEKIYTEKCFVIPHAHGDEVVRDIF 299
           R+ W CDYVVD+YPG IATGK+QE  GEL+LIP ++E I      VIP AH DEV+RD++
Sbjct: 243 REKWGCDYVVDVYPGFIATGKSQERQGELKLIPLQDETIDLTNSIVIPGAHDDEVIRDVY 302

Query: 300 ISAHQSDMLYSCGEDGYVKIWKSTQGPLNTPETFWDYSEKMNVLGD 345
           I +H S M+Y+CGEDG VK+WK+  GPLN PE  WDYS+++N+L D
Sbjct: 303 IPSHDSVMMYTCGEDGNVKLWKNNNGPLNVPEQLWDYSKRVNMLED 348

>KAFR0H03340 Chr8 (637913..639016) [1104 bp, 367 aa] {ON} Anc_2.283
           YNL035C
          Length = 367

 Score =  481 bits (1238), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 213/341 (62%), Positives = 271/341 (79%)

Query: 3   SYSLVESNFFGSENWCLKLQPSYKHGLLTGLSNGEIRLLDWATCKSLQNIKASETAINDL 62
           SYSLV+   FGS+NWCLK QP Y HGLLT LSNGE++LLDW T   ++N K  + +IN +
Sbjct: 2   SYSLVQEQSFGSDNWCLKFQPLYNHGLLTSLSNGEVKLLDWETLNPVRNFKIDQVSINSM 61

Query: 63  KVIDSDFSAGHLVSSASIDAVKVFDIRTNSCIATIQNESNSPFLSLDSRHGLLACGTELQ 122
           K+I++D++   L ++A++++VK++DI++N CIATI N+  SPFLSLDSRH +LACGTELQ
Sbjct: 62  KLINNDYNNASLFATATLNSVKIYDIKSNDCIATITNDKKSPFLSLDSRHDMLACGTELQ 121

Query: 123 GIDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQDE 182
           G+DA ++IYD+R W +P++S +DSHHDD+T IKFHPSD N LLSGSTDGYTN+YDL Q E
Sbjct: 122 GVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQE 181

Query: 183 EEDALHQVINYASIHSCGWLSPKRIYTLSHMETFAIHELNDKSDELREPQPLDFGDVRKA 242
           E+DAL+QVINYASIHSCGWLSP+RIYTLSHMETF+I ELND++DELREPQPLDFGD+R  
Sbjct: 182 EDDALYQVINYASIHSCGWLSPRRIYTLSHMETFSISELNDRTDELREPQPLDFGDIRDQ 241

Query: 243 WDCDYVVDIYPGLIATGKTQENAGELRLIPFKNEKIYTEKCFVIPHAHGDEVVRDIFISA 302
           W+CDYV+DIYPG IATG++QE  G L++IP   E + + K   I  AH DEV+RD+FI  
Sbjct: 242 WNCDYVIDIYPGYIATGRSQEGNGNLQIIPMDGETVESSKAITIDRAHSDEVIRDVFIPR 301

Query: 303 HQSDMLYSCGEDGYVKIWKSTQGPLNTPETFWDYSEKMNVL 343
           +  ++LYSCGEDG VK WKS        E FWDYS++ NV 
Sbjct: 302 NHHNVLYSCGEDGTVKSWKSPHSQSTALEEFWDYSQRFNVF 342

>TDEL0G02140 Chr7 complement(420388..421566) [1179 bp, 392 aa] {ON}
           Anc_2.283 YNL035C
          Length = 392

 Score =  481 bits (1238), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 219/347 (63%), Positives = 275/347 (79%)

Query: 1   MASYSLVESNFFGSENWCLKLQPSYKHGLLTGLSNGEIRLLDWATCKSLQNIKASETAIN 60
           MASYS + +  FGS+NWCL LQP Y H LLT LSNGE+  +DW T KS++  +A  ++IN
Sbjct: 1   MASYSNLHTQDFGSDNWCLGLQPFYNHHLLTSLSNGEVHHIDWVTGKSVRVDQAGNSSIN 60

Query: 61  DLKVIDSDFSAGHLVSSASIDAVKVFDIRTNSCIATIQNESNSPFLSLDSRHGLLACGTE 120
            LK+IDS+F+ G   + AS D+V + D+R+   +A+++N+ N+PFLSLDSRHG+LACGTE
Sbjct: 61  KLKIIDSNFNEGSSYAVASNDSVNILDVRSRDKLASLKNDKNAPFLSLDSRHGMLACGTE 120

Query: 121 LQGIDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQ 180
           L G+DA +HIYD+R W TP+RS +DSHHDDVT I+FHPSD N+LLSGSTDGYTN+YDLKQ
Sbjct: 121 LSGVDAELHIYDVRNWSTPIRSFVDSHHDDVTDIRFHPSDRNVLLSGSTDGYTNVYDLKQ 180

Query: 181 DEEEDALHQVINYASIHSCGWLSPKRIYTLSHMETFAIHELNDKSDELREPQPLDFGDVR 240
            EE+DALHQVINYASIHSCGWLSPKRI+TLSHMET A+HELNDKSDELREPQPLDFGD+R
Sbjct: 181 QEEDDALHQVINYASIHSCGWLSPKRIFTLSHMETLAMHELNDKSDELREPQPLDFGDIR 240

Query: 241 KAWDCDYVVDIYPGLIATGKTQENAGELRLIPFKNEKIYTEKCFVIPHAHGDEVVRDIFI 300
           + W C YVVD+YPG +A G +QE +  L+L+  +NE+I TEK  VIP AHG+EVVRD+ I
Sbjct: 241 EKWGCSYVVDLYPGYVAVGSSQERSSFLKLMALENEQIETEKSLVIPSAHGEEVVRDVLI 300

Query: 301 SAHQSDMLYSCGEDGYVKIWKSTQGPLNTPETFWDYSEKMNVLGDDS 347
                +MLYSCGEDG VKIWK+     +    FWDYS+KM+V  +++
Sbjct: 301 PPQNCNMLYSCGEDGTVKIWKTKDTGFHIEPGFWDYSKKMDVFSEEA 347

>Ecym_3321 Chr3 complement(615730..616959) [1230 bp, 409 aa] {ON}
           similar to Ashbya gossypii ADL218C
          Length = 409

 Score =  472 bits (1215), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 220/363 (60%), Positives = 280/363 (77%), Gaps = 7/363 (1%)

Query: 3   SYSLVESNFFGSENWCLKLQPSYKHGLLTGLSNGEIRLLDWATCKSLQNIKASETAINDL 62
           SY+  ++  FGS+NWCLKLQP Y  GLL+ LSNG + L+DW +  S+Q+I    T+I+ L
Sbjct: 2   SYTKCDTISFGSDNWCLKLQPLYSRGLLSALSNGHVHLIDWNSLTSIQDIPVHGTSISAL 61

Query: 63  KVIDSDFSAGHLVSSASIDAVKVFDIRTNSCIATIQNESNSPFLSLDSRHGLLACGTELQ 122
           KV+D+D  +G+   +AS D+VK+FD+R N C+AT+QN  NSPF+SLDSRHG+LACGTEL 
Sbjct: 62  KVLDNDVDSGNTFVTASEDSVKIFDLRLNQCVATVQNAKNSPFISLDSRHGMLACGTELS 121

Query: 123 GIDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQDE 182
           G DA +H+YD++K D P+RS  DSHHDD+T IKFH SD ++LLSGSTDGY N+YDLKQ E
Sbjct: 122 GTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQE 181

Query: 183 EEDALHQVINYASIHSCGWLSPKRIYTLSHMETFAIHELNDKSDELREPQPLDFGDVRKA 242
           EE+ALHQVIN+ASIHSCGWLSPKRI+ LSHMETF+IHELNDKSDEL EP+PL+FGD+RK 
Sbjct: 182 EEEALHQVINFASIHSCGWLSPKRIWALSHMETFSIHELNDKSDELVEPKPLEFGDIRKP 241

Query: 243 WDCDYVVDIYPGLIATGKTQENAGELRLIPFKNEKIYTEKCFVIPHAHGDEVVRDIFISA 302
           W+CDYVVDI+PG I TG TQE +  L+L+PF NE++ T    +IP AHGDEVVRD  I  
Sbjct: 242 WNCDYVVDIFPGCIITGSTQEQS-MLQLLPFSNEEVDTTNSIIIPRAHGDEVVRDALIHK 300

Query: 303 HQSDMLYSCGEDGYVKIWKSTQGPLNTPETFWDYSEKMNVLGDDSKEAFTNLEEPLIIQK 362
             S++ YS GEDG + +WKS +G LN P  FW+Y EK+NVL D       N+E  + ++K
Sbjct: 301 TTSELFYSGGEDGNIVLWKSNRGSLNVPTEFWNYQEKLNVLHD------PNIEIDMTVEK 354

Query: 363 DLA 365
           D+A
Sbjct: 355 DIA 357

>Kwal_27.11550 s27 (845458..846681) [1224 bp, 407 aa] {ON} YNL035C -
           Hypothetical ORF [contig 27] FULL
          Length = 407

 Score =  470 bits (1209), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 209/341 (61%), Positives = 269/341 (78%)

Query: 3   SYSLVESNFFGSENWCLKLQPSYKHGLLTGLSNGEIRLLDWATCKSLQNIKASETAINDL 62
           SYS V+S  FG++NWCLKLQP Y  GLL  LSNG ++L+DW   K +  I+A  T I+D+
Sbjct: 2   SYSKVDSINFGADNWCLKLQPLYNRGLLASLSNGSVQLIDWVKNKQISQIQAHGTTISDM 61

Query: 63  KVIDSDFSAGHLVSSASIDAVKVFDIRTNSCIATIQNESNSPFLSLDSRHGLLACGTELQ 122
            V+++D + G L+++A+ D+VK+FD+R++  +AT++NE ++PFLSLDSRHG+LACGTEL 
Sbjct: 62  VVLNNDRNNGFLIATAAEDSVKIFDLRSSDTVATLKNEKSAPFLSLDSRHGMLACGTELS 121

Query: 123 GIDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQDE 182
           G+DA +HIYD++ W  PLRSL+DSHHDD+T IKFHP+D N+LLSGSTDGY NIYDL Q E
Sbjct: 122 GVDAELHIYDMKAWHQPLRSLVDSHHDDITNIKFHPTDPNVLLSGSTDGYVNIYDLTQPE 181

Query: 183 EEDALHQVINYASIHSCGWLSPKRIYTLSHMETFAIHELNDKSDELREPQPLDFGDVRKA 242
           E+DALHQVIN+ASIHS GW +PKRIYTLSHMETF IHELNDK +E  EP P DFGD+R++
Sbjct: 182 EDDALHQVINFASIHSSGWCAPKRIYTLSHMETFGIHELNDKLEEPTEPHPKDFGDIRQS 241

Query: 243 WDCDYVVDIYPGLIATGKTQENAGELRLIPFKNEKIYTEKCFVIPHAHGDEVVRDIFISA 302
           W CDYVVD+YPG IATGK+QE  GE++LIPF  E +  +    IP AHGDEVVRD+ +  
Sbjct: 242 WGCDYVVDVYPGFIATGKSQEGQGEVKLIPFTGEDLDLDSAVTIPSAHGDEVVRDVLVPF 301

Query: 303 HQSDMLYSCGEDGYVKIWKSTQGPLNTPETFWDYSEKMNVL 343
              DMLY+CGEDG V  WKS +GPLN P+ FW Y+++++V 
Sbjct: 302 QHEDMLYTCGEDGCVNAWKSNRGPLNVPQEFWSYADQIDVF 342

>SAKL0E07766g Chr5 (628373..629569) [1197 bp, 398 aa] {ON} similar
           to uniprot|P53962 Saccharomyces cerevisiae YNL035C
           Hypothetical ORF
          Length = 398

 Score =  469 bits (1208), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 210/343 (61%), Positives = 267/343 (77%)

Query: 3   SYSLVESNFFGSENWCLKLQPSYKHGLLTGLSNGEIRLLDWATCKSLQNIKASETAINDL 62
           SYS + +  FG ENWCL+LQP Y  GLLT LSNG I L+DW T + +    A   +I++L
Sbjct: 2   SYSKLHTASFGCENWCLQLQPLYNRGLLTSLSNGHIHLVDWCTGEIIHEFAAHSASISNL 61

Query: 63  KVIDSDFSAGHLVSSASIDAVKVFDIRTNSCIATIQNESNSPFLSLDSRHGLLACGTELQ 122
           KV++++F+   L +SAS D+VK+FD+RT+SC+AT+ N+ ++PFLSLDSRH +LACGTEL 
Sbjct: 62  KVLNNEFTNSDLFASASKDSVKIFDVRTSSCVATLHNDKSAPFLSLDSRHDMLACGTELS 121

Query: 123 GIDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQDE 182
           G+DA +HIYDI+K   PLRS +DSHHDD+T  KFHP D  +L+SGSTDGY NIYDL   +
Sbjct: 122 GVDAELHIYDIKKLSKPLRSFVDSHHDDITDTKFHPGDPGVLMSGSTDGYVNIYDLTNSD 181

Query: 183 EEDALHQVINYASIHSCGWLSPKRIYTLSHMETFAIHELNDKSDELREPQPLDFGDVRKA 242
           EEDALHQVIN+AS+HSCGWL+P+RIYTLSHMETFAIHELNDKSD+LREP+P++FGDVR+ 
Sbjct: 182 EEDALHQVINFASVHSCGWLAPRRIYTLSHMETFAIHELNDKSDDLREPKPVEFGDVRQP 241

Query: 243 WDCDYVVDIYPGLIATGKTQENAGELRLIPFKNEKIYTEKCFVIPHAHGDEVVRDIFISA 302
           W CDY+++I PG IA G++QE  GEL+LI F +EK+ T     IP AHGDE++RD+ I  
Sbjct: 242 WGCDYIININPGFIAAGRSQETQGELKLIAFNDEKVDTTNVLTIPQAHGDEIIRDVLIPD 301

Query: 303 HQSDMLYSCGEDGYVKIWKSTQGPLNTPETFWDYSEKMNVLGD 345
             +DMLYSCGEDG + IWKS  GPLN    FWDYS++ NV  D
Sbjct: 302 QTTDMLYSCGEDGCLNIWKSQTGPLNISRDFWDYSKRFNVFED 344

>KLLA0E08449g Chr5 (759718..760986) [1269 bp, 422 aa] {ON} similar
           to uniprot|P53962 Saccharomyces cerevisiae YNL035C
           Hypothetical ORF
          Length = 422

 Score =  469 bits (1206), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 208/347 (59%), Positives = 266/347 (76%)

Query: 3   SYSLVESNFFGSENWCLKLQPSYKHGLLTGLSNGEIRLLDWATCKSLQNIKASETAINDL 62
           S++  +  +F   NWCLKLQP Y+HGL+T +S+G + LLDW   K++ +I+   T+IND+
Sbjct: 2   SFNKYKCRYFEENNWCLKLQPLYQHGLMTSISDGSVHLLDWGNLKTISSIQCHTTSINDM 61

Query: 63  KVIDSDFSAGHLVSSASIDAVKVFDIRTNSCIATIQNESNSPFLSLDSRHGLLACGTELQ 122
           KVI+SDF  G + ++A+ D VKV+DIR  + +A++QN+  SPF SLDSRH +LACGTEL+
Sbjct: 62  KVINSDFDTGAVFATAAEDGVKVWDIRARNNVASLQNDKASPFFSLDSRHNMLACGTELK 121

Query: 123 GIDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQDE 182
             DA +HIYDIR W  P+RS +DSHHDD+T IKFHP D N+L+SGSTDGY NIYDL QD+
Sbjct: 122 DYDAELHIYDIRNWTKPVRSFVDSHHDDITDIKFHPCDSNLLMSGSTDGYVNIYDLTQDD 181

Query: 183 EEDALHQVINYASIHSCGWLSPKRIYTLSHMETFAIHELNDKSDELREPQPLDFGDVRKA 242
           EEDALHQVIN+ASIHSCGWL PKRI++LSHMETF IHELNDKSDE+ EP+PL+FGDVR  
Sbjct: 182 EEDALHQVINFASIHSCGWLGPKRIWSLSHMETFGIHELNDKSDEMIEPKPLEFGDVRDK 241

Query: 243 WDCDYVVDIYPGLIATGKTQENAGELRLIPFKNEKIYTEKCFVIPHAHGDEVVRDIFISA 302
           W CDYV+DIYP  IATGKT E+ GEL++IPF+NE++      VIP AHG+EV+RD+ I  
Sbjct: 242 WGCDYVIDIYPSFIATGKTHESQGELKIIPFQNEQVDVSSALVIPDAHGNEVIRDVLIPK 301

Query: 303 HQSDMLYSCGEDGYVKIWKSTQGPLNTPETFWDYSEKMNVLGDDSKE 349
           +Q+ +LYSCGEDGYV +WK T   LN P  FWDY+       +  +E
Sbjct: 302 NQTSLLYSCGEDGYVNVWKDTTNSLNVPHNFWDYTLPFTAFENSVRE 348

>ADL218C Chr4 complement(319674..320885) [1212 bp, 403 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL035C
          Length = 403

 Score =  458 bits (1178), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 208/343 (60%), Positives = 266/343 (77%)

Query: 3   SYSLVESNFFGSENWCLKLQPSYKHGLLTGLSNGEIRLLDWATCKSLQNIKASETAINDL 62
           SY L +   FG++NWCL+L+P Y+ G+L  LSNG + L+DWAT KS+ ++ A E++IN L
Sbjct: 2   SYILQQKVSFGADNWCLRLRPLYQAGVLAALSNGHVHLVDWATGKSVLDVAAHESSINGL 61

Query: 63  KVIDSDFSAGHLVSSASIDAVKVFDIRTNSCIATIQNESNSPFLSLDSRHGLLACGTELQ 122
           +V+DS    G + ++A+ D VK+FDIRT  C+AT+ + + +P LSLDSRHG+LA GTEL 
Sbjct: 62  QVLDSAHDRGTVFATAADDGVKLFDIRTRGCVATLTDANGAPALSLDSRHGMLAFGTELV 121

Query: 123 GIDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQDE 182
           G+DA V ++ + +W  PLR+ +DSHHDDVT +KFHP+D N+LLSGSTDGY N+YDLKQ E
Sbjct: 122 GVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSE 181

Query: 183 EEDALHQVINYASIHSCGWLSPKRIYTLSHMETFAIHELNDKSDELREPQPLDFGDVRKA 242
           E++ALHQVIN+ASIHSCGWLSPKRI++LSHMETFAIHELNDKS+   EPQP  FGDVR+ 
Sbjct: 182 EDEALHQVINFASIHSCGWLSPKRIWSLSHMETFAIHELNDKSEHANEPQPQLFGDVREP 241

Query: 243 WDCDYVVDIYPGLIATGKTQENAGELRLIPFKNEKIYTEKCFVIPHAHGDEVVRDIFISA 302
           W CDYVVD+YPG IA G T+ENAGELRL+P ++E +      V+P AHGDEVVRD+ + A
Sbjct: 242 WACDYVVDVYPGFIAAGSTRENAGELRLLPLRDECVDAANAIVLPQAHGDEVVRDVLVPA 301

Query: 303 HQSDMLYSCGEDGYVKIWKSTQGPLNTPETFWDYSEKMNVLGD 345
              ++LYS GEDG + IWKST GPLN P  FWDYS+K  VL D
Sbjct: 302 SSPELLYSAGEDGNMAIWKSTLGPLNVPVDFWDYSKKETVLED 344

>TBLA0B05920 Chr2 complement(1390257..1391468) [1212 bp, 403 aa]
           {ON} Anc_2.283 YNL035C
          Length = 403

 Score =  457 bits (1175), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 204/336 (60%), Positives = 270/336 (80%), Gaps = 4/336 (1%)

Query: 12  FGSENWCLKLQPSYKHGLLTGLSNGEIRLLDWATCKSLQNIKASETAINDLKVIDSDFSA 71
           FGS NWCLK +P Y +GLLT LSNGEI +LDW T +    IK  ET+IND ++++++++ 
Sbjct: 11  FGSNNWCLKFKPLYNYGLLTSLSNGEISILDWKTNQIKDKIKIGETSINDFEIVNNNYNG 70

Query: 72  GHLVSSASIDAVKVFDIRTNSCIATIQNESNSPFLSLDSRHGLLACGTELQGIDAAVHIY 131
           G L+ +A+ ++VK++D+++N CI TI NE NSPFLSLDS H ++ACGTEL G+DA ++IY
Sbjct: 71  GSLMVTATNESVKIYDLKSNDCIKTITNEKNSPFLSLDSLHNMMACGTELSGVDAELYIY 130

Query: 132 DIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQDEEEDALHQVI 191
           DIR WDTP+RS +DSHHDD+T IKFHP+D  +L+SGSTDGYTNIYDL + EEED+LHQVI
Sbjct: 131 DIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEEEDSLHQVI 190

Query: 192 NYASIHSCGWLSPKRIYTLSHMETFAIHELNDKSDELREPQPLDFGDVRKAWDCDYVVDI 251
           NY+SIHSCGWLS +RI+TLSHMETFAIH+LNDKS+ L+EP+P++FGD+R  W C+YV+D+
Sbjct: 191 NYSSIHSCGWLSSRRIFTLSHMETFAIHQLNDKSEVLKEPKPIEFGDIRNDWGCNYVIDV 250

Query: 252 YPGLIATGKTQENAGELRLIPFKNEKI--YTEKCFVIPHAHGDEVVRDIFISAHQSDMLY 309
           YPG IATGKT+E+ G+L++ PF NEKI    +   +IP AHGDEV+RD+FI+ +    +Y
Sbjct: 251 YPGYIATGKTEESKGQLKISPFNNEKIDLAEDNNIIIPQAHGDEVIRDVFINPNDPSNMY 310

Query: 310 SCGEDGYVKIWK--STQGPLNTPETFWDYSEKMNVL 343
           SCGEDG VK+WK  +T   L  PE F+DYS ++NVL
Sbjct: 311 SCGEDGNVKLWKIDTTTKSLKIPEHFFDYSLRLNVL 346

>TPHA0C03370 Chr3 complement(738736..739977) [1242 bp, 413 aa] {ON}
           Anc_2.283 YNL035C
          Length = 413

 Score =  442 bits (1136), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 208/351 (59%), Positives = 271/351 (77%), Gaps = 7/351 (1%)

Query: 3   SYSLVESNFFGSENWCLKLQPSYKHGLLTGLSNGEIRLLDWATCKSLQNIKASETAINDL 62
           S  LV    FG++NWCL+L+P Y  GLL   SNG + L+DW +   ++  +  ET IN L
Sbjct: 2   SAKLVNQITFGNDNWCLELKPLYSRGLLCSSSNGSVNLIDWNSPSIIKKFEVGETNINSL 61

Query: 63  KVIDSDFSAGHLVSSASIDAVKVFDIRT-NSCIATIQNESNSPFLSLDSRHGLLACGTEL 121
           +VI++DF  G + ++ S+ +VK++D+R  +S +ATI+N+ NS FLSL+SRH +L CGTEL
Sbjct: 62  RVINNDFENGCIFAATSLASVKIYDVRNGDSPVATIKNDKNSVFLSLESRHDMLVCGTEL 121

Query: 122 QGIDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQD 181
            G+DA + IYD+R +  P+R+ +DSHHDD+T IKFHPSD NILLSGSTDGYTNIYDL Q+
Sbjct: 122 TGVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQE 181

Query: 182 EEEDALHQVINYASIHSCGWLSPKRIYTLSHMETFAIHELNDKSDELREPQPLDFGDVRK 241
           +E++ALHQVINYASIHSCGWLSPKRIYTLSHMETFAIHELNDKSDEL EP+PLDFGD+R 
Sbjct: 182 DEDEALHQVINYASIHSCGWLSPKRIYTLSHMETFAIHELNDKSDELTEPRPLDFGDIRG 241

Query: 242 AWDCDYVVDIYPGLIATGKTQENAGELRLIPFKNEKIYTEKCFVIPHAHGDEVVRDIFIS 301
            WDCDYVVD+YPG +A GK+ ENAGEL++  F+NE + TE   +IP+AHGDEV+RD+FI 
Sbjct: 242 QWDCDYVVDLYPGYVAMGKSAENAGELKICGFENEIMNTENHIIIPNAHGDEVIRDVFIP 301

Query: 302 A----HQSDMLYSCGEDGYVKIWKSTQ--GPLNTPETFWDYSEKMNVLGDD 346
                + SD++YSCGEDG V IW + +    LN  + FW+ +E+++VL DD
Sbjct: 302 PGNLNNHSDIIYSCGEDGNVNIWHAPRCSSILNVSKDFWNATEQLDVLSDD 352

>CAGL0G01628g Chr7 complement(151262..152392) [1131 bp, 376 aa] {ON}
           similar to uniprot|P53962 Saccharomyces cerevisiae
           YNL035c
          Length = 376

 Score =  428 bits (1101), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 205/347 (59%), Positives = 261/347 (75%), Gaps = 6/347 (1%)

Query: 4   YSLVESNFFGSENWCLKLQPSYKHGLLTGLSNGEIRLLDWATCKSLQNIKASETAINDLK 63
           YSL  S  FGS NWCLKLQP + +G+LT +S+GE+ LL     K   + K  ET+IN L 
Sbjct: 2   YSLAGSCNFGSNNWCLKLQPVH-NGILTSVSSGEVHLLGLDLSKQ-DSFKVGETSINALS 59

Query: 64  VIDSDFSAGHLVSSASIDAVKVFDIRTNSCIATIQNESNSPFLSLDSRHGLLACGTELQG 123
            +D      +L ++++ + VKVFD+R N  +AT++ E+ +  LSL S HG+LA G+E QG
Sbjct: 60  RVDGQ---ENLFAASNGNKVKVFDLRENKEVATLEQENGANVLSLGSGHGMLAYGSEQQG 116

Query: 124 IDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQDEE 183
           +DA +H++DIR W  P+RS +DSH DD+T I FHP+D N+LLSGSTDGYTN+YDL + EE
Sbjct: 117 VDAHLHLFDIRNWSKPVRSFVDSHQDDITSIAFHPADANVLLSGSTDGYTNVYDLLEPEE 176

Query: 184 EDALHQVINYASIHSCGWLSPKRIYTLSHMETFAIHELNDKSDELREPQPLDFGDVRKAW 243
           EDALHQVINYASIHSCGWL+P+RI+TLSHMETFAIHELNDKS+ELREPQPLDFGD+R+ W
Sbjct: 177 EDALHQVINYASIHSCGWLAPRRIFTLSHMETFAIHELNDKSEELREPQPLDFGDIRQPW 236

Query: 244 DCDYVVDIYPGLIATGKTQENAGELRLIPFKNEKIYTEKCFVIPHAHGDEVVRDIFISAH 303
           DC+YVVDIYPG I+ G ++E  G LR+IPF+NE +  +    I  AHGDE+VRD +I   
Sbjct: 237 DCNYVVDIYPGYISAGVSEEGKGALRIIPFRNEHVQAKDTITISQAHGDEIVRDTYILPS 296

Query: 304 QSDMLYSCGEDGYVKIWKSTQGPLNTPETFWDYSEKMNVLGDDSKEA 350
           QSDMLYSCGEDG VK W++    L+ PETFWDYS KM++L D+  E 
Sbjct: 297 QSDMLYSCGEDGQVKAWRNDI-KLDIPETFWDYSTKMSLLSDEVPEV 342

>CAGL0B03575g Chr2 complement(357525..358784) [1260 bp, 419 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056w HAT2
          Length = 419

 Score = 62.8 bits (151), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 63/198 (31%), Positives = 96/198 (48%), Gaps = 29/198 (14%)

Query: 12  FGSEN-WCLKLQPSYKHGLLTGLSNGEIRLLDWATCKSLQNIKASET-------AINDLK 63
           + +EN + L    + K+ LL+G  +  I L  W      +NIK + T        IND+K
Sbjct: 177 YHTENGYGLAFNANEKYSLLSGSDDSNIAL--WDISNFEKNIKPTITFEDAHTDIINDVK 234

Query: 64  VIDSDFSAGHLVSSASIDA-VKVFDIRTNSCIATIQNES--NSPFLSLDSRHGLLACGTE 120
              S+    H+  S S D+ +K+FD R++  I  I  +   N+   S  S +   A GT 
Sbjct: 235 WHSSE---AHIFGSVSEDSTMKLFDKRSSQIIHNINTKKPYNTLAFSPFSSNLFAAAGT- 290

Query: 121 LQGIDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLK- 179
               D  V++YDIR    PL ++   H D VT I+F P++  IL S  +D  T ++DL+ 
Sbjct: 291 ----DNLVYLYDIRDVSNPLYAMT-GHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQE 345

Query: 180 ------QDEEEDALHQVI 191
                 QDE ED   +V+
Sbjct: 346 IGAEQTQDEIEDGPPEVL 363

>KLTH0C11550g Chr3 (949063..950259) [1197 bp, 398 aa] {ON} similar
           to uniprot|P39984 Saccharomyces cerevisiae YEL056W
          Length = 398

 Score = 52.4 bits (124), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 35/93 (37%), Positives = 51/93 (54%), Gaps = 6/93 (6%)

Query: 123 GIDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQ-- 180
           G D+ V +YD+RK + P+ S+   HHD VT ++F P    IL SGS+D    I+DL Q  
Sbjct: 268 GTDSQVQLYDLRKPEAPIHSM-SGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQIG 326

Query: 181 --DEEEDALHQVINYASIHSCGWLSPKRIYTLS 211
              ++EDA   V     +H+ G  SP   ++ S
Sbjct: 327 AEQQQEDADDGVPELLMMHA-GHKSPVNDFSCS 358

>Kpol_1045.78 s1045 (183044..184222) [1179 bp, 392 aa] {ON}
           (183046..184224) [1179 nt, 393 aa]
          Length = 392

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 38/112 (33%), Positives = 62/112 (55%), Gaps = 10/112 (8%)

Query: 73  HLVSSASIDA-VKVFDIR-TNSCIATIQNESNSPFLSLDSRH--GLLACGTELQGIDAAV 128
           +L  S S D+ +K+ D R T+  I TIQ ++    L+  S+H   L A      G+D  +
Sbjct: 213 NLFGSVSEDSTLKLHDKRSTSKVINTIQAKAAFNTLAF-SKHSANLFAAA----GLDTNI 267

Query: 129 HIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQ 180
           ++YD R+   PL  ++  H D +TC++FHP +  IL+SG  D    ++DL +
Sbjct: 268 YLYDRRQTTKPLH-VMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLAE 318

>ACR017W Chr3 (387122..388393) [1272 bp, 423 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL056W (HAT2)
          Length = 423

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 51/183 (27%), Positives = 86/183 (46%), Gaps = 13/183 (7%)

Query: 3   SYSLVESNFFGSEN-WCLKLQPSYKHGLLTGLSNGEIRLLDWATCKSLQNIKAS-ETAIN 60
           S + V +  F  EN + L   P     LL+G  +  + L D    K  ++I  S +  +N
Sbjct: 175 SKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVN 234

Query: 61  DLKVIDSDFSAGHLVSSASIDAVKVFDIRTNSCIATIQNESNSPFLSLD-SRHG--LLAC 117
           D+K    +F +    + +    ++V D R        +  + SPF +L  S+H   LLA 
Sbjct: 235 DVKW--HEFESNVFGTVSEDKTLQVHDKRVR-LEPVKKLPTASPFNTLSFSKHSRNLLAA 291

Query: 118 GTELQGIDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYD 177
                G+D+ +++YD+R   +PL  ++  H D VT ++F P    I+ S  +D    I+D
Sbjct: 292 A----GVDSQIYLYDMRDMSSPLH-VMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWD 346

Query: 178 LKQ 180
           L Q
Sbjct: 347 LTQ 349

>ZYRO0F00462g Chr6 complement(46021..47202) [1182 bp, 393 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 393

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 50/177 (28%), Positives = 83/177 (46%), Gaps = 16/177 (9%)

Query: 11  FFGSENWCLKLQPSYKHGLLTGLSNGEIRLLDWATCKSLQNI----KASETAINDLKVID 66
           F     + L   P+ K  LL+G  +  I L D  T KS + I          +ND K  +
Sbjct: 152 FHNENGYGLSFNPNEKGKLLSGSDDSNIVLWD-VTGKSQEPILTFTDRHSDIVNDCKWHN 210

Query: 67  SDFSAGHLVSSASIDAVKVFDIR-TNSCIATIQNES--NSPFLSLDSRHGLLACGTELQG 123
            D +    VS  S   +++ D R  ++ +  +Q +   N+   S  S +   A GT    
Sbjct: 211 FDQNIFGSVSEDS--TLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGT---- 264

Query: 124 IDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQ 180
            D+ V++YD R+   PL  ++  H D VT ++FHP +  +L+S  +D  T ++DL +
Sbjct: 265 -DSMVYLYDRRRASKPLH-MMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLAE 319

>NDAI0K02900 Chr11 (657436..658752) [1317 bp, 438 aa] {ON} Anc_6.9
          Length = 438

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 57/204 (27%), Positives = 100/204 (49%), Gaps = 25/204 (12%)

Query: 5   SLVESNFFGSEN-WCLKLQPSYKHGLLTGLSNGEIRLLDWATCKSL--QNIKASETAIND 61
           +L+ +  F  EN + L   P+ K  LL+G  +G I L D     +L  + +K  ++  ND
Sbjct: 187 ALISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHND 246

Query: 62  LKVID---SDFSAGHLVSSASIDAVKVFDIR-TNSCIATIQNESNSPFLSLD-SRHG--L 114
           + V D   ++F++    S +    +++ D R  N+ I +I+  +  PF +L  S+H   L
Sbjct: 247 I-VNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTIINSIK--TTDPFNTLAFSKHSQYL 303

Query: 115 LACGTELQGIDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTN 174
           +A      G D+ V++YD R    PL S+ + H D +T ++F P    +L+S   D    
Sbjct: 304 MAAA----GTDSLVYLYDSRNLSVPLYSM-NGHEDSITNLEFSPHTDGVLISSGNDRRVI 358

Query: 175 IYDLKQ-------DEEEDALHQVI 191
           ++D+         D+ ED   +VI
Sbjct: 359 MWDINDIGAEQIPDDAEDGAPEVI 382

 Score = 30.4 bits (67), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 42/196 (21%), Positives = 81/196 (41%), Gaps = 38/196 (19%)

Query: 140 LRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQDEEE--------DALHQVI 191
           L S +  H ++   + F+P+D   LLSGS DG   ++D++++           D++H  I
Sbjct: 188 LISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDI 247

Query: 192 NYASIHSCGW--LSPKRIYTLSHMETFAIHELNDKSDELREPQPLD-FGDVRKAWDCDYV 248
               ++ C W   +     ++S   T  +H+  +++  +   +  D F  +  +    Y 
Sbjct: 248 ----VNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTIINSIKTTDPFNTLAFSKHSQY- 302

Query: 249 VDIYPGLIATGKTQENAGELRLIPFKNEKIYTEKCFVIP----HAHGDEVVRDIFISAHQ 304
                 L+A       AG   L+      +Y  +   +P    + H D +  ++  S H 
Sbjct: 303 ------LMAA------AGTDSLV-----YLYDSRNLSVPLYSMNGHEDSIT-NLEFSPHT 344

Query: 305 SDMLYSCGEDGYVKIW 320
             +L S G D  V +W
Sbjct: 345 DGVLISSGNDRRVIMW 360

>SAKL0E00814g Chr5 complement(59724..60920) [1197 bp, 398 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 398

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 56/204 (27%), Positives = 91/204 (44%), Gaps = 19/204 (9%)

Query: 5   SLVESNFFGSEN-WCLKLQPSYKHGLLTGLSNGEIRLLD--WATCKSLQNIKASETAIND 61
           +LV  + F  +N + L   P  K  LL+   +G I L +         + +   E  +ND
Sbjct: 152 ALVSEHAFHKDNGYGLSFNPRTKGELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVND 211

Query: 62  LKVIDSDFSAGHLVSSASIDAVKVFDIRTNSCIATIQNESNSPFLSLD-SRH--GLLACG 118
                 +F+     S +    +++ D RTNS +  +    +SPF +LD S+H   L A  
Sbjct: 212 CTW--HEFNENLFGSVSEDKTLQIHDKRTNSTVHRLT--LSSPFNTLDFSKHSQNLFAAA 267

Query: 119 TELQGIDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDL 178
               G D+ V++YD+R     L ++   H D VT ++F P    IL S  +D    ++DL
Sbjct: 268 ----GTDSLVYLYDLRNTADALHTM-SGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDL 322

Query: 179 KQ----DEEEDALHQVINYASIHS 198
            Q      +EDA   V     +H+
Sbjct: 323 MQIGSEQAQEDAADGVPELMMMHA 346

>KLLA0D00814g Chr4 complement(76687..77913) [1227 bp, 408 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 408

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 48/185 (25%), Positives = 81/185 (43%), Gaps = 22/185 (11%)

Query: 1   MASYSLVESNFFGSENWCLKLQPSYKHGLLTGLSNGEIRLLDWATCKSLQNIKASET--- 57
           +AS+S  + N +G     L   P+    LL+   +G + L D     S  N   S+T   
Sbjct: 162 IASFSYHKENGYG-----LAFNPTVSGQLLSASDDGTVALWD---VTSTANKSPSQTFDV 213

Query: 58  ---AINDLKVIDSDFSAGHLVSSASIDAVKVFDIRTNSCIATIQNESNSPFLSLDSR-HG 113
               +ND K    +F +    + +  + + + D  ++  I  +   S    L+   R   
Sbjct: 214 HTDIVNDCKW--HEFQSSLFGTVSEDNTLIIHDTNSDRAIQKLSVSSAFNTLAFSKRSEN 271

Query: 114 LLACGTELQGIDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYT 173
           LLA      G D+ V++YD+R+   PL S+   H D VT ++F P    +L S  +D   
Sbjct: 272 LLAAA----GTDSNVYLYDLRRLQKPLHSMA-GHEDSVTSLEFSPHQDGLLTSSGSDRRI 326

Query: 174 NIYDL 178
            ++DL
Sbjct: 327 IMWDL 331

>KNAG0E00980 Chr5 complement(186207..187451) [1245 bp, 414 aa] {ON}
           Anc_6.9 YEL056W
          Length = 414

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 53/190 (27%), Positives = 86/190 (45%), Gaps = 26/190 (13%)

Query: 17  WCLKLQPSYKHGLLTGLSNGEIRLLDWAT-----CKSLQNIKASETAINDLKVIDSDFSA 71
           + L   P  K  LL+G  +  + L D  +      +  +NI +    +ND +  +   S 
Sbjct: 180 YGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSD--IVNDCQWHNFQKSL 237

Query: 72  GHLVSSASIDAVKVFDIRTNSCIATIQNESNSPFLSLDSRH---GLLACGTELQGIDAAV 128
              VS  S  ++++ D R +  +ATI      PF +L   H    LLA G    G+++ V
Sbjct: 238 FGTVSEDS--SLQIHDTRESKPVATIN--GTKPFNTLSFSHHSENLLATG----GVNSEV 289

Query: 129 HIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQ-------D 181
           ++YD R  + PL  L+  H D VT + F   D  I+LS   D    I+D+         +
Sbjct: 290 YLYDRRYVEEPLH-LMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGAEQVLE 348

Query: 182 EEEDALHQVI 191
           + EDA  +V+
Sbjct: 349 DAEDATSEVM 358

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 48/202 (23%), Positives = 78/202 (38%), Gaps = 26/202 (12%)

Query: 126 AAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQDEEED 185
             V+IYD           +  H D+   + F+P     LLSGS D    ++D+  D  E 
Sbjct: 154 GTVYIYDRSNERDTASITLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNE- 212

Query: 186 ALHQVINYASIHS-----CGWLSPKR--IYTLSHMETFAIHELNDKSDELREPQPLDFGD 238
               V  + +IHS     C W + ++    T+S   +  IH       + RE +P+   +
Sbjct: 213 ---PVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIH-------DTRESKPVATIN 262

Query: 239 VRKAWDCDYVVDIYPGLIATGKTQENAGELRLIPFKNEKIYTEKCFVIPHAHGDEVVRDI 298
             K ++          L+ATG             +  ++ Y E+   +   H D V    
Sbjct: 263 GTKPFNTLSFSHHSENLLATGGVNSEV-------YLYDRRYVEEPLHLMSGHTDAVTSLD 315

Query: 299 FISAHQSDMLYSCGEDGYVKIW 320
           F S+    ++ S G D  V IW
Sbjct: 316 F-SSQDDGIILSAGADKRVIIW 336

>KAFR0L00320 Chr12 (56449..57624) [1176 bp, 391 aa] {ON} Anc_6.9
           YEL056W
          Length = 391

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 53/186 (28%), Positives = 86/186 (46%), Gaps = 19/186 (10%)

Query: 1   MASYSLVESNFFGSENWCLKLQPSYKHGLLTGLSNGEIRLLDWATCKSLQNIKASETA-- 58
           + +YS  + N +G     L   P  K  LL+   +G I + D    +S   ++  ++   
Sbjct: 144 VKTYSYHKDNGYG-----LSFNPISKGQLLSAADDGYIAMYD-INAESEDPVETWQSTDN 197

Query: 59  --INDLKVIDSDFSAGHLVSSASIDAVKVFDIRTNSCIATIQNES--NSPFLSLDSRHGL 114
             IND+K    D +    VS    + + ++D+RT   + +I+ E   NS   S  S++  
Sbjct: 198 CIINDIKWHHFDATLFGTVSEEK-NTLSIYDLRTKDKVTSIEMEQPFNSLAFSKHSKNLF 256

Query: 115 LACGTELQGIDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTN 174
            A GT     D  V++YD+R     L S+   H   VT ++FH S   IL+S S D    
Sbjct: 257 SAAGT-----DQNVYLYDLRNTRKTLHSM-SGHEGPVTNLEFHDSVDGILVSSSEDRRII 310

Query: 175 IYDLKQ 180
           I+DL +
Sbjct: 311 IWDLME 316

 Score = 34.3 bits (77), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 32/60 (53%), Gaps = 1/60 (1%)

Query: 125 DAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQDEEE 184
           +  V I+D    D+P+++    H D+   + F+P     LLS + DGY  +YD+  + E+
Sbjct: 129 NGTVSIFDRNSSDSPVKTY-SYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDINAESED 187

>TBLA0H03650 Chr8 (888840..890099) [1260 bp, 419 aa] {ON} Anc_8.548
           YBR195C
          Length = 419

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 44/184 (23%), Positives = 88/184 (47%), Gaps = 18/184 (9%)

Query: 18  CLKL--QPSYKHGLLTGLSNGEIRLLDWATCKSLQNIKAS----ETAINDLKVIDSDFSA 71
           CL +   P  +  LL+  SNG I L D+    S +N + +    +T  +DL   +  +  
Sbjct: 198 CLSIAWNPQQEGQLLSCESNGNIHLWDFQKEFSSKNREINNTIWDTNFDDLGCNEVTWMN 257

Query: 72  GH---LVSSASIDAVKVFDIRTNSCIATIQNESNSPFLS---LDSRHGLLACGTELQGID 125
           GH     +    + + VFD R    + +I+  +++  ++    +  + +L    +  GI 
Sbjct: 258 GHNSIFATCGENNKMAVFDTRKEGIVNSIEQGNHNGGINSCKFNYENAMLLASGDSNGI- 316

Query: 126 AAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGST-DGYTNIYDLKQDEEE 184
             ++++DIRK + P+R+L   H   ++ I++ P    ++ SG   DG   ++D+  +EE 
Sbjct: 317 --INLWDIRKLNKPIRNLY--HGSSISTIEWSPLMNEMIASGGQEDGLVKLWDISNEEEP 372

Query: 185 DALH 188
             +H
Sbjct: 373 IFIH 376

>KLLA0E04819g Chr5 (428278..429657) [1380 bp, 459 aa] {ON} similar
           to uniprot|P20053 Saccharomyces cerevisiae YPR178W PRP4
           Splicing factor component of the U4/U6-U5 snRNP complex
          Length = 459

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 74/141 (52%), Gaps = 18/141 (12%)

Query: 72  GHLVSSASIDAVK-VFDIRTNSCIATIQNESNSPFLSLD-SRHGL-LACGTELQGIDAAV 128
           G LVS+A +DA+  ++DIR+   I ++Q  S  P  S+D S++G  LA G+     D  +
Sbjct: 317 GSLVSTAGLDAIALIWDIRSGKNIMSLQGHSK-PIYSVDWSQNGYQLASGSG----DGTI 371

Query: 129 HIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYD----LKQDEEE 184
            ++DIRK        I +H+  V+ +KF+  +   L+S   D   NI++    +K+   E
Sbjct: 372 KVWDIRKKGNV--ETILAHNSIVSQVKFNKQNGGYLVSSGYDKKVNIFNDGNWIKERSLE 429

Query: 185 DALHQVINY----ASIHSCGW 201
             L +V++       I+S GW
Sbjct: 430 GHLDKVMSIDIVGPDIYSAGW 450

>TBLA0A07120 Chr1 complement(1765718..1766941) [1224 bp, 407 aa]
           {ON} Anc_6.9 YEL056W
          Length = 407

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 57/212 (26%), Positives = 95/212 (44%), Gaps = 29/212 (13%)

Query: 17  WCLKLQPSYKHGLLTGLSNGEIRLLDWATCKSLQNIKASETAI-NDLKVIDSDFSAGHLV 75
           + L   P  K  LL+   +G +    W   KS+  +   ET+I ND++    + +    V
Sbjct: 173 YGLAFNPLDKGKLLSSSDDGSVAY--WNIQKSIPLLTLQETSIINDVRWNQFNQNLFGYV 230

Query: 76  SSASIDAVKVFDIRTNSC-IATIQNES-------NSPFLSLDSRHGLLACGTELQGIDAA 127
           + +S   +K  D+R N+  +  + N         N+   S  S + + A G      D+ 
Sbjct: 231 TESSCLNLK--DVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGE-----DSL 283

Query: 128 VHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQ------- 180
           +++YD R  + PL   +  H D VT + FH  +  I++SG +D    ++DLKQ       
Sbjct: 284 IYLYDTRNLNQPLH-YMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQEQTS 342

Query: 181 DEEEDALHQVINYASIHSCGWLSPKRIYTLSH 212
           DE ED    V     IH  G  SP   +++S+
Sbjct: 343 DEIEDG--DVPELLMIH-AGHRSPINDFSMSN 371

>KNAG0F03870 Chr6 complement(731884..733281) [1398 bp, 465 aa] {ON}
           Anc_7.534 YPR178W
          Length = 465

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/108 (30%), Positives = 58/108 (53%), Gaps = 9/108 (8%)

Query: 72  GHLVSSASIDAVK-VFDIRTNSCIATIQNESNSPFLSLD--SRHGLLACGTELQGIDAAV 128
           G L+ S  +D++  V+D+R+   I T+Q  +  P   +D  S    LA G    G D  V
Sbjct: 320 GALICSGGLDSLAMVWDLRSGKNIVTLQGHAK-PVYCVDWSSNSHQLATG----GGDGVV 374

Query: 129 HIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIY 176
           +++D+RK + P   L+ +H   V+ ++F  +  ++L+SG  D   N+Y
Sbjct: 375 NVWDLRKLEQPATKLL-AHKSIVSSLRFERNRGDVLVSGGYDRALNVY 421

 Score = 35.4 bits (80), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 36/158 (22%), Positives = 76/158 (48%), Gaps = 11/158 (6%)

Query: 29  LLTGLSNGEIRLLDWATCKSLQNIKASETAINDLKVIDSDF-SAGHLVSSASIDAV-KVF 86
           L+TG  +  +RL  +   +S   +  +    ++ +V+++ F  +   V+SAS D   +++
Sbjct: 235 LVTGADDNYVRLTRY-NGESNGLVNVATLGGHENRVVNTVFHPSDKYVASASFDTTWRLW 293

Query: 87  DIRTNSCIATIQNESNSPF-LSLDSRHGLLACGTELQGIDAAVHIYDIRKWDTPLRSLID 145
           D+ T   +   +  S   + LS      L+  G    G+D+   ++D+R     +   + 
Sbjct: 294 DVETAQELQLQEGHSKEVYSLSFQPDGALICSG----GLDSLAMVWDLRSGKNIV--TLQ 347

Query: 146 SHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQDEE 183
            H   V C+ +  S+ + L +G  DG  N++DL++ E+
Sbjct: 348 GHAKPVYCVDW-SSNSHQLATGGGDGVVNVWDLRKLEQ 384

>Smik_11.298 Chr11 complement(497968..499956) [1989 bp, 662 aa] {ON}
           YKR036C (REAL)
          Length = 662

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 56/115 (48%), Gaps = 8/115 (6%)

Query: 25  YKHGLLTGLSNGEIRLLDWATCKSLQNIKASETAINDLKVIDSDFSAGHLVSSASIDAVK 84
           YK  L TG  +G +RL D    K ++ ++     I  LK     F +  LV+ +  ++V+
Sbjct: 517 YKSALATGTKDGIVRLWDLRVGKPVRLLRGHTDGITSLK-----FDSEKLVTGSMDNSVR 571

Query: 85  VFDIRTNSCIATIQNESNSPFLSLDSRHGLLACGTELQGIDAAVHIYDIRKWDTP 139
           ++D+RT+S +  I    + P  SLD    L+A G   +G++      D   W TP
Sbjct: 572 IWDLRTSSVVDVIA--YDLPVTSLDFDDKLIAVGANERGVNVFNMELD-EHWMTP 623

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 50/200 (25%), Positives = 87/200 (43%), Gaps = 47/200 (23%)

Query: 18  CLKLQPSYKHGLLTGLSNGEIRLLDWATCKSL--------QNIKASETA------INDLK 63
           C++L  +  + L+TG  +  ++L D    K L        QN++ + T       I+D +
Sbjct: 386 CMQLDAANHNMLITGSKDATLKLWDLNLSKELYLDHTPLKQNMEQNPTPCIHNFEIHDDE 445

Query: 64  VIDSDFSAGHLVSSASIDAVKVFDIRTNSCI-------ATIQNES--------------- 101
           +    F +  L+S +    +  +D+ T  CI       A   N+S               
Sbjct: 446 ITALSFDSEALISGSKDKKILHWDMATGKCIQQLDLIFAPTHNDSRISAPSSNYSTRLLD 505

Query: 102 -NSPFL-SLDSRHGLLACGTELQGIDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPS 159
            ++P + +L      LA GT+    D  V ++D+R    P+R L+  H D +T +KF   
Sbjct: 506 TDAPMIGALQCYKSALATGTK----DGIVRLWDLR-VGKPVR-LLRGHTDGITSLKF--- 556

Query: 160 DVNILLSGSTDGYTNIYDLK 179
           D   L++GS D    I+DL+
Sbjct: 557 DSEKLVTGSMDNSVRIWDLR 576

>Skud_5.33 Chr5 (46184..47389) [1206 bp, 401 aa] {ON} YEL056W (REAL)
          Length = 401

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 56/205 (27%), Positives = 94/205 (45%), Gaps = 23/205 (11%)

Query: 11  FFGSENWCLKLQPSYKHGLLTGLSNGEIRLLDWAT-CKSLQNIKASETAINDLKVIDSDF 69
           F     + L   P  K  LL+G  +  + L D +    S   I+  +   +D+ V DS +
Sbjct: 158 FHKDNGYALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDI-VNDSKW 216

Query: 70  SAGH--LVSSASIDAV-KVFDIRT-NSCIATIQNESNSPFLSLDSRH---GLLACGTELQ 122
              +  L  + S D++ K+ DIR  N+ I T +     PF +L   H    +LA      
Sbjct: 217 HNFNKDLFGTVSEDSLLKINDIRAENTTIDTAK--CPQPFNTLAFSHHSSNILAAA---- 270

Query: 123 GIDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQ-- 180
           G+D+ V++YD+R    PL  +   H D VT ++F P    +++S  +D    ++DLKQ  
Sbjct: 271 GMDSHVYLYDLRNMKEPLHHM-SGHEDAVTNLEFSPHVDGVVVSSGSDNRLIMWDLKQIG 329

Query: 181 -----DEEEDALHQVINYASIHSCG 200
                D+ ED + ++I   + H   
Sbjct: 330 AEQTPDDAEDGVPELIMVHAGHRSA 354

>SAKL0F08404g Chr6 complement(640436..642367) [1932 bp, 643 aa] {ON}
           similar to uniprot|P39014 Saccharomyces cerevisiae
           YIL046W MET30 F-box protein containing five copies of
           the WD40 motif controls cell cycle function sulfur
           metabolism and methionine biosynthesis as part of the
           ubiquitin ligase complex interacts with and regulates
           Met4p localizes within the nucleus
          Length = 643

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 40/177 (22%), Positives = 81/177 (45%), Gaps = 15/177 (8%)

Query: 5   SLVESNFFGSENWCLKLQPSYKHGLLTGLSNGEIRLLDWATCKSLQNIKASETAINDLKV 64
           S V   F G  +  L LQ ++++ L TG  +  + + D  + K ++ +      +  +  
Sbjct: 322 SCVIQEFKGHMDGVLSLQFNHRY-LFTGSYDSTVAIWDLCSGKLIRRLTGHHDGVKSVYF 380

Query: 65  IDSDFSAGHLVSSASIDAVKVFDIRTNSCIATIQNESNSPFLSLDSRHGLLACGTELQGI 124
            D     G L  +     ++V++ +T +CI+T +  S+S  LS+DS   ++  G+     
Sbjct: 381 DDQKLITGSLDKT-----IRVWNYQTGACISTYRGHSDS-VLSVDSYKKIIVSGSA---- 430

Query: 125 DAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQD 181
           D  V ++ +   ++     +  H + V C+K HP       SGS D    ++D++ +
Sbjct: 431 DKTVKVWHV---ESRTCYTLRGHSEWVNCVKLHPKSFT-CFSGSDDTTIRMWDIRSN 483

>TBLA0D04130 Chr4 (1027726..1029450) [1725 bp, 574 aa] {ON}
           Anc_7.231 YIL046W
          Length = 574

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 78/172 (45%), Gaps = 15/172 (8%)

Query: 11  FFGSENWCLKLQPSYKHGLLTGLSNGEIRLLDWATCKSLQNIKASETAINDLKVIDSDFS 70
           F G  +  L LQ +Y+  L TG  +  I + D  + K ++ +      I  L      F 
Sbjct: 236 FKGHMDGVLTLQFNYRL-LFTGSYDSTIAIWDLYSGKLIRRLNGHSDGIKTLY-----FD 289

Query: 71  AGHLVSSASIDAVKVFDIRTNSCIATIQNESNSPFLSLDSRHGLLACGTELQGIDAAVHI 130
              L++ +    ++V+D +   CI+T +  S+S  LS+D    L+  G+     D +V +
Sbjct: 290 ENKLITGSLDKTIRVWDYKGGRCISTYKGHSDS-ILSVDCYKKLIVSGSA----DCSVKV 344

Query: 131 YDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQDE 182
           + I +        +  H + V C+K HP+  +   S S D    ++DL+ ++
Sbjct: 345 WHIERRTC---YTLKGHTEWVNCVKLHPTSFS-CFSASDDCTIRMWDLRSNK 392

>ZYRO0A08690g Chr1 (691253..692803) [1551 bp, 516 aa] {ON} highly
           similar to uniprot|Q04225 Saccharomyces cerevisiae
           YMR131C RRB1 RiboSome Assembly 2
          Length = 516

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 51/195 (26%), Positives = 91/195 (46%), Gaps = 21/195 (10%)

Query: 10  NFFGSENWCLKLQPSYKHG-LLTGLSNGEIRLLDWATCKSLQNIKASETAINDLKVIDSD 68
           N    E + L   P  K G LLTG  +G+I L    T K + + K   TA N+  V D  
Sbjct: 275 NHGNVEGYGLDWSPLIKTGALLTGDCSGQIFLTQRHTSKWITD-KQPFTAANNQSVEDIQ 333

Query: 69  FSAGH---LVSSASIDAVKVFDIRTNS---CIATIQNESNSPFLSLDSRHG-LLACGTEL 121
           +S        +S +   V+++D R+      I+T  + ++   +S + + G LLA G + 
Sbjct: 334 WSPTESTVFATSGTDGYVRIWDTRSKKHKPAISTRASNTDVNVISWNEKLGYLLASGDD- 392

Query: 122 QGIDAAVHIYDIRKWDTPLRS-------LIDSHHDDVTCIKFHPSDVNILLSGSTDGYTN 174
              + +  ++D+R++ +P  S         D H   +T I F+P D +++   S D    
Sbjct: 393 ---NGSWGVWDLRQF-SPANSEGVQPVAQYDFHRGPITSISFNPLDDSVVAVASEDNTVT 448

Query: 175 IYDLKQDEEEDALHQ 189
           ++DL  + ++D + Q
Sbjct: 449 LWDLSVEADDDEIQQ 463

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 27/116 (23%), Positives = 50/116 (43%), Gaps = 6/116 (5%)

Query: 90  TNSCIATIQNESNSPFLSLDSRHGLLACGTELQGIDAAVHIY----DIRKWDTPLRSLID 145
           +   I TI+N  N     LD    L+  G  L G D +  I+       KW T  +    
Sbjct: 266 SRKAIHTIRNHGNVEGYGLD-WSPLIKTGALLTG-DCSGQIFLTQRHTSKWITDKQPFTA 323

Query: 146 SHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQDEEEDALHQVINYASIHSCGW 201
           +++  V  I++ P++  +  +  TDGY  I+D +  + + A+    +   ++   W
Sbjct: 324 ANNQSVEDIQWSPTESTVFATSGTDGYVRIWDTRSKKHKPAISTRASNTDVNVISW 379

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 38/76 (50%), Gaps = 5/76 (6%)

Query: 247 YVVDIYPGLIATGK--TQENAGELRLIPFKNEKIYTEKCFVIPHAHGDEVVRDIFISAHQ 304
           Y +D  P LI TG   T + +G++ L      K  T+K      A  ++ V DI  S  +
Sbjct: 282 YGLDWSP-LIKTGALLTGDCSGQIFLTQRHTSKWITDKQPFT--AANNQSVEDIQWSPTE 338

Query: 305 SDMLYSCGEDGYVKIW 320
           S +  + G DGYV+IW
Sbjct: 339 STVFATSGTDGYVRIW 354

>Suva_11.268 Chr11 complement(492639..494576) [1938 bp, 645 aa] {ON}
           YKR036C (REAL)
          Length = 645

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/178 (23%), Positives = 81/178 (45%), Gaps = 24/178 (13%)

Query: 9   SNFFGSENWCLKLQPSYKHGLLTGLSNGEIRLLDWATCKSLQNIKASETAINDLKVIDSD 68
           ++  GSE   +     Y   L +G  +G +RL D    K ++ ++     I  LK     
Sbjct: 484 TSVLGSEAPMIGALQCYNSALASGTKDGVVRLWDLRIGKPVRALEGHTDGITSLK----- 538

Query: 69  FSAGHLVSSASIDAVKVFDIRTNSCIATIQNESNSPFLSLDSRHGLLACGTELQGIDAAV 128
           F +  LV+ +  ++V+++D+RT+S I  I    + P  SLD    L+  G    G    V
Sbjct: 539 FDSEKLVTGSMDNSVRIWDLRTSSIIDVIA--YDLPITSLDFDDKLITVGANETG----V 592

Query: 129 HIYDIRK---WDTP-----LRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDL 178
           +++++ +   W TP     L+   D   + +  +K+       L++G  +G  N++ +
Sbjct: 593 NVFNMERDEHWMTPEPPNSLKG--DEASERIAIVKYKDG---FLINGHNNGDINVWSI 645

>KLLA0E07085g Chr5 (645766..647124) [1359 bp, 452 aa] {ON} similar
           to uniprot|P42841 Saccharomyces cerevisiae YNL317W PFS2
           Integral subunit of the pre-mRNA cleavage and
           polyadenylation factor (CPF) complex plays an essential
           role in mRNA 3'-end formation by bridging different
           processing factors and thereby promoting the assembly of
           the processing complex
          Length = 452

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/142 (26%), Positives = 63/142 (44%), Gaps = 20/142 (14%)

Query: 61  DLKVIDSDFSAGHLVSSASIDAVKVFDIRTNSCIATIQNESNSPFLSLDSRHGLLAC--- 117
           D+K  D     G +VS +  + +K +D R+ SC++T+          L  +H +++    
Sbjct: 209 DVKSCDWHPKMGLIVSGSKDNLIKFWDPRSGSCVSTM----------LGFKHTIISTKFQ 258

Query: 118 ---GTELQGI--DAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGY 172
              G  L  I  D    +YDIR+    L S+ D    D   +++HP D  +   G  DG 
Sbjct: 259 PKQGNLLSVISKDKTCKVYDIRQQAKELFSVRDD--VDYMTLQWHPIDETVFTVGCYDGS 316

Query: 173 TNIYDLKQDEEEDALHQVINYA 194
              +DL Q+ + +     I YA
Sbjct: 317 IKHFDLSQENQPNKPTHNIPYA 338

>Suva_5.12 Chr5 (23273..24478) [1206 bp, 401 aa] {ON} YEL056W (REAL)
          Length = 401

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 37/129 (28%), Positives = 61/129 (47%), Gaps = 18/129 (13%)

Query: 83  VKVFDIRT-NSCIATIQNESNSPFLSLDSRH---GLLACGTELQGIDAAVHIYDIRKWDT 138
           +K+ D+R  N+   T +     PF +L   H    LLA      G D+ V++YD+R    
Sbjct: 233 LKINDLRVENTTTGTAK--CPEPFNTLAFSHHSSNLLAAA----GTDSHVYLYDLRNMKE 286

Query: 139 PLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQ-------DEEEDALHQVI 191
           PL  +   H D VT ++F P    +++S  +D    ++DLKQ       D+ ED + ++I
Sbjct: 287 PLHHM-SGHEDAVTNLEFSPHVDGVVVSSGSDNRLIMWDLKQIGAEQTPDDAEDGVPELI 345

Query: 192 NYASIHSCG 200
              + H   
Sbjct: 346 MVHAGHKSA 354

>TBLA0H03060 Chr8 complement(748221..750413) [2193 bp, 730 aa] {ON}
           Anc_1.247 YKR036C
          Length = 730

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 41/68 (60%), Gaps = 9/68 (13%)

Query: 115 LACGTELQGIDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTN 174
           LA GT+    D  + ++D+R  +   R LI  H D +T +KF   D N ++SGS DG T 
Sbjct: 594 LATGTK----DGIIRLWDLRSGEIA-RKLI-GHQDAITSLKF---DTNNIISGSLDGSTR 644

Query: 175 IYDLKQDE 182
           I+DL+QD+
Sbjct: 645 IWDLRQDQ 652

>TDEL0D01310 Chr4 complement(251119..253248) [2130 bp, 709 aa] {ON}
           Anc_1.247 YKR036C
          Length = 709

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 43/140 (30%), Positives = 63/140 (45%), Gaps = 30/140 (21%)

Query: 69  FSAGHLVSSASIDAVKVFDIRTNSCIATI---------QNESN-----------SPFL-S 107
           F +GHLVS +    V+ +D+ +  C+ TI         Q  SN           SP + +
Sbjct: 506 FDSGHLVSGSQDRTVRQWDLTSGKCLQTIDLSFAGRLSQTSSNSGSGLLTSTDTSPIIGA 565

Query: 108 LDSRHGLLACGTELQGIDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSG 167
           L      LA GT     D AV ++D+R     +R+L + H   VT +KF   D   L++G
Sbjct: 566 LQCFDAALATGTR----DGAVRLWDLRSGKI-IRTL-EGHTGAVTSLKF---DSKNLITG 616

Query: 168 STDGYTNIYDLKQDEEEDAL 187
           S D    I+DL+     DA 
Sbjct: 617 SLDRSVRIWDLRTGTLADAF 636

>Kpol_1041.20 s1041 complement(56019..57566) [1548 bp, 515 aa] {ON}
           complement(56019..57566) [1548 nt, 516 aa]
          Length = 515

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 47/194 (24%), Positives = 91/194 (46%), Gaps = 20/194 (10%)

Query: 10  NFFGSENWCLKLQPSYKHG-LLTGLSNGEIRLLDWATCKSLQNIKASETAINDLKVIDSD 68
           N    E + L   P  + G LLTG  +G++      T K + + K   T  N+  + D  
Sbjct: 275 NHGNVEGYALDWSPLIRSGALLTGDCSGQVYFTQRHTSKWVTD-KQPFTVSNNKSIEDIQ 333

Query: 69  FS--AGHLVSSASIDA-VKVFDIRTNS---CIATIQNESNSPFLSLDSRHG-LLACGTEL 121
           +S     + ++A  D  ++V+D R+      I+T  + ++   +S + + G LLA G + 
Sbjct: 334 WSRTEATVFATAGCDGYIRVWDTRSKKHKPAISTKASNTDVNVISWNEKMGYLLASGDD- 392

Query: 122 QGIDAAVHIYDIRKWD------TPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNI 175
              +    ++D+R++        P+ +  D H   +T I FHP+D +I+   S D    +
Sbjct: 393 ---NGTWGVWDLRQFSPSNENAQPV-AQYDFHKGAITSISFHPTDESIVAVASEDNTVTL 448

Query: 176 YDLKQDEEEDALHQ 189
           +DL  + +++ + Q
Sbjct: 449 WDLSVEADDEEIKQ 462

 Score = 32.0 bits (71), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 52/247 (21%), Positives = 96/247 (38%), Gaps = 22/247 (8%)

Query: 94  IATIQNESNSPFLSLDSRHGLLACGTELQGIDAAVHIYDIR----KWDTPLRSLIDSHHD 149
           I TI+N  N    +LD    L+  G  L G D +  +Y  +    KW T  +    S++ 
Sbjct: 270 IHTIRNHGNVEGYALD-WSPLIRSGALLTG-DCSGQVYFTQRHTSKWVTDKQPFTVSNNK 327

Query: 150 DVTCIKFHPSDVNILLSGSTDGYTNIYDLKQDEEEDALHQVINYASIHSCGWLSPKRIYT 209
            +  I++  ++  +  +   DGY  ++D +  + + A+    +   ++   W + K  Y 
Sbjct: 328 SIEDIQWSRTEATVFATAGCDGYIRVWDTRSKKHKPAISTKASNTDVNVISW-NEKMGYL 386

Query: 210 LSHME---TFAIHELNDKSDELREPQPLDFGDVRKAWDCDYVVDIYPGLIATGKTQENAG 266
           L+  +   T+ + +L   S      QP+   D  K              I    +++N  
Sbjct: 387 LASGDDNGTWGVWDLRQFSPSNENAQPVAQYDFHKGAITSISFHPTDESIVAVASEDNTV 446

Query: 267 ELRLIP-------FKNEKIYTEKCFVIP----HAHGDEVVRDIFISAHQSDMLYSCGEDG 315
            L  +         K +   T++   IP      H  + V+D+         L S G DG
Sbjct: 447 TLWDLSVEADDEEIKQQTAETKELAQIPPQLLFVHWQKEVKDVKWHKQIPGCLVSTGTDG 506

Query: 316 YVKIWKS 322
            + IWK+
Sbjct: 507 -LNIWKT 512

>SAKL0C13266g Chr3 complement(1171961..1173340) [1380 bp, 459 aa]
           {ON} highly similar to uniprot|Q75AV4 Ashbya gossypii
           ADL184W PSF2 Polyadenylation factor subunit 2 and
           similar to YNL317W uniprot|P42841 Saccharomyces
           cerevisiae YNL317W PFS2 Integral subunit of the pre-mRNA
           cleavage and polyadenylation factor (CPF) complex plays
           an essential role in mRNA 3'-end formation by bridging
           different processing factors and thereby promoting the
           assembly of the processing complex
          Length = 459

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 38/136 (27%), Positives = 63/136 (46%), Gaps = 8/136 (5%)

Query: 61  DLKVIDSDFSAGHLVSSASIDAVKVFDIRTNSCIATIQNESNSPFLS--LDSRHGLLACG 118
           D+K  D   + G +VS +  + +K++D R+  CI+TI    ++   +    ++  LLA  
Sbjct: 209 DVKSCDWHPTMGLIVSGSKDNLIKLWDPRSGQCISTILGFKHTIIKTKFQPTKGNLLAVV 268

Query: 119 TELQGIDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDL 178
            +    D +  I+DIR+    L+S  D    D   + +HP + +I   G  DG    +DL
Sbjct: 269 AK----DKSCKIFDIRQNMKELKSFRD--ESDYMSLTWHPINESIFTVGCYDGSLKHFDL 322

Query: 179 KQDEEEDALHQVINYA 194
            QD         I YA
Sbjct: 323 LQDTGSSNSFHDIPYA 338

>YEL056W Chr5 (47168..48373) [1206 bp, 401 aa] {ON}  HAT2Subunit of
           the Hat1p-Hat2p histone acetyltransferase complex;
           required for high affinity binding of the complex to
           free histone H4, thereby enhancing Hat1p activity;
           similar to human RbAp46 and 48; has a role in telomeric
           silencing
          Length = 401

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 62/126 (49%), Gaps = 18/126 (14%)

Query: 83  VKVFDIRTN-SCIATIQNESNSPFLSLDSRH---GLLACGTELQGIDAAVHIYDIRKWDT 138
           +K+ D+R N + I T++     PF +L   H    LLA      G+D+ V++YD+R    
Sbjct: 233 LKINDVRANNTTIDTVK--CPQPFNTLAFSHHSSNLLAAA----GMDSYVYLYDLRNMKE 286

Query: 139 PLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQ-------DEEEDALHQVI 191
           PL  +   H D V  ++F      +++S  +D    ++DLKQ       D+ ED + ++I
Sbjct: 287 PLHHM-SGHEDAVNNLEFSTHVDGVVVSSGSDNRLMMWDLKQIGAEQTPDDAEDGVPELI 345

Query: 192 NYASIH 197
              + H
Sbjct: 346 MVHAGH 351

>KLTH0E12694g Chr5 (1126940..1128196) [1257 bp, 418 aa] {ON} similar
           to uniprot|P13712 Saccharomyces cerevisiae YBR195C MSI1
           Subunit of chromatin assembly factor I (CAF- I)
           regulates the RAS/cAMP pathway via sequestration of
           Npr1p kinase localizes to the nucleus and cytoplasm
           homologous to human retinoblastoma binding proteins
           RbAp48 and RbAp46
          Length = 418

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 45/75 (60%), Gaps = 6/75 (8%)

Query: 114 LLACGTELQGIDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTD-GY 172
           +L C  +  G    ++++DIR +  PL++L+  H+D ++ ++++P +  +L +G  D G 
Sbjct: 304 MLLCSADSAG---RINLWDIRNFTQPLKTLL--HNDSISVLQWNPREPTVLATGGQDGGL 358

Query: 173 TNIYDLKQDEEEDAL 187
             I+DL Q E ++ +
Sbjct: 359 VKIWDLSQPEGQELI 373

>KNAG0D01690 Chr4 (286791..288755) [1965 bp, 654 aa] {ON} Anc_7.231
           YIL046W
          Length = 654

 Score = 43.1 bits (100), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 38/172 (22%), Positives = 80/172 (46%), Gaps = 17/172 (9%)

Query: 11  FFGSENWCLKLQPSYKHGLLTGLSNGEIRLLDWATCKSLQNIKASETAINDLKVIDSDFS 70
           F G  +  L ++ +++  L TG  +G + + D  T K ++ +   +  +  L      F 
Sbjct: 274 FKGHMDGILSMKFNFRF-LFTGSYDGTVAIWDLFTGKLIRRLNGHQDGVKTL------FF 326

Query: 71  AGHLVSSASID-AVKVFDIRTNSCIATIQNESNSPFLSLDSRHGLLACGTELQGIDAAVH 129
            G  + + S+D  ++V++  T  CI+T +  +NS  +S+DS   ++  G+     D  V 
Sbjct: 327 DGQKLITGSLDKTIRVWNYMTGECISTYRGHTNS-VMSVDSFKKIIVSGSA----DKTVK 381

Query: 130 IYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQD 181
           ++ +   ++     +  H + V C+K HP       S S D    ++D++ +
Sbjct: 382 VWHV---ESRTCYTLRGHSEWVNCVKLHPKSF-CCFSCSDDTTIRMWDIRTN 429

>KLTH0F16192g Chr6 (1312331..1313719) [1389 bp, 462 aa] {ON} similar
           to uniprot|P40968 Saccharomyces cerevisiae YDR364C CDC40
           Pre-mRNA splicing factor important for catalytic step II
           of pre-mRNA splicing and plays a role in cell cycle
           progression required for DNA synthesis during mitosis
           and meiosis has WD repeats
          Length = 462

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 37/166 (22%), Positives = 72/166 (43%), Gaps = 8/166 (4%)

Query: 18  CLKLQPSYKHGLLTGLSNGEIRLLDWATCKSLQNIKASETAINDLKVIDSDFSAGHLVSS 77
           C +  P+  + L+ GLSN E+R  D         ++  +  ++ +  +         +SS
Sbjct: 259 CAEFSPANSNELIVGLSNSEVRHYDLRVAHKDGLVQVYDHHLSSIIALKYFPDGSKFISS 318

Query: 78  ASIDAVKVFDIRTNSCIATIQN--ESNSPFLSLDSRHGLLACGTELQGIDAAVHIYDIR- 134
           +   +++++D + N  I  I +  + + PF+ +   H   A     Q +D A++ + ++ 
Sbjct: 319 SEDKSMRIWDNQVNIPIKQISDTAQYSMPFIDIHPEHHYFAT----QSMDNAIYAFSMKP 374

Query: 135 KWDTPLRSLIDSHHDDVTCIKFHPS-DVNILLSGSTDGYTNIYDLK 179
           K+    +   + H      I F  S D   L SG T G   I+D K
Sbjct: 375 KYRRNPKKRFEGHKCAGYGIGFGFSPDGQYLASGDTKGRVYIWDWK 420

>Kwal_55.22076 s55 (1098857..1102717) [3861 bp, 1286 aa] {ON}
           YOL138C - Hypothetical ORF [contig 124] FULL
          Length = 1286

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 36/63 (57%), Gaps = 3/63 (4%)

Query: 123 GIDAAVHIYDIRKWDT---PLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLK 179
           G   +V IYDI K +T   PL +++  H   +  + F+ +  ++L+SGS DG   ++DL+
Sbjct: 185 GTSTSVSIYDINKANTLEGPLTTILSKHTRSINSVDFNMAQSSLLISGSQDGCIKVWDLR 244

Query: 180 QDE 182
             +
Sbjct: 245 SSQ 247

>AGL234W Chr7 (257969..259858) [1890 bp, 629 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR084C (TUP1)
          Length = 629

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 44/159 (27%), Positives = 71/159 (44%), Gaps = 18/159 (11%)

Query: 29  LLTGLSNGEIRLLDWATCKSLQNIKASETAINDLKVIDSDFSAG-HLVSSASIDAVKVFD 87
           L TG  +  IR+ D  T K L  ++  E  I  L      F AG  LVS +    V+++D
Sbjct: 367 LATGAEDKLIRIWDLTTKKILMTLQGHEQDIYSLDY----FPAGDKLVSGSGDRTVRIWD 422

Query: 88  IRTNSCIATIQNESNSPFLSLDSRHG-LLACGTELQGIDAAVHIYD------IRKWDTPL 140
           +RT  C  T+  E     +++    G  +A G+    +D  V ++D      + + D+  
Sbjct: 423 LRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGS----LDRTVRVWDSETGFLVERLDSE- 477

Query: 141 RSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLK 179
             L   H D V  + F   D   ++SGS D    ++DL+
Sbjct: 478 NELSTGHKDSVYSVVFT-RDGQGVISGSLDRSVKLWDLR 515

>Kpol_1028.23 s1028 (63032..65266) [2235 bp, 744 aa] {ON}
           (63032..65266) [2235 nt, 745 aa]
          Length = 744

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 45/179 (25%), Positives = 78/179 (43%), Gaps = 16/179 (8%)

Query: 29  LLTGLSNGEIRLLDWATCKSLQNIKASETAINDLKVIDSDFSAGHLVSSASIDAVKVFDI 88
           L TG  +  IR+ D A  K +  ++  E    D+  +D   S   LVS +    V+++D+
Sbjct: 477 LATGAEDRLIRIWDIAQKKIVMVLQGHE---QDIYSLDYFPSGDKLVSGSGDRTVRIWDL 533

Query: 89  RTNSCIATIQNESNSPFLSLDSRHG-LLACGTELQGIDAAVHIYD------IRKWDTPLR 141
           R   C  T+  E     +++    G  +A G+    +D AV ++D      + + D+   
Sbjct: 534 RNGQCSLTLSIEDGVTTVAVSPGDGKYIAAGS----LDRAVRVWDSETGFLVERLDSE-N 588

Query: 142 SLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQDEEEDALHQVINYASIHSCG 200
            L   H D V  + F   D N ++SGS D    +++L+ D  +D    V     +   G
Sbjct: 589 ELGTGHKDSVYSVVFT-RDGNNVVSGSLDRSVKLWNLRGDNNQDVKPNVPGTCEVTYTG 646

>Ecym_3012 Chr3 complement(24573..25766) [1194 bp, 397 aa] {ON}
           similar to Ashbya gossypii ACR017W
          Length = 397

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 47/174 (27%), Positives = 78/174 (44%), Gaps = 12/174 (6%)

Query: 17  WCLKLQPSYKHGLLTGLSNGEIRLLDWATCKSLQNIKASETAI-NDLKVIDSDFSAGHLV 75
           + L   P  +  LL+   +  + L D  +     +I  + T I ND K  + D +    V
Sbjct: 164 YGLAFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTV 223

Query: 76  SSASIDAVKVFDIRT---NSCIATIQNESNSPFLSLDSRHGLLACGTELQGIDAAVHIYD 132
           S      ++V D R+   ++ +  ++   N+   S  S++ + A GT     D  V++YD
Sbjct: 224 SEDK--TLQVHDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGT-----DTRVYLYD 276

Query: 133 IRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQDEEEDA 186
           +R+   PL ++   H D VT I+F      IL S  +D    I+DL Q   E A
Sbjct: 277 LRRLSEPLHTMA-GHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIGAEQA 329

>ZYRO0D03828g Chr4 (310049..312229) [2181 bp, 726 aa] {ON} similar
           to uniprot|P47025 Saccharomyces cerevisiae YJL112W MDV1
           WD repeat protein that regulates steps in the
           Dnm1p-dependent process of mitochondrial fission
          Length = 726

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 63/140 (45%), Gaps = 30/140 (21%)

Query: 69  FSAGHLVSSASIDAVKVFDIRTNSCIATI---------------QNESNSPFL------S 107
           F +GHLVS +    ++ +D+ T  C+ TI                +   SP +      +
Sbjct: 523 FDSGHLVSGSQDRTLRQWDLSTGKCVQTIDISFASRGQSTSSLASSSLLSPVVEAPVVGA 582

Query: 108 LDSRHGLLACGTELQGIDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSG 167
           L      LA GT+    D  V ++D+R   T +RSL + H D +T +KF   D   L++G
Sbjct: 583 LQCFDAALATGTK----DGIVRLWDMRSGKT-IRSL-EGHTDAITTLKF---DSRNLVTG 633

Query: 168 STDGYTNIYDLKQDEEEDAL 187
           S D    I+DL+     DA 
Sbjct: 634 SLDRSIRIWDLRTGTLADAF 653

>TDEL0A07780 Chr1 complement(1352017..1353990) [1974 bp, 657 aa]
           {ON} Anc_6.363 YCR084C
          Length = 657

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/161 (26%), Positives = 75/161 (46%), Gaps = 16/161 (9%)

Query: 29  LLTGLSNGEIRLLDWATCKSLQNIKASETAINDLKVIDSDFSAGHLVSSASIDAVKVFDI 88
           L TG  +  IR+ D A  + +  ++  E    D+  +D   S   LVS +    V+++D+
Sbjct: 390 LATGAEDRLIRIWDIAKKQIVMVLQGHE---QDIYSLDYFPSGDKLVSGSGDRTVRIWDL 446

Query: 89  RTNSCIATIQNESNSPFLSLDSRHG-LLACGTELQGIDAAVHIYD------IRKWDTPLR 141
           RT  C  T+  E     +++    G  +A G+    +D AV ++D      + + D+   
Sbjct: 447 RTGQCSLTLSIEDGVTTVAVSPGDGKFIAAGS----LDRAVRVWDSETGFLVERLDSE-N 501

Query: 142 SLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQDE 182
            L   H D V  + F   D N ++SGS D    +++L+ D+
Sbjct: 502 ELGTGHKDSVYSVVFT-RDGNGVVSGSLDRSVKLWNLRGDK 541

>Kwal_23.6429 s23 complement(1577398..1579650) [2253 bp, 750 aa]
           {ON} YCR084C (TUP1) - glucose repression regulatory
           protein, exhibits similarity to beta subunits of G
           proteins [contig 17] FULL
          Length = 750

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/158 (26%), Positives = 74/158 (46%), Gaps = 16/158 (10%)

Query: 29  LLTGLSNGEIRLLDWATCKSLQNIKASETAINDLKVIDSDFSAGHLVSSASIDAVKVFDI 88
           L TG  +  IR+ D AT + +  ++  E    D+  +D   S   LVS +    V+++D+
Sbjct: 485 LATGAEDKLIRIWDLATRRIVMTLQGHE---QDIYSLDYFPSGDKLVSGSGDRTVRIWDL 541

Query: 89  RTNSCIATIQNESNSPFLSLDSRHG-LLACGTELQGIDAAVHIYD------IRKWDTPLR 141
           RT  C  T+  E     +++    G L+A G+    +D  V I+D      + + D+   
Sbjct: 542 RTGQCSLTLSIEDGVTTVAVSPGDGKLIAAGS----LDRTVRIWDSETGFLVERLDSE-N 596

Query: 142 SLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLK 179
            L   H D V  + F   D + ++SGS D    +++L+
Sbjct: 597 ELGTGHKDSVYSVVFT-RDGHGVVSGSLDRSVKLWNLR 633

>Kwal_27.12070 s27 (1071472..1072728) [1257 bp, 418 aa] {ON} YBR195C
           (MSI1) - p50 subunit of the yeast Chromatin Assembly
           Factor-I (CAF-I) negative regulator of ras-mediated cAMP
           induction; homologous to beta subunit of GTP-binding
           proteins [contig 24] FULL
          Length = 418

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 42/73 (57%), Gaps = 6/73 (8%)

Query: 114 LLACGTELQGIDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNIL-LSGSTDGY 172
           LL C  +  G    ++++DIR + +P+RSL   HH  V+ ++++P    IL  +G  DG 
Sbjct: 304 LLLCSADSAG---RINLWDIRDFSSPIRSL--DHHGSVSALQWNPHHPTILATAGQDDGL 358

Query: 173 TNIYDLKQDEEED 185
             I+DL Q  +++
Sbjct: 359 VKIWDLSQPVDQE 371

>SAKL0C13332g Chr3 (1177358..1181419) [4062 bp, 1353 aa] {ON}
           similar to uniprot|Q92271 Saccharomyces cerevisiae
           YOL138C Hypothetical ORF
          Length = 1353

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 33/64 (51%), Gaps = 3/64 (4%)

Query: 123 GIDAAVHIYDIRKW---DTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLK 179
           G   +V +YDI K    D PL + +  H   +  + F+ S  N+L+SG  DG   ++DL+
Sbjct: 201 GTSTSVSVYDINKTSTIDNPLVTTLSEHTRSINSVDFNMSQTNLLISGGQDGCIKVWDLR 260

Query: 180 QDEE 183
             + 
Sbjct: 261 SSQR 264

>KLTH0D10648g Chr4 (875331..875337,875409..876751) [1350 bp, 449 aa]
           {ON} weakly similar to uniprot|Q12206 YOR229W
           Saccharomyces cerevisiae WTM2 WD repeat containing
           transcriptional modulator 2
          Length = 449

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/118 (24%), Positives = 51/118 (43%), Gaps = 22/118 (18%)

Query: 62  LKVIDSDFSAGHLVSSASIDAVKVFDIRTNSCIATIQNESNSPFLSLDSRHGLLACGTEL 121
           LK++D+  S G+L+ + SI  V V          +I+   N+ F +              
Sbjct: 213 LKIVDNSQSPGNLIRTISIPGVSV--------TQSIKFHDNNMFSTCSD----------- 253

Query: 122 QGIDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLK 179
              D  +  YDIR    PL ++ + H   +TC    P+   + ++GS  G   ++DL+
Sbjct: 254 ---DNGIRFYDIRGDGKPLWTVFEPHDGKLTCYDVSPTLETLFITGSDTGVLKLWDLR 308

>TPHA0P01490 Chr16 complement(302996..304375) [1380 bp, 459 aa] {ON}
           Anc_3.25 YNL317W
          Length = 459

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 68/136 (50%), Gaps = 10/136 (7%)

Query: 61  DLKVIDSDFSAGHLVSSASIDAVKVFDIRTNSCIATIQNESNSPFLS--LDSRHGLLACG 118
           D+K  D     G +VS++  + +K++D R+  C++T+ N  ++   +    ++  LLA  
Sbjct: 214 DVKSCDWHPEMGLIVSASKDNLIKLWDPRSGQCVSTLLNFKHTVLKTKFQPTKGNLLAAI 273

Query: 119 TELQGIDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDL 178
           ++    D +  ++DIR     L  + D    D   + +HP++ ++    S DG    +D+
Sbjct: 274 SK----DKSCRVFDIRYHMKELTVIRD--EVDYMTLLWHPTNESMFTIASYDGAIKHFDI 327

Query: 179 KQDEEEDALHQVINYA 194
            Q+ EE    QVI YA
Sbjct: 328 LQNLEEP--QQVIPYA 341

>Smik_5.31 Chr5 (49406..50689) [1284 bp, 427 aa] {ON} YEL056W (REAL)
          Length = 427

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 59/120 (49%), Gaps = 18/120 (15%)

Query: 83  VKVFDIRT-NSCIATIQNESNSPFLSLDSRH---GLLACGTELQGIDAAVHIYDIRKWDT 138
           +K+ D+R  N  I  ++     PF +L   H    LLA      G+D+ V++YD+R    
Sbjct: 259 LKINDVRAHNITIDAVK--CPQPFNTLAFSHHSSNLLAAA----GMDSHVYLYDLRNMRE 312

Query: 139 PLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQ-------DEEEDALHQVI 191
           PL  +   H D VT I+F      +++S  +D    ++DLKQ       D+ ED + ++I
Sbjct: 313 PLHHM-SGHEDAVTNIEFSTHVDGVVVSSGSDNRLIMWDLKQIGAEQTPDDAEDGVPELI 371

>KLLA0E23541g Chr5 (2095246..2096499) [1254 bp, 417 aa] {ON} similar
           to uniprot|P13712 Saccharomyces cerevisiae YBR195C MSI1
           Subunit of chromatin assembly factor I (CAF- I)
           regulates the RAS/cAMP pathway via sequestration of
           Npr1p kinase localizes to the nucleus and cytoplasm
           homologous to human retinoblastoma binding proteins
           RbAp48 and RbAp46
          Length = 417

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/166 (21%), Positives = 77/166 (46%), Gaps = 13/166 (7%)

Query: 29  LLTGLSNGEIRLLD---WATCKSLQNIKASETAINDLKVIDSDFSAGH---LVSSASIDA 82
           L T  SNG++++ D   +   K    I   E+ ++   V D  +   H   L S    + 
Sbjct: 201 LATCQSNGKVKVWDLTKFDKSKQRMEIPERESVMDANGVNDVSWMVNHTSILASCGESNV 260

Query: 83  VKVFDIRTNSCIATIQNESNSPFLS---LDSRHGLLACGTELQGIDAAVHIYDIRKWDTP 139
           + + DIR ++ + T+   +++  ++    + ++ ++ C  + QG    + I+DIR +  P
Sbjct: 261 IGLIDIRQDTKMDTLHRTTHTDGINAIEFNYKNDMILCTGDSQG---QLKIWDIRDFKEP 317

Query: 140 LRSLIDSHHDDVTCIKFHPSDVNILLSG-STDGYTNIYDLKQDEEE 184
           ++       D ++ I+++P    IL +     G   I+D   ++E+
Sbjct: 318 IKEWEHGDQDPISAIQWNPQIPQILATADQQSGLVKIWDASGEQED 363

>CAGL0G04345g Chr7 (408842..410977) [2136 bp, 711 aa] {ON} similar
           to uniprot|P47025 Saccharomyces cerevisiae YJL112w MDV1
          Length = 711

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 55/117 (47%), Gaps = 14/117 (11%)

Query: 24  SYKHGLLTGLSNGEIRLLDWATCKSLQNIKASETAINDLKVIDSDFSAGHLVSSASIDAV 83
           S+   L TG  +G IRL D  T + ++ ++    AI  LK     F A  ++S +    +
Sbjct: 572 SFDAALATGTKDGLIRLWDMRTGEVVRVLEGHMDAITSLK-----FDATTIISGSLDGTI 626

Query: 84  KVFDIRTNSCIATIQNESNSPFLSLDSRHGLLACGTELQGIDAAVHIYDI---RKWD 137
           +++D+R+N+    I  E     L  D++H ++A        +   HIYD     KWD
Sbjct: 627 RLWDLRSNNLTDIISYEKPISSLDFDAKHIVVASN------EHNTHIYDRNDGNKWD 677

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 60/123 (48%), Gaps = 14/123 (11%)

Query: 102 NSPFL-SLDSRHGLLACGTELQGIDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSD 160
           N+P + S+ S    LA GT+    D  + ++D+R  +  +  +++ H D +T +KF   D
Sbjct: 563 NTPIIGSIQSFDAALATGTK----DGLIRLWDMRTGE--VVRVLEGHMDAITSLKF---D 613

Query: 161 VNILLSGSTDGYTNIYDLKQDEEEDALHQVINYASIHSCGWLSPKRIYTLSHMETFAIHE 220
              ++SGS DG   ++DL+ +     L  +I+Y    S      K I   S+     I++
Sbjct: 614 ATTIISGSLDGTIRLWDLRSNN----LTDIISYEKPISSLDFDAKHIVVASNEHNTHIYD 669

Query: 221 LND 223
            ND
Sbjct: 670 RND 672

>NDAI0H02750 Chr8 (677299..678837) [1539 bp, 512 aa] {ON} Anc_2.401
           YMR131C
          Length = 512

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 46/189 (24%), Positives = 88/189 (46%), Gaps = 19/189 (10%)

Query: 15  ENWCLKLQPSYKHG-LLTGLSNGEIRLLDWATCKSLQNIKASETAINDLKVIDSDFS--A 71
           E + L   PS + G LLTG  +G+I      T K + + K   T  N+  + D  +S   
Sbjct: 276 EGYALDWSPSIQTGALLTGDCSGQIYFTQRHTSKWVTD-KQPFTVSNNKSIEDIQWSRTE 334

Query: 72  GHLVSSASIDA-VKVFDIRTNS---CIATIQNESNSPFLSLDSRHG-LLACGTELQGIDA 126
           G + +SA  D  ++++D R+      I+   + ++   +S   + G LLA G +    + 
Sbjct: 335 GTVFASAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSDKLGYLLASGDD----NG 390

Query: 127 AVHIYDIRKWDTPLRSLI------DSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQ 180
              ++D+R++     + +      D H   +T I F+P D +I+   S D    ++DL  
Sbjct: 391 VWGVWDLRQFSPDTANSVQPVAQYDFHKGAITSISFNPLDESIVAVASEDNTVTLWDLSV 450

Query: 181 DEEEDALHQ 189
           + +++ + Q
Sbjct: 451 EADDEEIKQ 459

>TPHA0M02000 Chr13 complement(414262..416361) [2100 bp, 699 aa] {ON}
           Anc_6.363 YCR084C
          Length = 699

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 43/164 (26%), Positives = 74/164 (45%), Gaps = 16/164 (9%)

Query: 29  LLTGLSNGEIRLLDWATCKSLQNIKASETAINDLKVIDSDFSAGHLVSSASIDAVKVFDI 88
           L TG  +  IR+ D A  K +  ++  E    D+  +D   S   LVS +    V+++D+
Sbjct: 442 LATGAEDRLIRIWDIAQKKIIMVLQGHE---QDIYSLDYFPSGEKLVSGSGDRTVRIWDL 498

Query: 89  RTNSCIATIQNESNSPFLSLDSRHG-LLACGTELQGIDAAVHIYD------IRKWDTPLR 141
           RT  C  T+  E     +++    G  +A G+    +D AV ++D      + + D+   
Sbjct: 499 RTGQCSLTLSIEDGVTTVAVSPEDGKYIAAGS----LDRAVRVWDSETGFLVERLDSE-N 553

Query: 142 SLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQDEEED 185
            L   H D V  + F   D N ++SGS D    +++L     +D
Sbjct: 554 ELGTGHKDSVYSVVFT-RDGNNVVSGSLDRSVKLWNLNDANNKD 596

>KAFR0A06480 Chr1 complement(1312834..1314540) [1707 bp, 568 aa]
           {ON} Anc_4.122 YGL003C
          Length = 568

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 40/138 (28%), Positives = 64/138 (46%), Gaps = 11/138 (7%)

Query: 70  SAGHLVSSASIDAVKVFDIRTNSCIATIQNESNS-PFLSLDSRHGLLACGTELQGIDAAV 128
           S  HL    S   V++FD+    CI T+   S+    LS +S   +L  G+     D  +
Sbjct: 314 SGSHLAVGQSNGIVEIFDVNKKKCIRTMLGHSDRVACLSWNSY--ILTSGSR----DHNI 367

Query: 129 HIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQDEEEDALH 188
              D+R  D P    I+SH  +V  +K++  D N L+SG  D   N+YD  +   +  + 
Sbjct: 368 LHRDVRSPD-PFFEKIESHSQEVCGLKWN-VDENKLVSGGNDNIVNVYD--RTSTKPFMT 423

Query: 189 QVINYASIHSCGWLSPKR 206
              + A++ +  W S KR
Sbjct: 424 MTEHKAAVKALDWSSHKR 441

>TDEL0H00370 Chr8 complement(57487..58884) [1398 bp, 465 aa] {ON}
           Anc_7.534 YPR178W
          Length = 465

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 53/108 (49%), Gaps = 6/108 (5%)

Query: 70  SAGHLVSSASIDAVK-VFDIRTNSCIATIQNESNSPFLSLDSRHGLLACGTELQGIDAAV 128
           S G L+ SA +D    ++DIR+ +C A + +    P  S+D         T     D  V
Sbjct: 317 SDGSLLCSAGLDCTGMIWDIRSGNC-AMVLSGHTKPIYSVDWSPRGFEVAT--ASGDGTV 373

Query: 129 HIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIY 176
           +I+DIRK + P   ++ +H+  V+ I+F   +   L+S   D   N+Y
Sbjct: 374 NIWDIRKTNQP--QVLLAHNSIVSGIRFEKHNGKFLMSCGYDKNINVY 419

>CAGL0H08932g Chr8 (871668..871685,872089..874779) [2709 bp, 902 aa]
           {ON} highly similar to uniprot|P41811 Saccharomyces
           cerevisiae YGL137w SEC27
          Length = 902

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 37/171 (21%), Positives = 75/171 (43%), Gaps = 10/171 (5%)

Query: 19  LKLQPSYKHGLLTGLSNGEIRLLDWATCKSLQNIKASETAINDLKVIDSDFSAGHLVSSA 78
           + L PS +  +LT L +G + + ++ T + +++I+ ++T +   K I        +V  +
Sbjct: 19  IDLHPS-EPWVLTTLYSGRVEIWNYETQQEVRSIQVTDTPVRAGKFITR---KNWIVVGS 74

Query: 79  SIDAVKVFDIRTNSCIAT-IQNESNSPFLSLDSRHGLLACGTELQGIDAAVHIYDIRKWD 137
             + V+VF+  T   +A  + +      +++      +  G++    D  V +++    D
Sbjct: 75  DDNKVRVFNYNTGEKVADFVAHPDYIRSIAVHPSKPYILTGSD----DLTVKLWNWEN-D 129

Query: 138 TPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQDEEEDALH 188
             L      H   V C+ F+P D N+  SG  D    ++ L Q      LH
Sbjct: 130 WSLEQTFKGHEHFVMCVAFNPKDPNVFASGCLDHKVKVWSLGQSTPNFTLH 180

 Score = 38.1 bits (87), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 39/174 (22%), Positives = 77/174 (44%), Gaps = 16/174 (9%)

Query: 7   VESNFFGSENW--CLKLQPSYKHGLLTGLSNGEIRLLDWATCKSLQNIK---ASETAIND 61
           +E  F G E++  C+   P   +   +G  + ++++  W+  +S  N       E  +N 
Sbjct: 132 LEQTFKGHEHFVMCVAFNPKDPNVFASGCLDHKVKV--WSLGQSTPNFTLHTGQEKGVNY 189

Query: 62  LKVIDSDFSAGHLVSSASIDAVKVFDIRTNSCIATIQNE-SNSPFLSLDSRHGLLACGTE 120
           +          ++++S+    VK+FD +T SC+AT++   SN  F        ++  G+E
Sbjct: 190 VDYYPLP-DKPYMITSSDDTTVKIFDYQTKSCVATLEGHMSNVSFAVFHPTLPIIISGSE 248

Query: 121 LQGIDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHP-SDVNILLSGSTDGYT 173
               D  V +++   +   L   ++   +   CI  HP    N + SG  +G+T
Sbjct: 249 ----DGTVKLWNSSTY--KLEKTLNLGLERSWCIATHPVGRKNCIASGFDNGFT 296

>KNAG0E02180 Chr5 (440039..441592) [1554 bp, 517 aa] {ON} Anc_2.401
           YMR131C
          Length = 517

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 47/195 (24%), Positives = 88/195 (45%), Gaps = 17/195 (8%)

Query: 10  NFFGSENWCLKLQPSYKHG-LLTGLSNGEIRLLDWATCKSLQNIKASETAINDLKVIDSD 68
           N    E + L   P  K+G LLTG  +G+I      T K + + K   TA N+  V D  
Sbjct: 276 NHGNVEGYALDWSPMIKNGALLTGDCSGQIYFTQRHTSKWITD-KQPFTAENNKSVEDIQ 334

Query: 69  FSAGH--LVSSASIDA-VKVFDIRTNS---CIATIQNESNSPFLSLDSRHGLLACGTELQ 122
           +S     + +SA  D  ++++D R+      ++   + ++   +S   + G L    +  
Sbjct: 335 WSRTESTVFASAGCDGYIRIWDTRSKKHKPALSVKASNTDVNVISWSEKIGYLLASGDDN 394

Query: 123 GIDAAVHIYDIRKW------DTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIY 176
           G+     ++D+R++      D    +  D H   +T I F+P D +I+   S D    ++
Sbjct: 395 GL---WGVWDLRQFSPDNINDVQPVAQYDFHKGAITSINFNPLDDSIIAVASEDNTVTLW 451

Query: 177 DLKQDEEEDALHQVI 191
           DL  + +++ + Q I
Sbjct: 452 DLSVEADDEEIKQQI 466

 Score = 31.2 bits (69), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 37/158 (23%), Positives = 67/158 (42%), Gaps = 11/158 (6%)

Query: 94  IATIQNESNSPFLSLDSRHGLLACGTELQGIDAAVHIYDIR----KWDTPLRSLIDSHHD 149
           I T++N  N    +LD    ++  G  L G D +  IY  +    KW T  +     ++ 
Sbjct: 271 IHTVRNHGNVEGYALD-WSPMIKNGALLTG-DCSGQIYFTQRHTSKWITDKQPFTAENNK 328

Query: 150 DVTCIKFHPSDVNILLSGSTDGYTNIYDLKQDEEEDALHQVINYASIHSCGWLSPKRIYT 209
            V  I++  ++  +  S   DGY  I+D +  + + AL    +   ++   W S K  Y 
Sbjct: 329 SVEDIQWSRTESTVFASAGCDGYIRIWDTRSKKHKPALSVKASNTDVNVISW-SEKIGYL 387

Query: 210 LSHMETFAIHELNDKSDELREPQPLDFGDVRKAWDCDY 247
           L+  +   +  + D    LR+  P +  DV+     D+
Sbjct: 388 LASGDDNGLWGVWD----LRQFSPDNINDVQPVAQYDF 421

>Ecym_2523 Chr2 complement(1021566..1023506) [1941 bp, 646 aa] {ON}
           similar to Ashbya gossypii AGL234W
          Length = 646

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 43/159 (27%), Positives = 72/159 (45%), Gaps = 18/159 (11%)

Query: 29  LLTGLSNGEIRLLDWATCKSLQNIKASETAINDLKVIDSDFSAG-HLVSSASIDAVKVFD 87
           L TG  +  IR+ D ++ K L  ++  E  I  L      F AG  LVS +    V+++D
Sbjct: 384 LATGAEDKLIRIWDLSSKKILMTLQGHEQDIYSLDY----FPAGDKLVSGSGDRTVRIWD 439

Query: 88  IRTNSCIATIQNESNSPFLSLDSRHG-LLACGTELQGIDAAVHIYD------IRKWDTPL 140
           +RT  C  T+  E     +++    G  +A G+    +D  V ++D      + + D+  
Sbjct: 440 LRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGS----LDRTVRVWDSETGFLVERLDSE- 494

Query: 141 RSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLK 179
             L   H D V  + F   D   ++SGS D    ++DL+
Sbjct: 495 NELSTGHKDSVYSVVF-TRDGRSVVSGSLDRSVKLWDLR 532

>NCAS0C04450 Chr3 (912688..914073) [1386 bp, 461 aa] {ON} Anc_3.25
          Length = 461

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 38/136 (27%), Positives = 66/136 (48%), Gaps = 10/136 (7%)

Query: 61  DLKVIDSDFSAGHLVSSASIDAVKVFDIRTNSCIATIQNESNSPFLSL--DSRHGLLACG 118
           D+K  D     G +VS++  + VK++D R+  CI+TI    ++   +    +R  LLA  
Sbjct: 218 DIKSCDWHPEMGLIVSASKDNLVKLWDPRSGQCISTIIKFKHTVLKTRFQPTRGNLLAAI 277

Query: 119 TELQGIDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDL 178
           ++    D +  ++DIR     L  + D    D   + ++P + ++   G+ DG    +DL
Sbjct: 278 SK----DKSCRVFDIRHSMKELMCVRD--EVDYMTLTWNPINESMFTVGNYDGAMKYFDL 331

Query: 179 KQDEEEDALHQVINYA 194
            QD E  +   VI YA
Sbjct: 332 LQDLEGPS--HVIPYA 345

>TPHA0G02650 Chr7 (558370..559920) [1551 bp, 516 aa] {ON} Anc_2.401
           YMR131C
          Length = 516

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 50/212 (23%), Positives = 95/212 (44%), Gaps = 20/212 (9%)

Query: 10  NFFGSENWCLKLQPSYKHG-LLTGLSNGEIRLLDWATCKSLQNIKASETAINDLKVIDSD 68
           N    E + L   P  K G LLTG  +G + L    T K + + K   T  N+  + D  
Sbjct: 276 NHGNVEGYGLDWSPLIKTGALLTGDCSGMVYLTQRHTSKWVTD-KTPFTVGNNKSIEDIQ 334

Query: 69  FSAGH--LVSSASIDA-VKVFDIRTNS---CIATIQNESNSPFLSLDSRHG-LLACGTEL 121
           +S     + ++A  D  ++++D R+      I+T+ + ++   +S + + G LLA G + 
Sbjct: 335 WSRTESTVFATAGCDGYIRIWDTRSKKHKPVISTVVSNTDVNVISWNEKMGYLLASGDD- 393

Query: 122 QGIDAAVHIYDIRKWDTPLRSLI-----DSHHDDVTCIKFHPSDVNILLSGSTDGYTNIY 176
                   I+D+R++       +     D H   +T I F+P D +I+   S D    ++
Sbjct: 394 ---KGTWGIWDLRQFSPNSEKALPVAQYDFHKGAITSISFNPLDESIVAVASEDNTVTLW 450

Query: 177 DLKQDEEEDALHQVINYASIHSCGWLSPKRIY 208
           DL  + +++ + Q    A I     + P+ ++
Sbjct: 451 DLSVEADDEEIKQ--QKAEIKELEQIPPQLLF 480

>KNAG0D02720 Chr4 complement(489642..494267) [4626 bp, 1541 aa] {ON}
            Anc_5.49 YHR186C
          Length = 1541

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 47/176 (26%), Positives = 80/176 (45%), Gaps = 11/176 (6%)

Query: 38   IRLLDWATCKSLQNIKASE---TAINDLKVIDSDFSAGHLVSSASIDAVKVF-DIRTNSC 93
            I L DW   K L     S    T I DLK I+ D S   L++ +S   +K+F DI +NS 
Sbjct: 1215 ITLFDWDENKMLSRFSNSNPFGTKITDLKFINEDDST-LLMTGSSDGIIKIFKDINSNSS 1273

Query: 94   IATIQNESNSPFLSLDSR-HGLLACGTELQG-IDAAVHIYDIRKWDTPLRSL-IDSHHDD 150
            +  I        + L  R +GLL    +++G + A   +  IR WD    ++ +D     
Sbjct: 1274 VELIAAWRGLTEMLLTPRSNGLLTEWHQMRGALLATGDVKIIRIWDAHTETVEVDIPAKT 1333

Query: 151  VTCIKFHPSDV---NILLSGSTDGYTNIYDLKQDEEEDALHQVINYASIHSCGWLS 203
             + +    SD    NI ++G  DG   +YD + D  +  + +  + ++  +  W++
Sbjct: 1334 SSLVTSLTSDQLAGNIFVAGFADGTLRVYDRRIDARDSMVRRWRSASTGRANCWIN 1389

>TPHA0B04250 Chr2 complement(995664..997187) [1524 bp, 507 aa] {ON}
           Anc_1.107 YNL253W
          Length = 507

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 47/164 (28%), Positives = 70/164 (42%), Gaps = 14/164 (8%)

Query: 27  HG--LLTGLSNGEIRLLDWATCKSLQNI---KASETAINDLKVIDSDFSAGHLVSSASID 81
           HG  ++ G S GEI LL     K L+NI    A    I  LKV         LVS     
Sbjct: 243 HGNYIIVGTSIGEISLLRVNNNKELKNIIKVPAHRGKITGLKVTPL---GDKLVSVGEDG 299

Query: 82  AVKVFDIRTNSCIATI-QNESNSPFLSLDSRHGLLACGTELQGIDAAVHIYDIRKWDTPL 140
           A  ++D+ + +CI+TI + ESN     L     LL   +E    +     YD+   +  +
Sbjct: 300 ACLIWDLESLTCISTIVECESNIRTFDLSPSGKLLVVVSE----EGKFRFYDMITTEK-I 354

Query: 141 RSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQDEEE 184
                 H D    +KF+P+   +++SG  D    +Y  K   +E
Sbjct: 355 NDYDQKHLDSDFIVKFYPNKSWLMISGENDTLCRLYSEKGHSDE 398

>YPR178W Chr16 (892332..893729) [1398 bp, 465 aa] {ON}  PRP4Splicing
           factor, component of the U4/U6-U5 snRNP complex
          Length = 465

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 33/108 (30%), Positives = 55/108 (50%), Gaps = 7/108 (6%)

Query: 72  GHLVSSASIDAVKV-FDIRTNSCIATIQNESNSPFLSLDSRHGL-LACGTELQGIDAAVH 129
           G LV S  +D++ + +DIR+ S + T+   S   +    S +G  +A G    G D  ++
Sbjct: 319 GSLVCSGGMDSLSMLWDIRSGSKVMTLAGHSKPIYTVAWSPNGYQVATG----GGDGIIN 374

Query: 130 IYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVN-ILLSGSTDGYTNIY 176
           ++DIRK D    + I +H + VT ++F   D    L+S   D   N+Y
Sbjct: 375 VWDIRKRDEGQLNQILAHRNIVTQVRFSKEDGGKKLVSCGYDNLINVY 422

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 33/150 (22%), Positives = 69/150 (46%), Gaps = 14/150 (9%)

Query: 49  LQNIKASETAINDLKVIDSDFSAGHLVSSASIDAV-KVFDIRTNSCIATIQNESNSPF-L 106
           L ++   E  I+D+K       +G  + SAS D   +++D  T+  +   +      F L
Sbjct: 258 LGDLVGHERRISDVKY----HPSGKFIGSASHDMTWRLWDASTHQELLLQEGHDKGVFSL 313

Query: 107 SLDSRHGLLACGTELQGIDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLS 166
           S      L+  G    G+D+   ++DIR     +   +  H   +  + + P+   +  +
Sbjct: 314 SFQCDGSLVCSG----GMDSLSMLWDIRSGSKVM--TLAGHSKPIYTVAWSPNGYQVA-T 366

Query: 167 GSTDGYTNIYDLKQDEEEDALHQVINYASI 196
           G  DG  N++D+++  +E  L+Q++ + +I
Sbjct: 367 GGGDGIINVWDIRK-RDEGQLNQILAHRNI 395

>NCAS0A15170 Chr1 (2984221..2985645) [1425 bp, 474 aa] {ON}
           Anc_7.534
          Length = 474

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 39/161 (24%), Positives = 73/161 (45%), Gaps = 21/161 (13%)

Query: 63  KVIDSDF-SAGHLVSSASIDAV-KVFDIRTNSCIATIQNESNSPF-LSLDSRHGLLACGT 119
           +V++ DF  +G  V+SAS D   +++DI + + +   +      + LS  +   LL  G 
Sbjct: 277 RVVNVDFHPSGRFVASASFDMTWRLWDIESETELQFQEGHGKEVYSLSFQNDGALLCSG- 335

Query: 120 ELQGIDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLK 179
              G+D A  ++D+R   + +   +  H   +  + + P   +I  +G  DG  NI+D++
Sbjct: 336 ---GLDNAAIVWDVRTGKSIMN--LQGHAKPIYSVDWSPDGYHIA-TGGGDGVINIWDIR 389

Query: 180 QDEEEDALHQVINYAS-----------IHSCGWLSPKRIYT 209
           +  E   L    N  +           + SCG+    RIY+
Sbjct: 390 KTTETTRLLAHNNIVTGVRFQKSTGHCLVSCGYDKQIRIYS 430

>NCAS0F01970 Chr6 complement(396326..397861) [1536 bp, 511 aa] {ON}
           Anc_2.401 YMR131C
          Length = 511

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 47/194 (24%), Positives = 87/194 (44%), Gaps = 19/194 (9%)

Query: 10  NFFGSENWCLKLQPSYKHG-LLTGLSNGEIRLLDWATCKSLQNIKASETAINDLKVIDSD 68
           N    E + L   P  K G LLTG  +G+I      T K + + K   T  N+  + D  
Sbjct: 270 NHGNVEGYALDWSPLTKTGALLTGDCSGQIYFTQRHTSKWITD-KQPFTVANNQSIEDIQ 328

Query: 69  FSAGH--LVSSASIDA-VKVFDIRTNS---CIATIQNESNSPFLSLDSRHG-LLACGTEL 121
           +S     + +SA  D  ++++D R+      I+   + ++   +S   + G LLA G + 
Sbjct: 329 WSRTESTVFASAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSEKLGYLLASGDD- 387

Query: 122 QGIDAAVHIYDIRKWDTPLRSLI------DSHHDDVTCIKFHPSDVNILLSGSTDGYTNI 175
              +    ++D+R++       +      D H   +T I F+P D +I+  GS D    +
Sbjct: 388 ---NGTWGVWDLRQFSPENAGSVQPVAQYDFHKGAITSISFNPLDESIIAVGSEDNTVTL 444

Query: 176 YDLKQDEEEDALHQ 189
           +DL  + +++ + Q
Sbjct: 445 WDLSVEADDEEIKQ 458

 Score = 31.6 bits (70), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 57/253 (22%), Positives = 101/253 (39%), Gaps = 33/253 (13%)

Query: 94  IATIQNESNSPFLSLDSRHGLLACGTELQGIDAAVHIYDIR----KWDTPLRSLIDSHHD 149
           I T++N  N    +LD    L   G  L G D +  IY  +    KW T  +    +++ 
Sbjct: 265 IHTVKNHGNVEGYALD-WSPLTKTGALLTG-DCSGQIYFTQRHTSKWITDKQPFTVANNQ 322

Query: 150 DVTCIKFHPSDVNILLSGSTDGYTNIYDLKQDEEEDALHQVINYASIHSCGWLSPKRIYT 209
            +  I++  ++  +  S   DGY  I+D +  + + A+    +   ++   W S K  Y 
Sbjct: 323 SIEDIQWSRTESTVFASAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVISW-SEKLGYL 381

Query: 210 LSHMETFAIHELNDKSDELREPQPLDFGDVRKAWDCDY------VVDIYP---GLIATGK 260
           L+  +      + D    LR+  P + G V+     D+       +   P    +IA G 
Sbjct: 382 LASGDDNGTWGVWD----LRQFSPENAGSVQPVAQYDFHKGAITSISFNPLDESIIAVG- 436

Query: 261 TQENAGELRLIP-------FKNEKIYTEKCFVIP----HAHGDEVVRDIFISAHQSDMLY 309
           +++N   L  +         K +   T++   IP      H  + V+D+         L 
Sbjct: 437 SEDNTVTLWDLSVEADDEEIKQQAAETKELQQIPPQLLFVHWQKEVKDVKWHKQIPGCLV 496

Query: 310 SCGEDGYVKIWKS 322
           S G DG + IWK+
Sbjct: 497 STGTDG-LNIWKT 508

>Suva_10.316 Chr10 complement(551612..554068) [2457 bp, 818 aa] {ON}
           YLR222C (REAL)
          Length = 818

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 54/107 (50%), Gaps = 11/107 (10%)

Query: 75  VSSASIDAVKVFDIRTNSCIATIQNESNSPFLSLDSRHGLLACGTELQGIDAAVHIYDIR 134
           VS A +  +K+F ++T   + +++  S S  L  DS   LLA G    G D ++ + DI 
Sbjct: 79  VSQAQL--LKIFQLKTGKVVRSMKISSPSYILDTDSTSTLLAVG----GTDGSIIVVDIE 132

Query: 135 KWDTPLRSLIDSHHDDVTCIKFHP---SDVNILLSGSTDGYTNIYDL 178
             +  +   +  H   ++ +KF+    S V +L SG T+G   ++DL
Sbjct: 133 --NGYITHSLKGHGGTISSLKFYGQLDSKVWLLASGDTNGMVKVWDL 177

>KNAG0B01610 Chr2 (294433..296457) [2025 bp, 674 aa] {ON} Anc_1.247
           YKR036C
          Length = 674

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 62/129 (48%), Gaps = 22/129 (17%)

Query: 73  HLVSSASIDAVKVFDIRTNSCIAT-----IQNESNSPFLSLD--------SRHGLLACGT 119
           HL+S +    V+ +D+ T  C+ T     +   S+S   +LD        S    LA GT
Sbjct: 484 HLLSGSQDRTVRQWDMNTGKCVQTLDVSFVNALSHSLVTTLDPPVVGALKSYDVALATGT 543

Query: 120 ELQGIDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLK 179
           +    D  V ++D+R  +  +R+L   H   ++C+KF   D++ L++GS D    ++DL+
Sbjct: 544 K----DGMVRLWDLRTGEI-VRTL-KGHTGAISCLKF---DLHNLITGSLDNSVRVWDLR 594

Query: 180 QDEEEDALH 188
                DA  
Sbjct: 595 SGSTLDAFR 603

>ZYRO0A09636g Chr1 (779501..781927) [2427 bp, 808 aa] {ON} highly
           similar to uniprot|Q05946 Saccharomyces cerevisiae
           YLR222C UTP13 Nucleolar protein component of the small
           subunit (SSU) processome containing the U3 snoRNA that
           is involved in processing of pre-18S rRNA
          Length = 808

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 54/109 (49%), Gaps = 9/109 (8%)

Query: 73  HLVSSASIDAVKVFDIRTNSCIATIQNESNSPFLSLDSRHGLLACGTELQGIDAAVHIYD 132
           +L  ++    +K+FD+R    + +++  S S  +  DS   LLA G    G D ++ + D
Sbjct: 74  YLCFASQAQLLKIFDLREGKIVRSMKISSPSYVVDSDSTSTLLAIG----GTDGSITVVD 129

Query: 133 IRKWDTPLRSLIDSHHDDVTCIKFHP---SDVNILLSGSTDGYTNIYDL 178
           +   +  +   +  H   ++ +KF+     +V +L SG T+G   I+DL
Sbjct: 130 VE--NGYVTHSLKGHGGTISSVKFYGEQNGEVWLLASGDTNGMVKIWDL 176

>Smik_16.442 Chr16 (754983..756395) [1413 bp, 470 aa] {ON} YPR178W
           (REAL)
          Length = 470

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 55/108 (50%), Gaps = 7/108 (6%)

Query: 72  GHLVSSASIDAVKV-FDIRTNSCIATIQNESNSPFLSLDSRHGL-LACGTELQGIDAAVH 129
           G LV S  +D++ + +DIR+ S + T+   S   +    S +G  +A G    G D  ++
Sbjct: 324 GSLVCSGGMDSLTMLWDIRSGSKVMTLAGHSKPVYTVAWSPNGYQVATG----GGDGLIN 379

Query: 130 IYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVN-ILLSGSTDGYTNIY 176
           ++DIR+ D    + I +H + VT +KF   D    L+S   D   NIY
Sbjct: 380 VWDIRQRDEGQLNQILAHRNIVTQVKFSNDDGGKKLVSCGYDNLINIY 427

 Score = 38.5 bits (88), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 39/163 (23%), Positives = 74/163 (45%), Gaps = 22/163 (13%)

Query: 36  GEIRLLDWATCKSLQNIKASETAINDLKVIDSDFSAGHLVSSASIDAV-KVFDIRTNSCI 94
           GE+RLL         +    E  ++D+K       +G  + SAS D   +++D  T+  +
Sbjct: 258 GELRLLG--------DFVGHERRVSDVKY----HPSGKFIGSASHDMTWRLWDASTHQEL 305

Query: 95  ATIQNESNSPF-LSLDSRHGLLACGTELQGIDAAVHIYDIRKWDTPLRSLIDSHHDDVTC 153
              +  S   F LS      L+  G    G+D+   ++DIR     +   +  H   V  
Sbjct: 306 LLQEGHSKGVFSLSFQCDGSLVCSG----GMDSLTMLWDIRSGSKVM--TLAGHSKPVYT 359

Query: 154 IKFHPSDVNILLSGSTDGYTNIYDLKQDEEEDALHQVINYASI 196
           + + P+   +  +G  DG  N++D++Q  +E  L+Q++ + +I
Sbjct: 360 VAWSPNGYQVA-TGGGDGLINVWDIRQ-RDEGQLNQILAHRNI 400

>TPHA0M00190 Chr13 complement(38571..39746) [1176 bp, 391 aa] {ON}
           Anc_6.9 YEL056W
          Length = 391

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 49/188 (26%), Positives = 83/188 (44%), Gaps = 20/188 (10%)

Query: 17  WCLKLQPSYKHGLLTGLSNGEIRLLDWATCKSLQNIKASETAINDLKVIDSD---FSAGH 73
           + L   P+ +  L++G  +  I L D    K  Q I+   T+ +D+ V D     F+   
Sbjct: 155 YGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDI-VNDCQWHCFNTNM 213

Query: 74  LVSSASIDAVKVFDIRTNS---CIATIQNESNSPFLSLDSRHGLLACGTELQGIDAAVHI 130
             S +    +++FD R         + + + NS   S  S +   A GT        +++
Sbjct: 214 FGSVSEDSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTT-----NNIYL 268

Query: 131 YDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDL-------KQDEE 183
           YDIR     L S+   H + VT ++F      IL+SGS+D    ++DL       + DE 
Sbjct: 269 YDIRNTGKILHSMT-GHEEPVTSLEFSNDKDGILISGSSDRRVIMWDLFEIGAEQQPDEA 327

Query: 184 EDALHQVI 191
           +D L +V+
Sbjct: 328 DDGLPEVM 335

 Score = 30.8 bits (68), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 37/80 (46%), Gaps = 3/80 (3%)

Query: 125 DAAVHIYDI-RKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQDEE 183
           +  + IYD  R   + L S +  H D+   + F+P+    L+SGS D    ++D   D+ 
Sbjct: 127 EGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKL 186

Query: 184 EDALHQVINYAS--IHSCGW 201
           +  + +     S  ++ C W
Sbjct: 187 KQPIQEWTTSHSDIVNDCQW 206

>Kpol_1028.54 s1028 (125940..128657) [2718 bp, 905 aa] {ON}
           (125940..128657) [2718 nt, 906 aa]
          Length = 905

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 44/184 (23%), Positives = 81/184 (44%), Gaps = 22/184 (11%)

Query: 3   SYSLVESNFF---GSENWCLKLQPSYKHGLLTGLSNGEIRLLDWATCKSLQNIKASETAI 59
           S+ + E +FF    ++  C+   P   + L+ G SNGE RL D  +   +Q +   + A+
Sbjct: 240 SWRIAEKHFFFQNQAKVKCVTFHPG-SNLLVVGFSNGEFRLYDLPSFTLVQQLSMGQNAV 298

Query: 60  NDLKVIDSDFSAGHLVS--SASIDAVKVFDIRTNSCIATIQNESNSPFLSLDSRHGLLAC 117
           N + + ++    G  ++  S+++  + V++ ++ S I   Q          DS +GL   
Sbjct: 299 NTVSINNT----GEWLAFGSSALGQLLVYEWQSESYILKQQGH-------FDSLNGLTYS 347

Query: 118 GTELQGIDAAVHIYDIRKWDTP---LRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTN 174
               + + AA +   I+ WD       +    H   VT ++F      +L S S DG   
Sbjct: 348 PDGARVVTAA-NDGKIKVWDVVSGFCLATFSEHTSSVTAVQFAKRG-QVLFSSSLDGTVR 405

Query: 175 IYDL 178
            +DL
Sbjct: 406 AWDL 409

>CAGL0J01265g Chr10 complement(118375..119928) [1554 bp, 517 aa]
           {ON} highly similar to uniprot|Q04305 Saccharomyces
           cerevisiae YMR093w
          Length = 517

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 47/111 (42%), Gaps = 4/111 (3%)

Query: 73  HLVSSASIDAVKVFDIRTNSCIATIQNESNSPFLSLDSRHGLLACGTELQGIDAAVHIYD 132
           H  +  S   V+VF  RT   I T     +  + +   + G L C  +  G+   V +YD
Sbjct: 53  HDFAVTSSTRVQVFSSRTRQAIKTFSRFKDVVYSASYRKDGKLLCAGDATGL---VSVYD 109

Query: 133 IRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQDEE 183
                T L S+  S H      KFH  D+  L+S S D  T ++D+    E
Sbjct: 110 SYNPRTLLVSVAASQHP-THVTKFHDHDLKTLVSASDDRVTRVWDISHAYE 159

>KNAG0C01410 Chr3 (277054..279015) [1962 bp, 653 aa] {ON} Anc_1.247
           YKR036C
          Length = 653

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 50/100 (50%), Gaps = 12/100 (12%)

Query: 2   ASYSLVESNFFGSENWCLKLQPSYKHGLLTGLSNGEIRLLDWATCKSLQNIKASETAIND 61
           ASYS++     G+      LQ SY++ L TG  +G IRL D    K ++ I A  +A+  
Sbjct: 499 ASYSMLNPPVVGT------LQ-SYENALATGSRDGLIRLWDLRIGKVVRTIPAHNSAVTA 551

Query: 62  LKVIDSDFSAGHLVSSASIDAVKVFDIRTNSCIATIQNES 101
           LK     F   HL++ +      ++D+RT   +++   +S
Sbjct: 552 LK-----FDTTHLITGSFDRTAFIWDLRTGDSVSSFSYDS 586

 Score = 35.8 bits (81), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 45/183 (24%), Positives = 87/183 (47%), Gaps = 26/183 (14%)

Query: 18  CLKLQPSYKHGLLTGLSNGEIRL--LDWATCKSLQNIKASETAINDL--------KVIDS 67
           C+++  SY   + +G  +  ++L  +D AT K+ + +   E+    L        +++  
Sbjct: 397 CIEMDSSYNLAV-SGSKDATLKLWNIDLATEKAKKLLPELESRTACLHSFTSHKGEIVAL 455

Query: 68  DFSAGHLVSSASIDAVKVFDIRTNSCIATIQNESNSPFLS-LDSRHGLL---ACGTELQG 123
             S   LVS++    ++ +D+++  C+ ++     S  L+ LD+ + +L     GT LQ 
Sbjct: 456 SLSGESLVSASRDKTIRQWDLKSGKCVQSLDVAFPSRDLAGLDASYSMLNPPVVGT-LQS 514

Query: 124 IDAAVHIYD----IRKWDTPLRSL---IDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIY 176
            + A+        IR WD  +  +   I +H+  VT +KF   D   L++GS D    I+
Sbjct: 515 YENALATGSRDGLIRLWDLRIGKVVRTIPAHNSAVTALKF---DTTHLITGSFDRTAFIW 571

Query: 177 DLK 179
           DL+
Sbjct: 572 DLR 574

>KNAG0A01250 Chr1 (23559..24917) [1359 bp, 452 aa] {ON} Anc_3.25
           YNL317W
          Length = 452

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 60/129 (46%), Gaps = 20/129 (15%)

Query: 61  DLKVIDSDFSAGHLVSSASIDAVKVFDIRTNSCIATIQNESNSPFLSLDSRHGLLAC--- 117
           D+K  D   + G + S++  + VK++D RT +C++TI          L  +H +L     
Sbjct: 210 DVKSCDWHPTMGLIASASKDNLVKLWDPRTGNCVSTI----------LKFKHTVLKTRFQ 259

Query: 118 ---GTELQGI--DAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGY 172
              G  L GI  D +  ++DIR+  T L    D    D   + +HP + +    G+ DG 
Sbjct: 260 PGGGNLLLGISKDKSCRVFDIRQNMTELMVFRDD--VDYMTLLWHPINHSTFTVGNYDGS 317

Query: 173 TNIYDLKQD 181
              +D+ QD
Sbjct: 318 IKHFDVLQD 326

 Score = 31.6 bits (70), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 33/72 (45%), Gaps = 8/72 (11%)

Query: 293 EVVRDIFISAHQSDMLYSCGEDGYVKIWKSTQGPLNTPET--FW-----DYSEKMNVLGD 345
           E +RD+  SA+ S  + SC +D  +KIW  T G      T   W     D+   M ++  
Sbjct: 167 ECIRDVAFSANDSKFV-SCSDDNILKIWNFTNGQQERVLTGHHWDVKSCDWHPTMGLIAS 225

Query: 346 DSKEAFTNLEEP 357
            SK+    L +P
Sbjct: 226 ASKDNLVKLWDP 237

>TBLA0F00520 Chr6 complement(134791..136782) [1992 bp, 663 aa] {ON}
           Anc_6.363 YCR084C
          Length = 663

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 39/158 (24%), Positives = 70/158 (44%), Gaps = 16/158 (10%)

Query: 29  LLTGLSNGEIRLLDWATCKSLQNIKASETAINDLKVIDSDFSAGHLVSSASIDAVKVFDI 88
           L TG  +  IR+ D    K +  +   E    D+  +D   S   +VS +    V+++D+
Sbjct: 381 LATGAEDRLIRIWDITLKKIVMILNGHE---QDIYSLDYFPSGDKIVSGSGDRTVRIWDL 437

Query: 89  RTNSCIATIQNESNSPFLSLDSRHGLLACGTELQGIDAAVHIYD------IRKWDTPLRS 142
            T  C+ T+  E     +++      +A G+    +D AV ++D      + + D+    
Sbjct: 438 NTGQCLLTLSIEDGVTTVAVSPDGKFIAAGS----LDRAVRVWDAETGFLVERLDS--NE 491

Query: 143 LIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQ 180
           L   H D V  + F     N++ SGS D    +++LKQ
Sbjct: 492 LGTGHEDSVYSVVFTKDGKNVV-SGSLDKTVKLWNLKQ 528

>KLLA0A08822g Chr1 (772565..774313) [1749 bp, 582 aa] {ON} similar
           to uniprot|P53197 Saccharomyces cerevisiae YGL003C CDH1
           CDC20 homolog 1 protein required for Clb2 and Ase1
           degradation
          Length = 582

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 50/185 (27%), Positives = 84/185 (45%), Gaps = 29/185 (15%)

Query: 40  LLDWATCKSL-----QNIKASETAIND---LKVIDSDF-------SAGHLVSSASIDAVK 84
           L+DW++   L     ++I  S+   ND   L   +SDF       S  HL    S   V+
Sbjct: 284 LIDWSSTDVLAVALGKSIFLSDNTTNDVTHLATSESDFTSLSWVDSGSHLAVGLSSGIVE 343

Query: 85  VFDIRTNSCIATIQNESNSPFLSLDSRHGLLACGTELQGIDAAVHIYDIRKWDTPLRSLI 144
           ++D+  N CI T+    +     L   + +L+ G+     D  +   D+R  + P    I
Sbjct: 344 IYDVLKNKCIRTLSGHVDR-VACLSWNNHVLSSGSR----DRKILHRDVRAPE-PFFEQI 397

Query: 145 DSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYD--LKQD----EEEDALHQVINYASIHS 198
           D+H  +V  +K++ ++ N L SG  D    +YD  L+Q     EE  A  + + + S H+
Sbjct: 398 DTHSQEVCGLKWNVNE-NKLASGGNDNMVYVYDGTLRQPMLSMEEHTAAVKAMAW-SPHT 455

Query: 199 CGWLS 203
            G L+
Sbjct: 456 RGVLA 460

>Sklu_YGOB_Anc_2.401 Chr5 complement(385202..386764) [1563 bp, 520
           aa] {ON} ANNOTATED BY YGOB -
          Length = 520

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 47/189 (24%), Positives = 87/189 (46%), Gaps = 19/189 (10%)

Query: 15  ENWCLKLQPSYKHG-LLTGLSNGEIRLLDWATCKSLQNIKASETAINDLKVIDSDFSAGH 73
           E + L   P  K G LLTG  +G++ L    T K + + K   T  N+  V D  +S   
Sbjct: 284 EGYALDWSPLIKTGALLTGDCSGQVYLTQRHTSKWISD-KEPFTVANNQSVEDIQWSRTE 342

Query: 74  --LVSSASIDA-VKVFDIRTNS---CIATIQNESNSPFLSLDSRHG-LLACGTELQGIDA 126
             + +S   D  ++V+D R+      I+   + ++   +S   + G LLA G +    + 
Sbjct: 343 STVFASCGCDGYIRVWDTRSKKHKPAISVKASNTDVNVISWSEKIGYLLASGDD----NG 398

Query: 127 AVHIYDIRKW------DTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQ 180
              ++D+R++      +T   +  D H   +T I F+P D +I+   S D    ++DL  
Sbjct: 399 TWGVWDLRQFSPSNSNNTSPVAQYDFHKGAITSISFNPLDESIVAVASEDNTVTLWDLSV 458

Query: 181 DEEEDALHQ 189
           + +++ + Q
Sbjct: 459 EADDEEIKQ 467

 Score = 33.9 bits (76), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 41/77 (53%), Gaps = 7/77 (9%)

Query: 247 YVVDIYPGLIATGK--TQENAGELRLIPFKNEKIYTEK-CFVIPHAHGDEVVRDIFISAH 303
           Y +D  P LI TG   T + +G++ L      K  ++K  F + +   ++ V DI  S  
Sbjct: 286 YALDWSP-LIKTGALLTGDCSGQVYLTQRHTSKWISDKEPFTVAN---NQSVEDIQWSRT 341

Query: 304 QSDMLYSCGEDGYVKIW 320
           +S +  SCG DGY+++W
Sbjct: 342 ESTVFASCGCDGYIRVW 358

>Kwal_27.12667 s27 complement(1325822..1327987) [2166 bp, 721 aa]
           {ON} YJL112W (MDV1) - Involved in mitochondrial division
           [contig 260] FULL
          Length = 721

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 50/196 (25%), Positives = 84/196 (42%), Gaps = 43/196 (21%)

Query: 18  CLKLQPSYKHGLLTGLSNGEIRLLDWATCKSLQNIKASE-----------TAINDLKVID 66
           C++++ S  H L+TG  +  ++L D    + L N  A+E             ++++  + 
Sbjct: 452 CMQMEDS--HSLITGGRDALLKLWDIEKAEELYNDGATEGEEELCVHTFDAHVDEITALH 509

Query: 67  SDFSAGHLVSSASIDAVKVFDIRTNSCIATI--------------QNESNSPFLSLDSRH 112
             F    LVS +    ++ +D+ T  C+ TI              +  SN+P  S+   H
Sbjct: 510 --FEGNSLVSGSQDRTIRQWDLTTGKCLQTIDINFANRGTSGGFSKISSNNPRSSILLTH 567

Query: 113 GLLACGTELQGIDAAVHIYD----IRKWDTPLRS-----LIDSHHDDVTCIKFHPSDVNI 163
                   LQ  DAA+        +R WD  LRS      ++ H D VT ++F   D   
Sbjct: 568 NDPPVIGALQCYDAAMATGTKDGLVRLWD--LRSGQVIRTLEGHTDAVTGLQF---DSVN 622

Query: 164 LLSGSTDGYTNIYDLK 179
           L++GS D    I+DL+
Sbjct: 623 LVTGSLDRSIRIWDLR 638

>Kwal_55.21450 s55 (842483..843994) [1512 bp, 503 aa] {ON} YDR364C
           (CDC40) - Member of the beta transducin family [contig
           130] FULL
          Length = 503

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 37/166 (22%), Positives = 71/166 (42%), Gaps = 8/166 (4%)

Query: 18  CLKLQPSYKHGLLTGLSNGEIRLLDWATCKSLQNIKASETAINDLKVIDSDFSAGHLVSS 77
           C + +PS  +  + GLSN EIR  D  T      ++  +  ++ +  +         VSS
Sbjct: 300 CAEFRPSNSNEFIVGLSNSEIRHYDLRTSHKNGLVQVYDHHLSSIIALKYFPDGSKFVSS 359

Query: 78  ASIDAVKVFDIRTNSCIATIQNES--NSPFLSLDSRHGLLACGTELQGIDAAVHIYDIR- 134
           +   ++++++ + N  I  I + S  + P++ +       A     Q +D A++ + ++ 
Sbjct: 360 SEDKSMRIWENQINIPIKQISDTSQYSMPYIGIHPEQNYFAA----QSMDNAIYAFSMKP 415

Query: 135 KWDTPLRSLIDSHHDDVTCIKFHPS-DVNILLSGSTDGYTNIYDLK 179
           K+    +     H      I F  S D   + SG T G   I+D K
Sbjct: 416 KYKRHPKKHFSGHKCAGFGIGFGFSPDGQYIASGDTRGRVYIWDWK 461

>NCAS0A05520 Chr1 complement(1085200..1087215) [2016 bp, 671 aa]
           {ON} Anc_6.363
          Length = 671

 Score = 39.7 bits (91), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 40/158 (25%), Positives = 72/158 (45%), Gaps = 16/158 (10%)

Query: 29  LLTGLSNGEIRLLDWATCKSLQNIKASETAINDLKVIDSDFSAGHLVSSASIDAVKVFDI 88
           L TG  +  IR+ D    K +  +K  E    D+  +D   +   LVS +    V+++D+
Sbjct: 402 LATGAEDKLIRIWDIQERKIVMVLKGHE---QDVYSLDYFPNGEKLVSGSGDRTVRIWDL 458

Query: 89  RTNSCIATIQNESNSPFLSLDSRHG-LLACGTELQGIDAAVHIYD------IRKWDTPLR 141
           RT  C  T+  E     +++    G  +A G+    +D AV ++D      + + D+   
Sbjct: 459 RTGQCSLTLSIEYGVTTVAVSPNDGKFIAAGS----LDRAVRVWDSTTGFLVERLDSE-N 513

Query: 142 SLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLK 179
            L   H D V  + F   D N ++SGS D    +++++
Sbjct: 514 ELGTGHRDSVYSVVFT-RDGNEVVSGSLDKTVKLWNMR 550

>Kwal_26.8700 s26 (902915..904060) [1146 bp, 381 aa] {ON} YOR229W
           (WTM2) - Transcriptional modulator [contig 67] FULL
          Length = 381

 Score = 39.3 bits (90), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 35/165 (21%), Positives = 61/165 (36%), Gaps = 30/165 (18%)

Query: 23  PSYKHGLLTGLSNGEIRLLDWATCKSLQNIKASETAIND--------LKVIDSDFSAGHL 74
           P+     +    +G   L D+A  +  + +  S+ ++          LK++D+  S G L
Sbjct: 98  PATSFSRINNKGSGNAILADFAVSEDTETVVKSQQSMATGTGEEHSLLKIVDNSQSPGRL 157

Query: 75  VSSASIDAVKVFDIRTNSCIATIQNESNSPFLSLDSRHGLLACGTELQGIDAAVHIYDIR 134
           + S  I    V          TI+   N  F +                 D  +  YD R
Sbjct: 158 IRSICIPGTTV--------THTIKFHDNHMFSTCSD--------------DNKIRFYDTR 195

Query: 135 KWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLK 179
               PL  + D H   +TC    P+   + ++GS  G   ++DL+
Sbjct: 196 GDGKPLWEVCDPHDGRLTCFDVSPALETLFVTGSDTGVLKLWDLR 240

>KLTH0A07282g Chr1 complement(604949..607126) [2178 bp, 725 aa] {ON}
           some similarities with uniprot|P18323 Saccharomyces
           cerevisiae YCR084C
          Length = 725

 Score = 39.3 bits (90), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 40/158 (25%), Positives = 72/158 (45%), Gaps = 16/158 (10%)

Query: 29  LLTGLSNGEIRLLDWATCKSLQNIKASETAINDLKVIDSDFSAGHLVSSASIDAVKVFDI 88
           L TG  +  IR+ D  T + +  ++  E    D+  +D   S   LVS +    V+++D+
Sbjct: 463 LATGAEDKLIRIWDLTTRRIVMTLQGHE---QDIYSLDYFPSGDKLVSGSGDRTVRIWDL 519

Query: 89  RTNSCIATIQNESNSPFLSLDSRHG-LLACGTELQGIDAAVHIYD------IRKWDTPLR 141
           R   C  T+  E     +++    G L+A G+    +D  V I+D      + + D+   
Sbjct: 520 RAGQCSLTLSIEDGVTTVAVSPGDGKLIAAGS----LDRTVRIWDSETGFLVERLDSE-N 574

Query: 142 SLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLK 179
            L   H D V  + F   D + ++SGS D    +++L+
Sbjct: 575 ELGTGHKDSVYSVVFT-RDGHGVVSGSLDRSVKLWNLR 611

>NDAI0K02350 Chr11 complement(524551..526932) [2382 bp, 793 aa] {ON}
           Anc_6.363
          Length = 793

 Score = 39.3 bits (90), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 41/157 (26%), Positives = 70/157 (44%), Gaps = 16/157 (10%)

Query: 29  LLTGLSNGEIRLLDWATCKSLQNIKASETAINDLKVIDSDFSAGHLVSSASIDAVKVFDI 88
           L TG  +  IR+ D    K +  +K  E    D+  +D       LVS +    V+++D+
Sbjct: 510 LATGAEDKLIRIWDIQEGKIVMVLKGHE---QDVYSLDYFPDGQKLVSGSGDRTVRIWDL 566

Query: 89  RTNSCIATIQNESNSPFLSLDSRHG-LLACGTELQGIDAAVHIYD------IRKWDTPLR 141
           RT  C  T+  E     +++    G  +A G+    +D AV ++D      + + D+   
Sbjct: 567 RTGQCSLTLSIEDGVTTVAVSPHDGRFIAAGS----LDRAVRVWDSTTGFLVERLDSE-N 621

Query: 142 SLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDL 178
            L   H D V  + F   D N ++SGS D    +++L
Sbjct: 622 ELGTGHQDSVYSVVFT-RDGNEVVSGSLDKSVKLWNL 657

>KLTH0E09394g Chr5 complement(853592..855160) [1569 bp, 522 aa] {ON}
           highly similar to uniprot|Q04225 Saccharomyces
           cerevisiae YMR131C RRB1 RiboSome Assembly 2
          Length = 522

 Score = 39.3 bits (90), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 45/189 (23%), Positives = 88/189 (46%), Gaps = 19/189 (10%)

Query: 15  ENWCLKLQPSYKHG-LLTGLSNGEIRLLDWATCKSLQNIKASETAINDLKVIDSDFSAGH 73
           E + L   P  K G LLTG  +G + L    T K + + K + +A N+  + D  FS   
Sbjct: 286 EGYALDWSPLNKSGSLLTGDCSGRVYLTQRHTSKWITD-KTAFSAGNNQSIEDIQFSRTE 344

Query: 74  LVSSASIDA---VKVFDIRTNS---CIATIQNESNSPFLSLDSRHG-LLACGTELQGIDA 126
               AS      ++++D R+      I+   + ++   +S + + G LLA G +    + 
Sbjct: 345 ATVFASCGCDGYIRIWDTRSKKHKPAISVKASATDVNVISWNEKIGYLLASGDD----NG 400

Query: 127 AVHIYDIRKWD------TPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQ 180
           +  ++D+R++       T   +  + H   +T I F+P D +I+   S D   +++DL  
Sbjct: 401 SWGVWDLRQFSPNTAASTSPVAQYNFHKGAITSISFNPLDDSIIAVASEDNTVSLWDLSV 460

Query: 181 DEEEDALHQ 189
           + +++ + Q
Sbjct: 461 EADDEEIKQ 469

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 37/78 (47%), Gaps = 9/78 (11%)

Query: 247 YVVDIYP----GLIATGKTQENAGELRLIPFKNEKIYTEKCFVIPHAHGDEVVRDIFISA 302
           Y +D  P    G + TG   + +G + L      K  T+K      A  ++ + DI  S 
Sbjct: 288 YALDWSPLNKSGSLLTG---DCSGRVYLTQRHTSKWITDKTAF--SAGNNQSIEDIQFSR 342

Query: 303 HQSDMLYSCGEDGYVKIW 320
            ++ +  SCG DGY++IW
Sbjct: 343 TEATVFASCGCDGYIRIW 360

>Skud_2.229 Chr2 (415869..417506) [1638 bp, 545 aa] {ON} YBR103W
           (REAL)
          Length = 545

 Score = 39.3 bits (90), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 57/217 (26%), Positives = 98/217 (45%), Gaps = 36/217 (16%)

Query: 27  HGLLTGLSNGEIRLLDWATCKSLQNI-KASETAINDLK-------VIDSDF-SAGHLVSS 77
           + ++TG+ NGE+RL  W    +LQN+     T I  +K        I  D  +   L S 
Sbjct: 235 NSIVTGVENGELRL--WNKVGALQNVLNFHRTPIVSIKWNKDGTHFISMDVENVTILWSV 292

Query: 78  ASIDAVKVFDIRTNSCIATIQNESNSPFLSLDSRHGLLACGTELQGID----------AA 127
            S   ++ F+++ +S  +T   +SNS   S DS       G +++ +D           A
Sbjct: 293 LSGTVMQHFELKESSSHSTNAEDSNSN--SEDS------LGVDVEWVDDDKFVIPGPKGA 344

Query: 128 VHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVN-ILLSGSTDGYTNIYDLKQDEEEDA 186
           + +Y I +   P+  LI  HH  ++ + F+  +VN +LLS S DG   I+       ++ 
Sbjct: 345 IFVYQITE-KAPIGKLI-GHHGSISVLNFN--NVNKLLLSASDDGTLRIWHGGNGNSQNC 400

Query: 187 LHQVINYASIHSCGWLSPKRIYTLSHMETFAIHELND 223
            +   +  SI S  W+S  R+ + S   +  +  L D
Sbjct: 401 FYG--HSQSIISASWVSDDRVISCSMDGSVRLWSLRD 435

>TPHA0G01840 Chr7 complement(379782..381077) [1296 bp, 431 aa] {ON}
           Anc_8.631 YOR212W
          Length = 431

 Score = 38.9 bits (89), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 35/59 (59%), Gaps = 3/59 (5%)

Query: 123 GIDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQD 181
           G D+ VHI+D R   +  +  I   + DV  +KF+ +D N ++SGS DG   +YDL+ D
Sbjct: 254 GSDSYVHIWDTRAPSSVQKFYI--SNSDVNTVKFY-NDGNAIVSGSDDGIIRLYDLRAD 309

>ZYRO0D01122g Chr4 complement(86927..88327) [1401 bp, 466 aa] {ON}
           similar to uniprot|P20053 Saccharomyces cerevisiae
           YPR178W PRP4 Splicing factor component of the U4/U6-U5
           snRNP complex
          Length = 466

 Score = 38.9 bits (89), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 58/124 (46%), Gaps = 10/124 (8%)

Query: 63  KVIDSDF-SAGHLVSSASIDAV-KVFDIRTNSCIATIQNESNSPFLSLDSR-HGLLACGT 119
           +V DS F  +G  ++SAS D   +++D+ T   +  +Q        SL  +  G L C  
Sbjct: 269 RVTDSKFHPSGRFIASASFDMTWRLWDVETQEEL-LLQEGHGKELYSLGFQCDGSLVCSG 327

Query: 120 ELQGIDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLK 179
              GID    ++DIR     +   +  H   +  + + P+   +  +GS DG   I+DL+
Sbjct: 328 ---GIDCKGLVWDIRSGKRAMS--LSGHTKPIYSLDWSPNGYQVA-TGSGDGTIRIWDLR 381

Query: 180 QDEE 183
           + EE
Sbjct: 382 KPEE 385

>Kpol_1014.19 s1014 complement(30466..31824) [1359 bp, 452 aa] {ON}
           complement(30466..31824) [1359 nt, 453 aa]
          Length = 452

 Score = 38.9 bits (89), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 67/143 (46%), Gaps = 24/143 (16%)

Query: 61  DLKVIDSDFSAGHLVSSASIDAVKVFDIRTNSCIATIQNESNSPFLSLDSRHGLLAC--- 117
           D+K  D     G +VS++  + ++++D R+  CI+++          L+ +H +L     
Sbjct: 210 DVKSCDWHPEMGLIVSASKDNLIRLWDPRSGQCISSL----------LNFKHTVLKTRFQ 259

Query: 118 ---GTELQGI--DAAVHIYDIRKWDTPLRSLIDSHHD-DVTCIKFHPSDVNILLSGSTDG 171
              G  L  I  D +  ++DIR     +R L+    + D   +++HP++  +    S DG
Sbjct: 260 PTKGNLLTAISKDKSCRVFDIRH---SMRELMVYRDEVDYMTLEWHPTNETMFTVASYDG 316

Query: 172 YTNIYDLKQDEEEDALHQVINYA 194
               +D+ QD E+     V+ YA
Sbjct: 317 SLKHFDILQDLEKPT--HVVPYA 337

>Suva_13.311 Chr13 complement(511812..513344) [1533 bp, 510 aa] {ON}
           YMR131C (REAL)
          Length = 510

 Score = 38.9 bits (89), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 48/195 (24%), Positives = 92/195 (47%), Gaps = 21/195 (10%)

Query: 10  NFFGSENWCLKLQPSYKHG-LLTGLSNGEIRLLDWATCKSLQNIKASETAINDLKVIDSD 68
           N    E + L   P  K G LL+G  +G+I L    T + + + K S T  N+  + D  
Sbjct: 269 NHGNVEGYGLDWSPLIKTGALLSGDCSGQIYLTQRHTSRWVTD-KQSFTVSNNESIEDIQ 327

Query: 69  FSAGH--LVSSASIDA-VKVFDIRTNS---CIATIQNESNSPFLSLDSRHG-LLACGTEL 121
           +S     + ++A+ D  ++++D R+      I+   + ++   +S   + G LLA G + 
Sbjct: 328 WSRTESTVFATAACDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSDKIGYLLASGDD- 386

Query: 122 QGIDAAVHIYDIRKWDTPLRS-------LIDSHHDDVTCIKFHPSDVNILLSGSTDGYTN 174
              +    ++D+R++ TP  +         D H   +T I F+P D +I+  GS D    
Sbjct: 387 ---NGTWGVWDLRQF-TPSNADTVQPVAQYDFHKGAITSIAFNPLDESIVAVGSEDNTVT 442

Query: 175 IYDLKQDEEEDALHQ 189
           ++DL  + +++ + Q
Sbjct: 443 LWDLSVEADDEEIKQ 457

 Score = 31.6 bits (70), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 25/112 (22%), Positives = 51/112 (45%), Gaps = 6/112 (5%)

Query: 94  IATIQNESNSPFLSLDSRHGLLACGTELQGIDAAVHIYDIRK----WDTPLRSLIDSHHD 149
           I T++N  N     LD    L+  G  L G D +  IY  ++    W T  +S   S+++
Sbjct: 264 IHTVKNHGNVEGYGLD-WSPLIKTGALLSG-DCSGQIYLTQRHTSRWVTDKQSFTVSNNE 321

Query: 150 DVTCIKFHPSDVNILLSGSTDGYTNIYDLKQDEEEDALHQVINYASIHSCGW 201
            +  I++  ++  +  + + DGY  I+D +  + + A+    +   ++   W
Sbjct: 322 SIEDIQWSRTESTVFATAACDGYIRIWDTRSKKHKPAISVKASNTDVNVISW 373

>KLTH0F19338g Chr6 (1564555..1568427) [3873 bp, 1290 aa] {ON}
           similar to uniprot|Q92271 Saccharomyces cerevisiae
           YOL138C Hypothetical ORF
          Length = 1290

 Score = 39.3 bits (90), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 33/63 (52%), Gaps = 3/63 (4%)

Query: 123 GIDAAVHIYDIRKW---DTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLK 179
           G   +V IYDI +    D P   ++  H   +  + F+ +  ++L+SGS DG   ++DL+
Sbjct: 185 GTSTSVSIYDINRANLVDGPASMVLSKHTRSINSVDFNMAQTSLLISGSQDGCIKVWDLR 244

Query: 180 QDE 182
             +
Sbjct: 245 SSQ 247

>YER107C Chr5 complement(373448..374545) [1098 bp, 365 aa] {ON}
           GLE2RNA export factor associated with the nuclear pore
           complex (NPC); associates with NUP116p; required for
           polyadenylated RNA export but not for protein import;
           homologous to S. pombe Rae1p and human RAE1
          Length = 365

 Score = 38.5 bits (88), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 32/149 (21%), Positives = 66/149 (44%), Gaps = 23/149 (15%)

Query: 74  LVSSASIDA-VKVFDIRTNSCIATIQNESNSPFLSLDSRHGLLACGTELQGIDAAVHIYD 132
           + S++S D  V+++D++        Q+ES+SP L   +R           G D A+ +YD
Sbjct: 51  MFSASSWDGKVRIWDVQNGVPQGRAQHESSSPVLC--TRWSNDGTKVASGGCDNALKLYD 108

Query: 133 IRKWDTPLRSLIDSHHDDVTCIKF---HPSDVNILLSGSTDGYTNIYDLKQDEEEDALHQ 189
           I    T     I  H   +  ++F    PS+   +++GS D     +D++Q +    +  
Sbjct: 109 IASGQT---QQIGMHSAPIKVLRFVQCGPSNTECIVTGSWDKTIKYWDMRQPQPVSTV-- 163

Query: 190 VINYASIHSCGWLSPKRIYTLSHMETFAI 218
                       + P+R+Y++ + ++  +
Sbjct: 164 ------------MMPERVYSMDNKQSLLV 180

>TBLA0B08730 Chr2 complement(2077729..2079114) [1386 bp, 461 aa]
           {ON} Anc_3.25 YNL317W
          Length = 461

 Score = 38.9 bits (89), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 60/132 (45%), Gaps = 20/132 (15%)

Query: 61  DLKVIDSDFSAGHLVSSASIDAVKVFDIRTNSCIATIQNESNSPFLSLDSRHGLLAC--- 117
           D+K  D     G +VS +  + VK +D R+  C++TI          L+ +H +L     
Sbjct: 211 DVKSCDWHPEMGLIVSGSKDNLVKFWDPRSGQCVSTI----------LNFKHTVLRTRFQ 260

Query: 118 ---GTELQGI--DAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGY 172
              G  L GI  D +  ++DIR     L ++ D    D   + +HP + ++    + DG 
Sbjct: 261 PTRGNYLLGISKDKSCRVFDIRNHTKELLTVRD--EVDFMTLSWHPINESVFTLANYDGS 318

Query: 173 TNIYDLKQDEEE 184
              +D+ +D E+
Sbjct: 319 IKHFDILEDLEK 330

>Smik_12.279 Chr12 complement(526367..528820) [2454 bp, 817 aa] {ON}
           YLR222C (REAL)
          Length = 817

 Score = 38.9 bits (89), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 53/107 (49%), Gaps = 11/107 (10%)

Query: 75  VSSASIDAVKVFDIRTNSCIATIQNESNSPFLSLDSRHGLLACGTELQGIDAAVHIYDIR 134
           VS A +  +K+F ++T   + +++  S S  L  DS   LLA G    G D ++ + DI 
Sbjct: 79  VSQAQL--LKIFHLKTGKVVRSMKISSPSYILDADSTSTLLAVG----GTDGSIIVVDIE 132

Query: 135 KWDTPLRSLIDSHHDDVTCIKFHP---SDVNILLSGSTDGYTNIYDL 178
             +  +      H   ++ +KF+    S + +L SG T+G   ++DL
Sbjct: 133 --NGYITHSFKGHGGTISSLKFYGQLDSKIWLLASGDTNGMVKVWDL 177

 Score = 32.0 bits (71), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 27/55 (49%), Gaps = 5/55 (9%)

Query: 274 KNEKIYTEKCFVIP---HAHGDEVVRDIFISAHQSDMLYSCGEDGYVKIWKSTQG 325
           K  KI++   F +      H + V R  FI+  +   L SCG DG +KIW  + G
Sbjct: 555 KTVKIWSLDTFSVMKTLEGHTNAVQRCSFINKQKQ--LVSCGADGLIKIWDCSSG 607

>Ecym_7042 Chr7 (86859..88103) [1245 bp, 414 aa] {ON} similar to
           Ashbya gossypii AEL250C
          Length = 414

 Score = 38.5 bits (88), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 26/107 (24%), Positives = 58/107 (54%), Gaps = 9/107 (8%)

Query: 81  DAVKVFDIRTNSCIATIQNESNSPFLS---LDSRHGLLACGTELQGIDAAVHIYDIRKWD 137
           + + + D RT +  +T ++  ++  ++    +  +  L C  + +G    ++I DIR+ +
Sbjct: 263 NGLTILDTRTPTTFSTKRHSCHTGGINAVQFNYDNDFLLCSADSEG---TLNICDIRQLE 319

Query: 138 TPLRSLIDSHHDDVTCIKFHPSDVNILLS-GSTDGYTNIYDLKQDEE 183
            P+++   SH D V+ I+++P    ++ S G  DG   I+DL Q+++
Sbjct: 320 HPVKTW--SHLDAVSTIQWNPKFPTVIASAGQNDGLVKIWDLAQEDD 364

>YLR222C Chr12 complement(579318..581771) [2454 bp, 817 aa] {ON}
           UTP13Nucleolar protein, component of the small subunit
           (SSU) processome containing the U3 snoRNA that is
           involved in processing of pre-18S rRNA
          Length = 817

 Score = 38.9 bits (89), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 53/107 (49%), Gaps = 11/107 (10%)

Query: 75  VSSASIDAVKVFDIRTNSCIATIQNESNSPFLSLDSRHGLLACGTELQGIDAAVHIYDIR 134
           VS A +  +K+F ++T   + +++  S S  L  DS   LLA G    G D ++ + DI 
Sbjct: 79  VSQAQL--LKIFHLKTGKVVRSMKISSPSYILDADSTSTLLAVG----GTDGSIIVVDIE 132

Query: 135 KWDTPLRSLIDSHHDDVTCIKFHP---SDVNILLSGSTDGYTNIYDL 178
             +  +      H   ++ +KF+    S + +L SG T+G   ++DL
Sbjct: 133 --NGYITHSFKGHGGTISSLKFYGQLNSKIWLLASGDTNGMVKVWDL 177

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 40/89 (44%), Gaps = 18/89 (20%)

Query: 240 RKAWDCDYVVDIYPGLIATGKTQENAGELRLIPFKNEKIYTEKCFVIP---HAHGDEVVR 296
           R  WD  +    Y  L+AT     ++G+      K  KI++   F +      H + V R
Sbjct: 534 RGLWDVSFCQ--YDKLLAT-----SSGD------KTVKIWSLDTFSVMKTLEGHTNAVQR 580

Query: 297 DIFISAHQSDMLYSCGEDGYVKIWKSTQG 325
             FI+  +   L SCG DG +KIW  + G
Sbjct: 581 CSFINKQKQ--LISCGADGLIKIWDCSSG 607

>Kpol_1031.36 s1031 complement(87105..89225) [2121 bp, 706 aa] {ON}
           complement(87105..89225) [2121 nt, 707 aa]
          Length = 706

 Score = 38.5 bits (88), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 39/131 (29%), Positives = 60/131 (45%), Gaps = 29/131 (22%)

Query: 69  FSAGHLVSSASIDAVKVFDIRTNSCIATI-------QNE-----------SNSPFL--SL 108
           F + HLVS++    ++ +D+    CI TI       QN+           S+ PF+  SL
Sbjct: 505 FDSVHLVSASQDKTIRQWDLVNGKCIQTIDLSSVVKQNQTDIVNIPDFYSSSEPFVTGSL 564

Query: 109 DSRHGLLACGTELQGIDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGS 168
                 LA GT     D  V ++D+R     +R+ +  H + VT +KF   D   L+SGS
Sbjct: 565 QCFDAALATGTR----DGLVRLWDMRSGKV-VRTFM-GHTNAVTSLKF---DSYNLISGS 615

Query: 169 TDGYTNIYDLK 179
            D     +DL+
Sbjct: 616 LDKSIRTWDLR 626

 Score = 31.6 bits (70), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 33/150 (22%), Positives = 64/150 (42%), Gaps = 20/150 (13%)

Query: 25  YKHGLLTGLSNGEIRLLDWATCKSLQNIKASETAINDLKVIDSDFSAGHLVSSASIDAVK 84
           +   L TG  +G +RL D  + K ++       A+  LK     F + +L+S +   +++
Sbjct: 567 FDAALATGTRDGLVRLWDMRSGKVVRTFMGHTNAVTSLK-----FDSYNLISGSLDKSIR 621

Query: 85  VFDIRTNSCIATIQNESNSPFLSLDSRHGLLACGTELQGIDAAVHIY---DIRKWDTPLR 141
            +D+RT S       +S    +  DS + + A G      + +  +Y   D ++W+    
Sbjct: 622 TWDLRTGSLSDLFAYDSPVYSIDFDSSNLVSAIG------ETSFKVYNRKDDKQWECV-- 673

Query: 142 SLIDSHHDDVTCIKFHPSDVNILLSGSTDG 171
               +  +D + I       N  ++GS DG
Sbjct: 674 ----NSAEDTSSIYHVKYKNNYAVTGSNDG 699

>CAGL0L00781g Chr12 (97503..99524) [2022 bp, 673 aa] {ON} similar to
           uniprot|P39014 Saccharomyces cerevisiae YIL046w MET30
          Length = 673

 Score = 38.5 bits (88), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 38/171 (22%), Positives = 76/171 (44%), Gaps = 15/171 (8%)

Query: 11  FFGSENWCLKLQPSYKHGLLTGLSNGEIRLLDWATCKSLQNIKASETAINDLKVIDSDFS 70
           F G  +  L LQ +Y+  L TG  +  + + D  T K ++ +      +  L   D    
Sbjct: 330 FKGHMDGVLTLQFNYRL-LFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQKLI 388

Query: 71  AGHLVSSASIDAVKVFDIRTNSCIATIQNESNSPFLSLDSRHGLLACGTELQGIDAAVHI 130
            G L  +     ++V++  T  CI+T +  ++S  +S+DS   ++  G+     D  V +
Sbjct: 389 TGSLDKT-----IRVWNYITGECISTYRGHTDS-VMSVDSHKKIIVSGSA----DKTVKV 438

Query: 131 YDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQD 181
           + +   ++     +  H + V C+K HP   +   S S D    ++D++ +
Sbjct: 439 WHV---ESRTCYTLKGHTEWVNCVKLHPKSFS-CYSCSDDTTIRMWDIRTN 485

>Ecym_2024 Chr2 complement(35886..39839) [3954 bp, 1317 aa] {ON}
           similar to Ashbya gossypii ADL186C
          Length = 1317

 Score = 38.9 bits (89), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 31/60 (51%), Gaps = 3/60 (5%)

Query: 123 GIDAAVHIYDIRKWD---TPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLK 179
           G   ++ IYDI +     +PL +    H   +  + F+    N+++SG  DGY  ++DL+
Sbjct: 213 GTSTSLSIYDINRTSDIGSPLVATYSEHSRSINSVDFNMGQTNLIISGGQDGYIKVWDLR 272

>ADL186C Chr4 complement(369320..373405) [4086 bp, 1361 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL138C
          Length = 1361

 Score = 38.5 bits (88), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 32/60 (53%), Gaps = 3/60 (5%)

Query: 123 GIDAAVHIYDIRKW---DTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLK 179
           G   +V IYDI +    D+PL + +  H   +  + F+    ++L+SG  DG   ++DL+
Sbjct: 203 GTSTSVSIYDINRASAKDSPLITTLSEHSRSINSVDFNMGQTHLLISGGQDGCIKVWDLR 262

>TBLA0G01490 Chr7 (389958..392156) [2199 bp, 732 aa] {ON} Anc_4.122
           YGL003C
          Length = 732

 Score = 38.5 bits (88), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 53/109 (48%), Gaps = 9/109 (8%)

Query: 70  SAGHLVSSASIDAVKVFDIRTNSCIATIQNESN-SPFLSLDSRHGLLACGTELQGIDAAV 128
           +  H+    S   ++++D+    CI T+   ++ +  LS +S   +L  G+     D  +
Sbjct: 479 TGSHIAIGQSNGIIEIYDVTKRKCIRTLSGHTDRTACLSWNSH--ILTSGSR----DRTI 532

Query: 129 HIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYD 177
              D+R  D P    I SH  +V  +K++ SD N L+SG  D   NIYD
Sbjct: 533 LHRDVRMKD-PFFERIKSHTQEVCGLKWNESD-NKLVSGGNDNTVNIYD 579

>NCAS0E03750 Chr5 complement(736672..740502) [3831 bp, 1276 aa] {ON}
           Anc_7.310
          Length = 1276

 Score = 38.5 bits (88), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 41/184 (22%), Positives = 82/184 (44%), Gaps = 24/184 (13%)

Query: 18  CLKLQPSYKHGLLTGLSNGEIRLLDWATCKSLQNIKASETAI-------NDLKVIDSDFS 70
            L+  P  ++ L +  +NGEI  L W   K+L +   S +A        +++K +  + S
Sbjct: 118 TLRFNPKQQNVLASAGNNGEI--LIWDINKTLSSTDYSPSAPGIAMSTQDEIKSVSWNKS 175

Query: 71  AGHLVSSA--SIDAVKVFDIRTNSCIATIQNESNS----PFLSLDSRHGLL------ACG 118
             H+ +SA  +     ++D++    +  +   S      P L++   H  +      A G
Sbjct: 176 LAHVFASAGDTTTYASIWDLKAKKEVIHLNYTSPKTGLKPNLAVVEWHPKVTTYVATASG 235

Query: 119 TELQGIDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDL 178
           ++    D  + I+D+R  + P+ +L   H   +  + +   D ++LLS   DG   ++D 
Sbjct: 236 SD---SDPVILIWDLRNSNMPMTTLEGPHTKGIMSLDWCTKDESLLLSSGRDGIVALWDT 292

Query: 179 KQDE 182
           K +E
Sbjct: 293 KANE 296

>TPHA0E01790 Chr5 (359679..361004) [1326 bp, 441 aa] {ON} Anc_5.429
           YDR364C
          Length = 441

 Score = 38.1 bits (87), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 44/189 (23%), Positives = 83/189 (43%), Gaps = 15/189 (7%)

Query: 19  LKLQPSYKHGLLTGLSNGEIRLLD-WATCKSLQNIKASETAINDLKVIDSDFSAGHLVSS 77
           LK  P+  H  L+G ++  IRL D +   + +++ K  + A+   + +D + +     SS
Sbjct: 154 LKFFPNTAHMFLSGGNDNMIRLWDFYHDRRCIRDYKGHKKAV---RSVDFNNNGTVFFSS 210

Query: 78  ASIDAVKVFDIRTNSCIATIQNESNSPFLSLDSRHGLLACGTELQGI-DAAVHIYDIR-K 135
           +    VK++D  T    A ++  S    +  D +   L+    + G+ ++ ++ YD R  
Sbjct: 211 SYDQTVKIWDTETGKVKAKVKCNS----IPNDVKPRPLSDSEYIVGLSNSKINHYDQRVS 266

Query: 136 WDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQD----EEEDALHQVI 191
               L    D H   + C+K+ P D +  +S S D    I++ K +    +  D     +
Sbjct: 267 SKNGLVQTYDHHQGSILCLKYFP-DGSKFISSSEDKTVRIWENKINIPIKQIADTTQHSM 325

Query: 192 NYASIHSCG 200
            Y  IH  G
Sbjct: 326 PYMDIHPEG 334

>Skud_12.285 Chr12 complement(525831..528284) [2454 bp, 817 aa] {ON}
           YLR222C (REAL)
          Length = 817

 Score = 38.5 bits (88), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 53/107 (49%), Gaps = 11/107 (10%)

Query: 75  VSSASIDAVKVFDIRTNSCIATIQNESNSPFLSLDSRHGLLACGTELQGIDAAVHIYDIR 134
           VS A +  +K+F ++T   + +++  S S  L  D    LLA G    G D ++ I DI 
Sbjct: 79  VSQAQL--LKIFQLKTGRIVRSLKISSPSYILDTDPTSTLLAVG----GTDGSIVIVDIE 132

Query: 135 KWDTPLRSLIDSHHDDVTCIKFHP---SDVNILLSGSTDGYTNIYDL 178
             +  +   +  H   ++ +KF+    S+  +L SG T+G   ++DL
Sbjct: 133 --NGYITHSLKGHGGTISSLKFYGQLDSETWLLASGDTNGMVKVWDL 177

 Score = 33.9 bits (76), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 49/110 (44%), Gaps = 19/110 (17%)

Query: 240 RKAWDCDYVVDIYPGLIATGKTQENAGELRLIPFKNEKIYTEKCFVIP---HAHGDEVVR 296
           R  WD  +    Y  L+AT     ++G+      K  KI++   F +      H + V R
Sbjct: 534 RGLWDVSFCQ--YDKLLAT-----SSGD------KTVKIWSLDTFSVMKTLEGHSNAVQR 580

Query: 297 DIFISAHQSDMLYSCGEDGYVKIWKSTQGP-LNTPETFWDYSEKMNVLGD 345
             FI+  +   L SCG DG +KIW  + G  LNT +   +    +N + D
Sbjct: 581 CSFINKQKQ--LVSCGADGLIKIWDCSSGECLNTLDGHNNRLWALNTMND 628

 Score = 31.2 bits (69), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 48/235 (20%), Positives = 90/235 (38%), Gaps = 48/235 (20%)

Query: 6   LVESNFFGSENWCLKLQPSYKHGLLTGLSNGEIRLLDWATCKSLQNIKASETAINDLKVI 65
           +V S    S ++ L   P+    L  G ++G I ++D        ++K     I+ LK  
Sbjct: 95  IVRSLKISSPSYILDTDPTSTL-LAVGGTDGSIVIVDIENGYITHSLKGHGGTISSLKFY 153

Query: 66  DSDFSAGHLVSSASIDA-VKVFDIRTNSCIATIQNESNSPFLSLDSRHGLLACGTELQGI 124
               S   L++S   +  VKV+D+    C+ T+Q  S++                 ++G+
Sbjct: 154 GQLDSETWLLASGDTNGMVKVWDLVKRKCLLTLQEHSSA-----------------VRGL 196

Query: 125 DAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQDEEE 184
           D                 +I+    D + +K        LLSG  D   N++D    ++ 
Sbjct: 197 D-----------------IIEGESGDGSSLK--------LLSGGRDDIVNVWDFDMKKKC 231

Query: 185 DALHQVINYASIHSCGWL----SPKRIYTLSHMETFAIHELNDKSDELREPQPLD 235
             +  +     + SCG+L      + IYT      F + +L   +   R  +P++
Sbjct: 232 KLVKTLPVNQQVESCGFLKNHDGKRIIYTAGGDAIFQLIDLESGTVLKRTNKPIE 286

>KLTH0D05346g Chr4 complement(475917..477440) [1524 bp, 507 aa] {ON}
           highly similar to uniprot|Q04305 Saccharomyces
           cerevisiae YMR093W UTP15 Nucleolar protein component of
           the small subunit (SSU) processome containing the U3
           snoRNA that is involved in processing of pre-18S rRNA
          Length = 507

 Score = 38.1 bits (87), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 45/102 (44%), Gaps = 6/102 (5%)

Query: 83  VKVFDIRTNSCIATIQNESNSPFLSLDSRHG-LLACGTELQGIDAAVHIYDIRKWDTPLR 141
           V++F  RT   I T     +  + +   + G LLA G         V IYD     T L 
Sbjct: 63  VQLFSSRTRQVIKTFSRFKDVVYSASFRQDGKLLAMG----DATGRVSIYDSYNPRTQLV 118

Query: 142 SLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQDEE 183
           S+  S H      KFHP+D   L++ S D    ++D+ Q +E
Sbjct: 119 SIAASSHP-THVAKFHPADSRTLVTASDDRVVRVWDITQAQE 159

>KLTH0E15576g Chr5 complement(1384027..1386198) [2172 bp, 723 aa]
           {ON} similar to uniprot|P47025 Saccharomyces cerevisiae
           YJL112W MDV1 WD repeat protein that regulates steps in
           the Dnm1p-dependent process of mitochondrial fission
          Length = 723

 Score = 38.1 bits (87), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 38/140 (27%), Positives = 58/140 (41%), Gaps = 24/140 (17%)

Query: 69  FSAGHLVSSASIDAVKVFDIRTNSCIATI--------------QNESNSPFLSLDSRHGL 114
           F    LVS +    ++ +D+RT  C+ TI                 SN+P  S+   H  
Sbjct: 512 FEGNSLVSGSQDRTIRQWDLRTGKCLQTIDINFTNRGTSDGFSTISSNNPRSSVLLTHND 571

Query: 115 LACGTELQGIDAAVHIYD----IRKWDTPLRSLI---DSHHDDVTCIKFHPSDVNILLSG 167
                 LQ  DAA+        +R WD  +  ++   + H D VT ++F   D   L++G
Sbjct: 572 PPVIGALQCYDAAMATGTKDGIVRLWDLRMGQVVRTLEGHTDAVTGLQF---DAVNLVTG 628

Query: 168 STDGYTNIYDLKQDEEEDAL 187
           S D    I+DL+     DA 
Sbjct: 629 SLDRSIRIWDLRTGTLADAF 648

>KLLA0F21406g Chr6 complement(1996260..1998377) [2118 bp, 705 aa]
           {ON} similar to uniprot|P47025 Saccharomyces cerevisiae
           YJL112W MDV1 WD repeat protein that regulates steps in
           the Dnm1p-dependent process of mitochondrial fission
          Length = 705

 Score = 38.1 bits (87), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 58/130 (44%), Gaps = 19/130 (14%)

Query: 61  DLKVIDSDFSAGHLVSSASID-AVKVFDIRTNSCIATIQNESNSPFLSLDSRHGLLACGT 119
           D+  +D D   G + S+ S+D +VKV+D+     IAT+     S       ++  L  G 
Sbjct: 399 DITCLDFDMPFGTMCSAGSLDHSVKVWDLSKKKQIATLHGHLASISCMQIDQYSTLITG- 457

Query: 120 ELQGIDAAVHIYDIRKWDTPLRS-----------LIDSHHDDVTCIKFHPSDVNILLSGS 168
              G DA + ++DI K      S             DSH D++T I F   D + L+SGS
Sbjct: 458 ---GRDAVLKLWDIDKAMADEASNSSEDNDACLYTFDSHVDEITAISF---DGDNLVSGS 511

Query: 169 TDGYTNIYDL 178
            D     +DL
Sbjct: 512 QDRTVRQWDL 521

>SAKL0D04796g Chr4 (372598..374907) [2310 bp, 769 aa] {ON} similar
           to uniprot|P47025 Saccharomyces cerevisiae YJL112W MDV1
           WD repeat protein that regulates steps in the
           Dnm1p-dependent process of mitochondrial fission
          Length = 769

 Score = 38.1 bits (87), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 41/142 (28%), Positives = 61/142 (42%), Gaps = 31/142 (21%)

Query: 69  FSAGHLVSSASIDAVKVFDIRTNSCIATIQ-------NESNSPFLSLDSRHGLLACGTEL 121
           FS  +L+S +    ++ +D+ +  C+ TI        N S S  LS  SR   L    E 
Sbjct: 560 FSGDNLISGSQDRTIRQWDLNSGKCVQTIDINFASRVNSSTSGTLS--SRSSTLLVPNE- 616

Query: 122 QGIDAAVHIYD-----------IRKWDTPLRS-----LIDSHHDDVTCIKFHPSDVNILL 165
           Q +  A+  YD           +R WD  LRS      +  H D +T ++F   D   L+
Sbjct: 617 QPVIGALQCYDAALATGTKDGLVRLWD--LRSGQVVRTLQGHTDAITSLQF---DSINLI 671

Query: 166 SGSTDGYTNIYDLKQDEEEDAL 187
           +GS D    I+DL+     DA 
Sbjct: 672 TGSIDRSIRIWDLRTGTLADAF 693

 Score = 30.8 bits (68), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 56/103 (54%), Gaps = 17/103 (16%)

Query: 83  VKVFDIRTNSCIATIQNESNS-PFLSLDSRHGLLACGTELQGIDAAVHIYDIRKWDTPLR 141
           V+++D+R+   + T+Q  +++   L  DS +  L  G+    ID ++ I+D+R       
Sbjct: 639 VRLWDLRSGQVVRTLQGHTDAITSLQFDSIN--LITGS----IDRSIRIWDLRTG----- 687

Query: 142 SLIDS--HHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQDE 182
           +L D+  + + V+ ++F   D++ ++  + +    IYD KQDE
Sbjct: 688 TLADAFAYENPVSHLEF---DLDKIVVANNENTVKIYDRKQDE 727

>ZYRO0B10450g Chr2 complement(825240..826688) [1449 bp, 482 aa] {ON}
           highly similar to uniprot|P33750 Saccharomyces
           cerevisiae YLL011W
          Length = 482

 Score = 38.1 bits (87), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 80/366 (21%), Positives = 150/366 (40%), Gaps = 72/366 (19%)

Query: 29  LLTGLSNGEIRLLDWATCKSLQNIKASETAINDLKV----IDSDFSAGHLVSSASIDAVK 84
           + TG  +G ++  + ++ + L + KA    +  L V       + +  +++S      VK
Sbjct: 83  MATGSGDGVVKFWNMSSSEELCSFKAHYGIVTGLCVSPVLASKNKNLQYMLSCGDDKTVK 142

Query: 85  VFDIRTNSCIATIQNESNSPFLSLDSRHGLLAC---GTELQGIDA-------AVHIYDIR 134
           ++ + T+   A ++++ N     L++R GLL         QGID              I+
Sbjct: 143 LWSVDTDD-YADVKDDQN-----LNTR-GLLKTFYGDHSFQGIDHHRSNSAFVTGGAQIQ 195

Query: 135 KWDTPLRSLIDSH----HDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQDEEEDALHQV 190
            WDT  RS   S+     D++T +KF+ +D NIL S  +D    +YDL+ +       ++
Sbjct: 196 LWDTS-RSKSTSNLSWGADNITSVKFNQNDSNILASTGSDNSIVLYDLRTNS---PTQKI 251

Query: 191 INYASIHSCGWLSPKRIYTLSHMETFAIHELNDKSDELREPQPLDFGDVRKAWDCDYVVD 250
           +     +S  W         + ME F     N+  +         + D+RK    +  ++
Sbjct: 252 VQQMRTNSLCW---------NPMEPFNFVTGNEDHNAY-------YYDMRK---MNRALN 292

Query: 251 IYPGLIATGKTQENAGELRLIPFKNEKI-----YTEKCFVIPHAHGDEV-----VRDIFI 300
           ++   ++         ++   P  +E +      T + F   H H  EV     ++ +F 
Sbjct: 293 VFKDHVSA------VMDVDFAPTGDEIVTGSYDKTIRIFKTNHGHSREVYHTKRMQHVFQ 346

Query: 301 SAHQSDMLY--SCGEDGYVKIWKSTQGPLNTPETFWDYSEKMNVLGDDS--KEAFTNLEE 356
             +  D  Y  S  +DG V++W+S     +  +T    S + N L  D   KE F N+ E
Sbjct: 347 VKYSMDSKYIVSGSDDGNVRLWRSKAWDRSNAKT----SREKNKLEYDEKLKERFKNMPE 402

Query: 357 PLIIQK 362
              I +
Sbjct: 403 IRRISR 408

>AAR057W Chr1 (442821..445589) [2769 bp, 922 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR057C (PWP2)
          Length = 922

 Score = 38.1 bits (87), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 40/212 (18%), Positives = 85/212 (40%), Gaps = 47/212 (22%)

Query: 3   SYSLVESNFFGSENWCLKLQPSY--KHGLLTGLSNGEIRLLDWATCKSLQNIKASETAIN 60
           S+ + + N+F ++N  +K    +   + L+ G SNGE R+ +      +Q +   + A+N
Sbjct: 258 SWRITKKNYFYAKNAKVKCAAFHADSNMLIVGFSNGEFRMYELPDFTFIQQLSMGQNAVN 317

Query: 61  DLKVIDSD------------------------------FSA----------GHLVSSASI 80
            + V  S                               F A            +V++A  
Sbjct: 318 TVAVNRSGEWLAFGSSTLGQLLVYEWQSESYILKQQGHFDALNALAYSPDGARIVTAAED 377

Query: 81  DAVKVFDIRTNSCIATIQNESNSPFLSLDSRHGLLACGTELQGIDAAVHIYDIRKWDTPL 140
             +K++DI +  C+AT +  ++S      +++G +   + L   D  V  +D+ ++    
Sbjct: 378 GKIKIWDIVSGFCLATFEEHTSSVTSVQFAKNGQIMFSSSL---DGTVKAWDLMRFRN-F 433

Query: 141 RSLIDSHHDDVTCIKFHPSDVNILLSGSTDGY 172
           R+   +     +C+   P+   ++ +GS D Y
Sbjct: 434 RTFTATERIQFSCLAADPTG-EVVCAGSLDNY 464

>TBLA0F04240 Chr6 (1043577..1045760) [2184 bp, 727 aa] {ON}
           Anc_6.363 YCR084C
          Length = 727

 Score = 38.1 bits (87), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 40/157 (25%), Positives = 71/157 (45%), Gaps = 16/157 (10%)

Query: 29  LLTGLSNGEIRLLDWATCKSLQNIKASETAINDLKVIDSDFSAGHLVSSASIDAVKVFDI 88
           L  G  +  IR+ D  T + +  +K  E    D+  +D   S   LVS +    V+++D+
Sbjct: 472 LAAGAEDKLIRIWDITTKQIVMILKGHE---QDIYSLDYFPSGEKLVSGSGDKTVRIWDL 528

Query: 89  RTNSCIATIQNESNSPFLSLDSRHG-LLACGTELQGIDAAVHIYD------IRKWDTPLR 141
           RT  C  T+  E     +S    +G  +A G+    +D +  I+D      +++ D+   
Sbjct: 529 RTGQCSLTLSIEDGVTTVSSSPNNGKFIAAGS----LDRSARIWDTETGFLLKRLDS-QT 583

Query: 142 SLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDL 178
            L + H D +  + F   D   L+SGS D    +++L
Sbjct: 584 DLQNGHKDSIYSVSFT-KDGKKLVSGSLDRSVKLWNL 619

>Suva_6.187 Chr6 complement(344709..346853) [2145 bp, 714 aa] {ON}
           YJL112W (REAL)
          Length = 714

 Score = 38.1 bits (87), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 59/138 (42%), Gaps = 36/138 (26%)

Query: 65  IDSDFSAGHLVSSASIDAVKVFDIRTNSCIATI-----------------------QNES 101
           +DSDF    LVS +    ++ +D+R+  C+  I                       Q   
Sbjct: 510 LDSDF----LVSGSQDRTIRQWDLRSGKCMQAIDLSFANVSSTATNVDLSKSTLLTQRSE 565

Query: 102 NSPFLSLDSRHGLLACGTELQGIDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDV 161
                +L S    LA GT+    D  V ++D+R     +R+L + H D +T +KF   D 
Sbjct: 566 RPSIGALQSFDAALATGTK----DGVVRLWDLRSGKV-IRTL-EGHTDAITSLKF---DS 616

Query: 162 NILLSGSTDGYTNIYDLK 179
             L++GS D    ++DL+
Sbjct: 617 ACLVTGSYDRTVRVWDLR 634

>Skud_11.271 Chr11 complement(490869..492809) [1941 bp, 646 aa] {ON}
           YKR036C (REAL)
          Length = 646

 Score = 38.1 bits (87), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 46/197 (23%), Positives = 87/197 (44%), Gaps = 40/197 (20%)

Query: 18  CLKLQPSYKHGLLTGLSNGEIRLLDWATCKSL--------QNIKAS--ETAINDLKVIDS 67
           C+++  +  + L+TG  +  +++ D    K L        QN++ +     I++ ++ + 
Sbjct: 369 CMQMDKTNYNILITGSKDATLKMWDLNLSKELYLDHSPLRQNMEETIITPCIHNFELHND 428

Query: 68  DFSAGHLVSSASIDAVK---VF--DIRTNSCIATIQ-----NESNSPFLSLDSRHGLLAC 117
           + +A    S A I   K   +F  D+ T  C+  +        +++   +   ++G    
Sbjct: 429 EITALSFDSEALISGSKDKKIFHWDLATGKCVQELNLIFTPTHNDTKTSTRSGKNGTYLL 488

Query: 118 GTELQGIDAAVHIYD-----------IRKWD----TPLRSLIDSHHDDVTCIKFHPSDVN 162
           GTE   I  A+  Y+           +R WD     P+RSL + H D +T +KF   D  
Sbjct: 489 GTEAPMI-GALQCYNSALATGTKDGVVRLWDLRIGKPVRSL-EGHTDGITSLKF---DSE 543

Query: 163 ILLSGSTDGYTNIYDLK 179
            L++GS D    I+DL+
Sbjct: 544 KLVTGSMDNSVRIWDLR 560

>KLLA0C08976g Chr3 (784536..787271) [2736 bp, 911 aa] {ON} highly
           similar to uniprot|P25636 Saccharomyces cerevisiae
           YCR057C PWP2 part of small (ribosomal) subunit (SSU)
           processosome (contains U3 snoRNA) Eight WD-repeats with
           homology with G protein beta subunits flanked by
           nonhomologous N-terminal and C-terminal extensions
           regulatory protein
          Length = 911

 Score = 38.1 bits (87), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 43/183 (23%), Positives = 76/183 (41%), Gaps = 20/183 (10%)

Query: 3   SYSLVESNFFGSENWCLKLQPSYKHG--LLTGLSNGEIRLLDWATCKSLQNIKASETAIN 60
           S+ + + NFF +    +K    +     L  G SNGE RL +      +Q +   + A+N
Sbjct: 243 SWRITKKNFFHANRAKVKCSAFHAASNILTVGFSNGEFRLYELPEFIMIQQLSMGQNAVN 302

Query: 61  DLKVIDSDFSAGHLVS--SASIDAVKVFDIRTNSCIATIQNESNSPFLSLDSRHGLLACG 118
            + +     S+G  ++  S+ +  + V++ ++ S I   Q          D+ +G L   
Sbjct: 303 TVAIN----SSGEWLAFGSSKLGQLIVYEWQSESYILKQQGH-------FDTLNG-LCYS 350

Query: 119 TELQGIDAAVHIYDIRKWDTP---LRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNI 175
            +   I  A H   I+ WD       +  D H   V+ ++F      +L S S DG    
Sbjct: 351 PDGSKIVTASHEGKIKIWDVASGFCLATFDEHAGGVSAVEFAKKG-QVLFSASLDGTVKA 409

Query: 176 YDL 178
           +DL
Sbjct: 410 WDL 412

>Suva_4.348 Chr4 (616802..618448) [1647 bp, 548 aa] {ON} YBR103W
           (REAL)
          Length = 548

 Score = 37.7 bits (86), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 41/198 (20%), Positives = 88/198 (44%), Gaps = 22/198 (11%)

Query: 27  HGLLTGLSNGEIRLLDWATCKSLQNIKASETAINDLKVIDSDFSAGHLVSSASIDAVKVF 86
           + ++TG+ NGE+RL  W    +LQN+     +   +  I  +    H +S    +   ++
Sbjct: 233 NSIVTGVENGELRL--WNKAGALQNVLNFHRS--PIVSIKWNKDGTHFISMDVENVTILW 288

Query: 87  DIRTNSCIATI---QNESNSPFLSLDSRHGLLACGTELQGID----------AAVHIYDI 133
           +I + + +      +N  +S      +  G  + G +++ +D           A+ +Y I
Sbjct: 289 NILSGTVMQHFELKENRGSSTTAESSNNSGEDSLGVDVEWVDDDKFVIPGPKGAIFVYQI 348

Query: 134 RKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQDEEEDALHQVINY 193
            +   P+  LI  HH  ++ ++F+ ++  +LLS S DG   I+       ++  +   + 
Sbjct: 349 TE-KAPIGKLI-GHHGSISVLEFNNTN-KLLLSASDDGTLRIWHGGNGNSQNCFYG--HS 403

Query: 194 ASIHSCGWLSPKRIYTLS 211
            SI S  W+   ++ + S
Sbjct: 404 QSIVSASWVGDDKVISCS 421

>KLLA0E21187g Chr5 (1892524..1893813) [1290 bp, 429 aa] {ON} similar
           to uniprot|P40968 Saccharomyces cerevisiae YDR364C CDC40
           Pre-mRNA splicing factor important for catalytic step II
           of pre-mRNA splicing and plays a role in cell cycle
           progression required for DNA synthesis during mitosis
           and meiosis has WD repeats
          Length = 429

 Score = 37.7 bits (86), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 40/170 (23%), Positives = 72/170 (42%), Gaps = 8/170 (4%)

Query: 12  FGSENWCLKLQPSYKHGLLTGLSNGEIRLLDWATCKSLQNIKASETAINDLKVIDSDFSA 71
           F S   C+   P  K+ L+ GLSN EIR  D    ++   ++  +     +  +      
Sbjct: 219 FNSVPNCITFHPKDKNQLVVGLSNSEIRHYDLRLSENHGEVQKYDHHQGSILALKYFPDG 278

Query: 72  GHLVSSASIDAVKVFDIRTNSCIATIQN--ESNSPFLSLDSRHGLLACGTELQGIDAAVH 129
             L+SS+    V++++ R N  I  I    + + P++ ++ + G   C    Q +D  ++
Sbjct: 279 KKLISSSEDKTVRIWENRINIPIKQISGTAQHSMPWIDINPQ-GQSFC---TQSMDNTIY 334

Query: 130 IYD-IRKWDTPLRSLIDSHHDDVTCIKFHPS-DVNILLSGSTDGYTNIYD 177
            Y  + K+          H+     I F  S D   + SG + G T I+D
Sbjct: 335 TYSMLPKYKRHPNKTFKGHNTTGYGIHFAFSPDGQYIASGDSKGQTFIWD 384

 Score = 30.8 bits (68), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 41/185 (22%), Positives = 67/185 (36%), Gaps = 56/185 (30%)

Query: 9   SNFFGSENWC--LKLQPSYKHGLLTGLSNGEIRLLDWATCKSL-QNIKASETAINDLKVI 65
           + ++G +N    L+  P   H LL+G ++  I+L D+   + L +  +     I DL   
Sbjct: 129 AEYYGHKNGTTSLRFIPKTGHLLLSGGNDNIIKLWDFYHERELLRTYEGHSMTIKDLNFT 188

Query: 66  DSDFSAGHLVSSASIDA-VKVFDIRTNSCIATIQNESNSPFLSLDSRHGLLACGTELQGI 124
           D+    GH  +SAS D  VK+++                               TE   I
Sbjct: 189 DN----GHSFASASFDKWVKIWN-------------------------------TEKGII 213

Query: 125 DAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQDEEE 184
           D  +    +                   CI FHP D N L+ G ++     YDL+  E  
Sbjct: 214 DKRLRFNSV-----------------PNCITFHPKDKNQLVVGLSNSEIRHYDLRLSENH 256

Query: 185 DALHQ 189
             + +
Sbjct: 257 GEVQK 261

>KLLA0F19734g Chr6 (1826828..1830229) [3402 bp, 1133 aa] {ON}
           similar to uniprot|Q03897 Saccharomyces cerevisiae
           YDR128W Hypothetical ORF
          Length = 1133

 Score = 38.1 bits (87), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 33/57 (57%), Gaps = 1/57 (1%)

Query: 128 VHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQDEEE 184
           V+++D+RK  +PL S+++ H   V  I F+P +   ++S   DG    +D  + E+E
Sbjct: 182 VYVWDVRKGTSPL-SVLEGHSGSVNSIDFNPFNETEIMSSGNDGTVKFWDYNKVEDE 237

>KLLA0F17237g Chr6 (1577197..1578768) [1572 bp, 523 aa] {ON} highly
           similar to uniprot|Q04225 Saccharomyces cerevisiae
           YMR131C RRB1 essential nuclear protein involved in early
           steps of ribosome biogenesis
          Length = 523

 Score = 37.7 bits (86), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 44/182 (24%), Positives = 86/182 (47%), Gaps = 21/182 (11%)

Query: 23  PSYKHG-LLTGLSNGEIRLLDWATCKSLQNIKASETAINDLKVIDSDFSAGH--LVSSAS 79
           P  K G +L+G  +G++ L    T K + + K + T  N+  + D  +S     + +S  
Sbjct: 295 PIIKTGAMLSGDCSGQVFLTQRHTSKWITD-KQAFTVANNKSIEDLQWSRTESTVFASCG 353

Query: 80  IDA-VKVFDIRTNS---CIATIQNESNSPFLSLDSRHG-LLACGTELQGIDAAVHIYDIR 134
           ID  ++++D R+      I+   + ++   +S   + G LLA G +    D    ++D+R
Sbjct: 354 IDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSEKIGYLLASGDD----DGTWGVWDLR 409

Query: 135 KWDTPLRSLIDS-------HHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQDEEEDAL 187
           ++ TP  +   S       H   +T I F+P D +I+   S D    ++DL  + +++ +
Sbjct: 410 QF-TPQNASTASPVAQYQFHKGAITSISFNPLDESIIAVASEDNTVTLWDLSVEADDEEI 468

Query: 188 HQ 189
            Q
Sbjct: 469 KQ 470

 Score = 30.8 bits (68), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 40/77 (51%), Gaps = 7/77 (9%)

Query: 247 YVVDIYPGLIATGK--TQENAGELRLIPFKNEKIYTEK-CFVIPHAHGDEVVRDIFISAH 303
           Y  D  P +I TG   + + +G++ L      K  T+K  F + +   ++ + D+  S  
Sbjct: 289 YANDWSP-IIKTGAMLSGDCSGQVFLTQRHTSKWITDKQAFTVAN---NKSIEDLQWSRT 344

Query: 304 QSDMLYSCGEDGYVKIW 320
           +S +  SCG DGY++IW
Sbjct: 345 ESTVFASCGIDGYIRIW 361

>TDEL0G03340 Chr7 (618276..619820) [1545 bp, 514 aa] {ON} Anc_2.401
           YMR131C
          Length = 514

 Score = 37.7 bits (86), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 48/195 (24%), Positives = 87/195 (44%), Gaps = 21/195 (10%)

Query: 10  NFFGSENWCLKLQPSYKHG-LLTGLSNGEIRLLDWATCKSLQNIKASETAINDLKVIDSD 68
           N    E + L   P  K G LLTG  +G++ L    T K + + K   T  N+  + D  
Sbjct: 273 NHGNVEGYGLDWSPLIKTGALLTGDCSGQVYLTQRHTSKWVTD-KQPFTFSNNKSIEDIQ 331

Query: 69  FSAGH---LVSSASIDAVKVFDIRTNS---CIATIQNESNSPFLSLDSRHG-LLACGTEL 121
           +S        +S     ++++D R+      I+T  + ++   +S + + G LLA G + 
Sbjct: 332 WSRTESTVFATSGCDGYIRIWDTRSKKHKPAISTRASATDVNVISWNEKIGYLLASGDD- 390

Query: 122 QGIDAAVHIYDIRKWDTPLRS-------LIDSHHDDVTCIKFHPSDVNILLSGSTDGYTN 174
              D    ++D+R+  +P  S         D H   +T I F+P D +I+   S D    
Sbjct: 391 ---DGRWGVWDLRQL-SPNNSENVQPVAQYDFHKGAITSISFNPLDESIIAVASEDNTVT 446

Query: 175 IYDLKQDEEEDALHQ 189
           ++DL  + +++ + Q
Sbjct: 447 LWDLSVEADDEEIKQ 461

>SAKL0F15972g Chr6 (1291625..1293037) [1413 bp, 470 aa] {ON} similar
           to uniprot|P20053 Saccharomyces cerevisiae YPR178W PRP4
           Splicing factor component of the U4/U6-U5 snRNP complex
          Length = 470

 Score = 37.4 bits (85), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 35/155 (22%), Positives = 75/155 (48%), Gaps = 11/155 (7%)

Query: 28  GLLTGLSNGEIRLLDWATCKSLQNIKASETAINDLKVIDSDF-SAGHLVSSASIDAV-KV 85
            L+TG +NGEIR+  W      ++   + T  ++ +V    F  +G  V+SAS D   ++
Sbjct: 239 ALVTGAANGEIRI--WNLNNDSESPAGTLTG-HENRVARVRFHPSGKYVASASFDMTWRL 295

Query: 86  FDIRTNSCIATIQNESNSPFLSLDSRHGLLACGTELQGIDAAVHIYDIRKWDTPLRSLID 145
           +D+     +   +  +   +     + G L C T   G+D+   ++D+R   + +   ++
Sbjct: 296 WDVEKQIELQLQEGHAKEVYCVAFQKDGSLLCST---GLDSVGLVWDLRSGKSIM--ALE 350

Query: 146 SHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQ 180
            H   +  + + P+  +I  +GS DG   ++D+++
Sbjct: 351 GHIKPIYGLDWSPNGYDI-ATGSADGTIRLWDVRK 384

 Score = 37.0 bits (84), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 31/108 (28%), Positives = 56/108 (51%), Gaps = 10/108 (9%)

Query: 72  GHLVSSASIDAVK-VFDIRTNSCIATIQNESNSPFLSLD-SRHGL-LACGTELQGIDAAV 128
           G L+ S  +D+V  V+D+R+   I  ++     P   LD S +G  +A G+     D  +
Sbjct: 323 GSLLCSTGLDSVGLVWDLRSGKSIMALEGHIK-PIYGLDWSPNGYDIATGS----ADGTI 377

Query: 129 HIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIY 176
            ++D+RK    +   + +H+  V+ +KF  ++ + L+S S D   NIY
Sbjct: 378 RLWDVRK--VGILGALPAHNSIVSEVKFDKANGHYLVSSSYDKTLNIY 423

>NCAS0A09610 Chr1 complement(1920171..1922258) [2088 bp, 695 aa]
           {ON} Anc_1.247
          Length = 695

 Score = 37.4 bits (85), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 35/135 (25%), Positives = 61/135 (45%), Gaps = 28/135 (20%)

Query: 73  HLVSSASIDAVKVFDIRTNSCIATIQ-----------NESNSPFLSLDSRHGLLACGTEL 121
           +L+S +    ++ +DI +  C+ TI              ++SPFL+      ++     L
Sbjct: 489 NLISGSQDRTIRQWDIPSGKCLQTIDLSFVAIASPPIQVTDSPFLTTTKATAIIGA---L 545

Query: 122 QGIDAA---------VHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGY 172
           Q  DAA         V ++D+R     +R+L + H   +TC+KF   D   +++GS D  
Sbjct: 546 QCFDAALATGTRDGIVRLWDLRAGKV-VRAL-EGHSGSITCLKF---DNKNIVTGSIDKT 600

Query: 173 TNIYDLKQDEEEDAL 187
             I+DL+     D L
Sbjct: 601 VRIWDLRSGILSDML 615

>KLTH0F19294g Chr6 complement(1560167..1561522) [1356 bp, 451 aa]
           {ON} similar to uniprot|P42841 Saccharomyces cerevisiae
           YNL317W PFS2 Integral subunit of the pre-mRNA cleavage
           and polyadenylation factor (CPF) complex plays an
           essential role in mRNA 3'-end formation by bridging
           different processing factors and thereby promoting the
           assembly of the processing complex
          Length = 451

 Score = 37.4 bits (85), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 32/134 (23%), Positives = 60/134 (44%), Gaps = 20/134 (14%)

Query: 61  DLKVIDSDFSAGHLVSSASIDAVKVFDIRTNSCIATIQNESNSPFLSLDSRHGLLAC--- 117
           D++  D   + G + S +  + +K++D R+  CI+TI          L  +H +++    
Sbjct: 211 DVRSCDWHPTMGLIASGSKDNLIKLWDPRSGQCISTI----------LGCKHTIISTKFQ 260

Query: 118 ---GTELQGI--DAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGY 172
              G  L  I  D +  ++DIR+    L    D    D   + +HP + +I   G  DG 
Sbjct: 261 PTKGNMLAVISKDKSCRVFDIRQNMKELAVYRD--ESDYMSLTWHPINESIFTVGCYDGS 318

Query: 173 TNIYDLKQDEEEDA 186
              +DL Q+ ++ +
Sbjct: 319 MKHFDLMQEPQDSS 332

>YLL011W Chr12 (127523..128992) [1470 bp, 489 aa] {ON}
           SOF1Essential protein required for biogenesis of 40S
           (small) ribosomal subunit; has similarity to the beta
           subunit of trimeric G-proteins and the splicing factor
           Prp4p
          Length = 489

 Score = 37.4 bits (85), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 43/191 (22%), Positives = 85/191 (44%), Gaps = 29/191 (15%)

Query: 29  LLTGLSNGEIRLLDWATCKSLQNIKASETAINDLKVIDSDF--------SAGHLVSSASI 80
           L TG ++G I+  + +T +   + KA    +  L V    F        S   ++S +  
Sbjct: 83  LATGSADGVIKYWNMSTREEFVSFKAHYGLVTGLCVTQPRFHDKKPDLKSQNFMLSCSDD 142

Query: 81  DAVKVFDIRTNSCIATIQNESNSPFLSLDSRHGLLAC---GTELQGID------------ 125
             VK++ I     +    N+++S   S+ +  GL+      +  QGID            
Sbjct: 143 KTVKLWSI----NVDDYSNKNSSDNDSVTNEEGLIRTFDGESAFQGIDSHRENSTFATGG 198

Query: 126 AAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQDEEED 185
           A +H++D+ +   P+ S +    D++T +KF+ ++ +IL S  +D    +YDL+ +    
Sbjct: 199 AKIHLWDVNRL-KPV-SDLSWGADNITSLKFNQNETDILASTGSDNSIVLYDLRTNSPTQ 256

Query: 186 ALHQVINYASI 196
            + Q +   +I
Sbjct: 257 KIVQTMRTNAI 267

>ADR242C Chr4 complement(1126441..1128006) [1566 bp, 521 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR131C
           (RRB1)
          Length = 521

 Score = 37.4 bits (85), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 46/213 (21%), Positives = 98/213 (46%), Gaps = 22/213 (10%)

Query: 10  NFFGSENWCLKLQPSYKHG-LLTGLSNGEIRLLDWATCKSLQNIKASETAINDLKVIDSD 68
           N    E + L   P  K G LLTG  +G + L    + K + + K   T  N+  + D  
Sbjct: 281 NHGNVEGYGLDWSPLIKTGALLTGDCSGRVFLTQRTSSKWITD-KQPFTVDNNKSIEDIK 339

Query: 69  FSAGH--LVSSASIDA-VKVFDIRTNS---CIATIQNESNSPFLSLDSRHG-LLACGTEL 121
           +S     + ++  +D  V+++DIR+      ++   ++++   +S + +   LLA G + 
Sbjct: 340 WSPSENTVFATCGVDGHVRIWDIRSKKHKPALSVKVSDTDVNVMSWNQKISYLLATGDD- 398

Query: 122 QGIDAAVHIYDIRKWD------TPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNI 175
              +    ++D+R++       +P+ +  D H   +T I F+P D +I+   S D    +
Sbjct: 399 ---NGTWGVWDLRQFSNQQGGVSPV-AQYDFHKGAITSISFNPLDESIIAVASEDNTVTL 454

Query: 176 YDLKQDEEEDALHQVINYASIHSCGWLSPKRIY 208
           +DL  + +++ + Q    A +     + P+ ++
Sbjct: 455 WDLSVEADDEEIKQ--QAAEVKELQQIPPQLLF 485

 Score = 32.0 bits (71), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 25/110 (22%), Positives = 49/110 (44%), Gaps = 6/110 (5%)

Query: 96  TIQNESNSPFLSLDSRHGLLACGTELQGIDAAVHIYDIR----KWDTPLRSLIDSHHDDV 151
           TI+N  N     LD    L+  G  L G D +  ++  +    KW T  +     ++  +
Sbjct: 278 TIKNHGNVEGYGLD-WSPLIKTGALLTG-DCSGRVFLTQRTSSKWITDKQPFTVDNNKSI 335

Query: 152 TCIKFHPSDVNILLSGSTDGYTNIYDLKQDEEEDALHQVINYASIHSCGW 201
             IK+ PS+  +  +   DG+  I+D++  + + AL   ++   ++   W
Sbjct: 336 EDIKWSPSENTVFATCGVDGHVRIWDIRSKKHKPALSVKVSDTDVNVMSW 385

>KLLA0E20967g Chr5 (1872227..1876192) [3966 bp, 1321 aa] {ON}
           similar to uniprot|Q92271 Saccharomyces cerevisiae
           YOL138C Hypothetical ORF
          Length = 1321

 Score = 37.4 bits (85), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 31/60 (51%), Gaps = 3/60 (5%)

Query: 123 GIDAAVHIYDIRKW---DTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLK 179
           G   +V IYDI K    D P+ + +  H   +  + F+    ++L+SG  DG   I+DL+
Sbjct: 197 GTSTSVAIYDINKTSAIDNPVVTSLSEHTRSINSVDFNMVQTSLLISGGQDGCIKIWDLR 256

>TPHA0B01120 Chr2 (254017..256176) [2160 bp, 719 aa] {ON} Anc_1.247
           YKR036C
          Length = 719

 Score = 37.4 bits (85), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 47/191 (24%), Positives = 82/191 (42%), Gaps = 41/191 (21%)

Query: 18  CLKLQPSYKHGLLTGLSNGEIRLLDWATCKSL---QN----------IKASETAINDLKV 64
           C++  P Y   L+TG  +  I+L +      L   +N          I    + +++L  
Sbjct: 451 CMQSSPHYSM-LITGSKDATIKLWNLKLASQLYLEENADIGNSNQSCIHTFSSHLDELTA 509

Query: 65  IDSDFSAGHLVSSASIDAVKVFDIRTNSCIATIQ----NESNSPFLS------------L 108
           I  D    +LVS +    ++ +D+ +  C+ TI        N+ F S            +
Sbjct: 510 ISYD--TINLVSGSQDKTIRQWDLLSGKCVQTIDLSFIKSRNNDFYSNQLLGEKPLVGAI 567

Query: 109 DSRHGLLACGTELQGIDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGS 168
                 LA GT+    D  V ++D+R    P+R+L + H D VT +KF  S +   ++ S
Sbjct: 568 QCFDAALATGTK----DGIVRLWDLRSG-VPVRTL-EGHTDAVTALKFDSSSI---VTAS 618

Query: 169 TDGYTNIYDLK 179
           +D    I+DL+
Sbjct: 619 SDKQVRIWDLR 629

>AGR180W Chr7 (1090641..1093061) [2421 bp, 806 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR222C (UTP13)
          Length = 806

 Score = 37.4 bits (85), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 51/230 (22%), Positives = 91/230 (39%), Gaps = 26/230 (11%)

Query: 18  CLKLQPSYKHGLLTGLSNGEIRLLDWATCKSLQNIKASETAINDLKVIDSDFSAGHLVSS 77
            L+L P  ++ L     N  +R  D  T ++ +++K S  A     V+D D S+  L   
Sbjct: 65  ALRLTPDGRY-LCYASQNQLLRFYDLETKRTTRSMKISSPAY----VLDCDESSTLLAVG 119

Query: 78  ASIDAVKVFDIRTNSCIATIQN-----ESNSPFLSLDSRHGLLACGTELQGIDAAVHIYD 132
            +  +V VFDI       +++       S   +  +DS   LLA G +  G+        
Sbjct: 120 GTDGSVNVFDIANGYVTHSLKGHGATISSVKFYGEVDSGMWLLASG-DTNGM-------- 170

Query: 133 IRKWDTPLRSLIDSHHDDVTC-----IKFHPSDVNILLSGSTDGYTNIYDLKQDEEEDAL 187
           ++ WD   R  I +  +         I+      ++LLSG  D   +++     ++   L
Sbjct: 171 VKIWDLVKRRCIHTVQEHTAAVRGLDIRVQEGAESLLLSGGRDDVVHVHHFDMKKKCKLL 230

Query: 188 HQVINYASIHSCGWL--SPKRIYTLSHMETFAIHELNDKSDELREPQPLD 235
             +     I SCG++  +   IYT      + I  L       +  QP++
Sbjct: 231 QTIPVKRQIESCGFIGDNTSLIYTAGGDAVYQIISLESGKSIKQTAQPVE 280

>CAGL0A00561g Chr1 complement(63710..64948) [1239 bp, 412 aa] {ON}
           similar to uniprot|P53196 Saccharomyces cerevisiae
           YGL004c
          Length = 412

 Score = 37.0 bits (84), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 34/52 (65%), Gaps = 3/52 (5%)

Query: 128 VHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLK 179
           +++YD  +W + L SL+ +H  DVT +K  PS+  +LLSGSTD    ++ L+
Sbjct: 123 INVYD-HEWMSKL-SLVGAHVSDVTTVKIFPSNA-VLLSGSTDMQLKVWSLE 171

>Ecym_8090 Chr8 (194643..196793) [2151 bp, 716 aa] {ON} similar to
           Ashbya gossypii AEL314W
          Length = 716

 Score = 37.4 bits (85), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 37/139 (26%), Positives = 59/139 (42%), Gaps = 29/139 (20%)

Query: 69  FSAGHLVSSASIDAVKVFDIRTNSCI-------------------ATIQNESNSPFL-SL 108
           F   HLVS +    ++ +D+    C+                   +TI N    P + +L
Sbjct: 515 FDDDHLVSGSQDRTIRQWDLNNGKCVQTLDISFASGGNLSRSIYSSTILNPDEPPIIGAL 574

Query: 109 DSRHGLLACGTELQGIDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGS 168
                 LA GT+    D  V ++D+R     +R+L D H D +T ++F   D   L++GS
Sbjct: 575 QCYDAALATGTK----DGVVRLWDLRSGRV-VRTL-DGHSDAITSLEF---DSLHLVTGS 625

Query: 169 TDGYTNIYDLKQDEEEDAL 187
            D    I+DL+     DA 
Sbjct: 626 LDKSIRIWDLRTGALADAF 644

 Score = 34.3 bits (77), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 56/110 (50%), Gaps = 17/110 (15%)

Query: 74  LVSSASIDAVKVFDIRTNSCIATIQNESNS-PFLSLDSRHGLLACGTELQGIDAAVHIYD 132
           L +      V+++D+R+   + T+   S++   L  DS H  L  G+    +D ++ I+D
Sbjct: 581 LATGTKDGVVRLWDLRSGRVVRTLDGHSDAITSLEFDSLH--LVTGS----LDKSIRIWD 634

Query: 133 IRKWDTPLRSLIDSHHDD--VTCIKFHPSDVNILLSGSTDGYTNIYDLKQ 180
           +R       +L D+   D  VT ++F   D+N +++ + +G   IYD K+
Sbjct: 635 LRTG-----ALADAFAYDHSVTSLQF---DLNKIVAANREGTVKIYDRKE 676

 Score = 33.9 bits (76), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 36/68 (52%), Gaps = 5/68 (7%)

Query: 25  YKHGLLTGLSNGEIRLLDWATCKSLQNIKASETAINDLKVIDSDFSAGHLVSSASIDAVK 84
           Y   L TG  +G +RL D  + + ++ +     AI  L     +F + HLV+ +   +++
Sbjct: 577 YDAALATGTKDGVVRLWDLRSGRVVRTLDGHSDAITSL-----EFDSLHLVTGSLDKSIR 631

Query: 85  VFDIRTNS 92
           ++D+RT +
Sbjct: 632 IWDLRTGA 639

>ZYRO0G02618g Chr7 (201987..204629) [2643 bp, 880 aa] {ON} similar
           to uniprot|Q03177 Saccharomyces cerevisiae YMR102C
           Protein of unknown function transcription is activated
           by paralogous transcription factors Yrm1p and Yrr1p
           along with genes involved in multidrug resistance
          Length = 880

 Score = 37.4 bits (85), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 45/87 (51%), Gaps = 8/87 (9%)

Query: 97  IQNESNSPFLSLD-SRHGLLACGTELQGIDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIK 155
           I  E  S  L LD S++G L   +    +D AV ++ + + +  L++ +  H D VTCIK
Sbjct: 284 IYREHGSSVLDLDWSQNGFLVSAS----MDKAVKLWHVER-EQSLKTFL--HPDFVTCIK 336

Query: 156 FHPSDVNILLSGSTDGYTNIYDLKQDE 182
           F+P D    +SG  D    ++ +  DE
Sbjct: 337 FYPLDDRFFVSGCLDHKCRMWSILDDE 363

>Kpol_1018.103 s1018 complement(268887..269966) [1080 bp, 359 aa]
           {ON} complement(268887..269966) [1080 nt, 360 aa]
          Length = 359

 Score = 36.6 bits (83), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 41/148 (27%), Positives = 68/148 (45%), Gaps = 18/148 (12%)

Query: 44  ATCKSLQN----IKASETAINDLKVI-DSDFSAGHLVSSASID-AVKVFDIRTNSCIATI 97
           AT K ++N      A+E +I+D+     SDF    L S +S D  V+++DI+        
Sbjct: 18  ATTKDMENDIVVNNAAEDSISDIAFSPQSDF----LFSVSSWDNKVRIWDIQGGVAQGRA 73

Query: 98  QNESNSPFLSLDSRHGLLACGTELQGIDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKF- 156
           Q E   P L   +R  L        G D  V++YD+   ++     I +H   +  ++F 
Sbjct: 74  QFEHAKPVLC--TRWSLDGSKVASGGCDNIVNMYDV---NSGQSQQIGTHSSAIKSLRFV 128

Query: 157 --HPSDVNILLSGSTDGYTNIYDLKQDE 182
              PS+   L++GS D     +DL+Q +
Sbjct: 129 QCGPSNQECLVTGSWDKTIKYWDLRQPQ 156

>SAKL0A00660g Chr1 (71855..73837) [1983 bp, 660 aa] {ON} some
           similarities with uniprot|P18323 Saccharomyces
           cerevisiae YCR084C
          Length = 660

 Score = 37.0 bits (84), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 38/157 (24%), Positives = 71/157 (45%), Gaps = 16/157 (10%)

Query: 29  LLTGLSNGEIRLLDWATCKSLQNIKASETAINDLKVIDSDFSAGHLVSSASIDAVKVFDI 88
           L TG  +  IR+ D +T + +  ++  E    D+  +D   S   LVS +    V+++D+
Sbjct: 393 LATGAEDKLIRIWDLSTKRIVMTLQGHE---QDIYSLDYFPSGDKLVSGSGDRTVRIWDL 449

Query: 89  RTNSCIATIQNESNSPFLSLDSRHG-LLACGTELQGIDAAVHIYD------IRKWDTPLR 141
           RT  C  T+  E     +++    G  +A G+    +D  + ++D      + + D+   
Sbjct: 450 RTGQCSLTLSIEDGVTTVAVSPGEGKFIAAGS----LDRTLRVWDSETGFLVERLDSE-N 504

Query: 142 SLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDL 178
            L   H D V  + F   D   ++SGS D    +++L
Sbjct: 505 ELGTGHKDSVYSVVFT-RDGQGVVSGSLDRSVKLWNL 540

>Suva_16.510 Chr16 (874866..876263) [1398 bp, 465 aa] {ON} YPR178W
           (REAL)
          Length = 465

 Score = 37.0 bits (84), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 38/163 (23%), Positives = 74/163 (45%), Gaps = 22/163 (13%)

Query: 36  GEIRLLDWATCKSLQNIKASETAINDLKVIDSDFSAGHLVSSASIDAV-KVFDIRTNSCI 94
           G++RLL         ++   E  ++DLK       +G  + SAS D   +++D  T   +
Sbjct: 253 GDLRLLG--------SLVGHERRVSDLKY----HPSGKFIGSASHDMTWRLWDASTYQEL 300

Query: 95  ATIQNESNSPF-LSLDSRHGLLACGTELQGIDAAVHIYDIRKWDTPLRSLIDSHHDDVTC 153
              +  +   F LS      L+  G    G+D+   I+DIR  +  +   +  H   V  
Sbjct: 301 LLQEGHAKGVFCLSFQCDGSLVCSG----GMDSLAMIWDIRSGNKVMS--LTGHSKPVYT 354

Query: 154 IKFHPSDVNILLSGSTDGYTNIYDLKQDEEEDALHQVINYASI 196
           + + P+   +  +G  DG  N++D++Q  +   +HQ++ + +I
Sbjct: 355 VDWSPNGYQVA-TGGGDGLINVWDIRQ-RDGGQVHQILAHRNI 395

>TBLA0B04680 Chr2 complement(1095348..1099997) [4650 bp, 1549 aa] {ON}
            Anc_5.49 YHR186C
          Length = 1549

 Score = 37.4 bits (85), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 78/176 (44%), Gaps = 12/176 (6%)

Query: 25   YKHGLLTGLSNGEIRLLDWAT---CKSLQNIKASETAINDLKVIDSDFSAGHLVSSASID 81
            +++ L+T      I + DW +   C    N     T I  L++I+ D +A  L++ +S  
Sbjct: 1195 FENYLITADERDNITVFDWESSQICSKFSNGNPYGTKITSLQLINEDDNA-LLLTGSSNG 1253

Query: 82   AVKVFDIRTNSCIATIQN--ESNSPFLSLDSRHGLLACGTELQG-IDAAVHIYDIRKWDT 138
             VKVF    +S    + N   + +  L      GLL    +++G + A   +  IR WD 
Sbjct: 1254 IVKVFKNMHDSEDVEVINSWRALTDMLLTPRSSGLLLEWQQMKGYLLATGDVKVIRIWDA 1313

Query: 139  PLRSL-IDSHHDDVTCIKFHPSDV---NILLSGSTDGYTNIYDLKQDEEEDALHQV 190
               S+ +D      + I    SD    NI + G TDG   +YD + D   DA+ +V
Sbjct: 1314 HTESMEVDIPAKTSSLITSITSDQLSGNIFVCGFTDGSLRVYDRRVD-VRDAMVRV 1368

>Kwal_47.17827 s47 complement(570622..572193) [1572 bp, 523 aa] {ON}
           YMR131C (RRB1) - RiboSome Assembly 2 [contig 204] FULL
          Length = 523

 Score = 37.0 bits (84), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 43/189 (22%), Positives = 85/189 (44%), Gaps = 19/189 (10%)

Query: 15  ENWCLKLQPSYKHG-LLTGLSNGEIRLLDWATCKSLQNIKASETAINDLKVIDSDFSAGH 73
           E + L   P  K G LLTG  +G + L    T K + + K + +A N+  + D  FS   
Sbjct: 287 EGYALDWSPLNKSGSLLTGDCSGRVYLTQRHTSKWITD-KTAFSAGNNQSIEDIQFSRTE 345

Query: 74  LVSSASIDA---VKVFDIRTNS---CIATIQNESNSPFLSLDSRHG-LLACGTELQGIDA 126
               A+      ++++D R+      I+   + ++   +S + + G LLA G +    + 
Sbjct: 346 ATVFATCGCDGYIRIWDTRSKKHKPAISVKASSTDVNVISWNEKIGYLLASGDD----NG 401

Query: 127 AVHIYDIRKWDTPLRSLIDS------HHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQ 180
              ++D+R++     + +        H   +T I F+P D +I+   S D    ++DL  
Sbjct: 402 TWGVWDLRQFSPNNAASVSPVAQYSFHKGAITSIAFNPLDDSIIAVASEDNTVTLWDLSV 461

Query: 181 DEEEDALHQ 189
           + +++ + Q
Sbjct: 462 EADDEEIKQ 470

 Score = 31.6 bits (70), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 37/78 (47%), Gaps = 9/78 (11%)

Query: 247 YVVDIYP----GLIATGKTQENAGELRLIPFKNEKIYTEKCFVIPHAHGDEVVRDIFISA 302
           Y +D  P    G + TG   + +G + L      K  T+K      A  ++ + DI  S 
Sbjct: 289 YALDWSPLNKSGSLLTG---DCSGRVYLTQRHTSKWITDKTAF--SAGNNQSIEDIQFSR 343

Query: 303 HQSDMLYSCGEDGYVKIW 320
            ++ +  +CG DGY++IW
Sbjct: 344 TEATVFATCGCDGYIRIW 361

>CAGL0K03861g Chr11 complement(360277..361818) [1542 bp, 513 aa]
           {ON} highly similar to uniprot|Q04225 Saccharomyces
           cerevisiae YMR131c Ribosome assembly protein
          Length = 513

 Score = 37.0 bits (84), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 44/193 (22%), Positives = 89/193 (46%), Gaps = 17/193 (8%)

Query: 10  NFFGSENWCLKLQPSYKHG-LLTGLSNGEIRLLDWATCKSLQNIKASETAIN-DLKVIDS 67
           N    E + L   P  K G LL+G  +G+I L    T K + + +A     N  ++ I  
Sbjct: 272 NHGNVEGYGLDWSPLIKSGALLSGDCSGQIYLTQRHTSKWVTDKQAYSVGNNKSIEDIQW 331

Query: 68  DFSAGHLVSSASIDA-VKVFDIRTNS---CIATIQNESNSPFLSLDSRHG-LLACGTELQ 122
             +   + ++A  D  ++V+D R+      I+   + ++   +S + + G LLA G +  
Sbjct: 332 SKTESTVFATAGCDGYIRVWDTRSKKHKPAISVKASNTDVNVISWNEKIGYLLASGDD-- 389

Query: 123 GIDAAVHIYDIRKWDTPLRSLIDS------HHDDVTCIKFHPSDVNILLSGSTDGYTNIY 176
             + +  ++D+R++     + I        H   +T I F+P + +I+  GS D    ++
Sbjct: 390 --NGSWGVWDLRQFTPDNAANIQPVAQYNFHKGAITSIAFNPLEESIVAVGSEDNTVTLW 447

Query: 177 DLKQDEEEDALHQ 189
           DL  + +++ + Q
Sbjct: 448 DLSVEADDEEIKQ 460

>Smik_14.14 Chr14 (25114..26514) [1401 bp, 466 aa] {ON} YNL317W
           (REAL)
          Length = 466

 Score = 37.0 bits (84), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 38/142 (26%), Positives = 62/142 (43%), Gaps = 22/142 (15%)

Query: 61  DLKVIDSDFSAGHLVSSASIDAVKVFDIRTNSCIATIQNESNSPFLSLDSRHGLLAC--- 117
           D+K  D     G + S++  + VK++D R+ +CI++I          L  +H +L     
Sbjct: 221 DVKSCDWHPEMGLIASASKDNLVKLWDPRSGNCISSI----------LKFKHTVLKTRFQ 270

Query: 118 ---GTELQGI--DAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGY 172
              G  L  I  D +  ++DIR     L  + D    D   +++HP + ++      DG 
Sbjct: 271 PVKGNLLMAISKDKSCRVFDIRYSMKELMCVRDE--TDYMTLEWHPINESMFTLACYDGS 328

Query: 173 TNIYDLKQDEEEDALHQVINYA 194
              +DL QD  E  L   I YA
Sbjct: 329 LKHFDLLQDLNEPVL--TIPYA 348

>YBR103W Chr2 (447709..449316) [1608 bp, 535 aa] {ON}  SIF2WD40
           repeat-containing subunit of the Set3C histone
           deacetylase complex, which represses early/middle
           sporulation genes; antagonizes telomeric silencing;
           binds specifically to the Sir4p N-terminus
          Length = 535

 Score = 37.0 bits (84), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 39/194 (20%), Positives = 89/194 (45%), Gaps = 20/194 (10%)

Query: 29  LLTGLSNGEIRLLDWATCKSLQNIKASETAINDLKVIDSDFSAGHLVSSASIDAVKVFDI 88
           ++TG+ NGE+RL  W    +L N+     A   +  +  +    H++S    +   ++++
Sbjct: 235 IVTGVENGELRL--WNKTGALLNVLNFHRA--PIVSVKWNKDGTHIISMDVENVTILWNV 290

Query: 89  RTNSCIATIQ-NESNSPFLSLDSRHGLLACGTELQGID----------AAVHIYDIRKWD 137
            + + +   +  E+    ++ ++  G  + G +++ +D           A+ +Y I +  
Sbjct: 291 ISGTVMQHFELKETGGSSINAENHSGDGSLGVDVEWVDDDKFVIPGPKGAIFVYQITE-K 349

Query: 138 TPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQDEEEDALHQVINYASIH 197
           TP   LI  HH  ++ ++F+ ++  +LLS S DG   I+       ++  +   +  SI 
Sbjct: 350 TPTGKLI-GHHGPISVLEFNDTN-KLLLSASDDGTLRIWHGGNGNSQNCFYG--HSQSIV 405

Query: 198 SCGWLSPKRIYTLS 211
           S  W+   ++ + S
Sbjct: 406 SASWVGDDKVISCS 419

>ZYRO0D17292g Chr4 complement(1424965..1427121) [2157 bp, 718 aa]
           {ON} some similarities with uniprot|P16649 Saccharomyces
           cerevisiae YCR084C
          Length = 718

 Score = 37.0 bits (84), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 41/161 (25%), Positives = 73/161 (45%), Gaps = 16/161 (9%)

Query: 29  LLTGLSNGEIRLLDWATCKSLQNIKASETAINDLKVIDSDFSAGHLVSSASIDAVKVFDI 88
           L TG  +  IR+ D A  K +  ++  E    D+  +D   S   LVS +    V+++D+
Sbjct: 451 LATGAEDRLIRIWDIAQKKIVMVLQGHE---QDIYSLDYFPSGDKLVSGSGDRTVRIWDL 507

Query: 89  RTNSCIATIQNESNSPFLSLDSRHG-LLACGTELQGIDAAVHIYD------IRKWDTPLR 141
           RT  C  T+  E     +++    G  +A G+    +D AV ++D      + + D+   
Sbjct: 508 RTGQCSLTLSIEDGVTTVAVSLGDGKYIAAGS----LDRAVRVWDAETGFLVERLDSE-N 562

Query: 142 SLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQDE 182
            L   H D V  + F   D + ++SGS D    +++L   +
Sbjct: 563 ELGTGHKDSVYSVVFT-RDGHGVVSGSLDRSVKLWNLSSGQ 602

>Kwal_55.22067 s55 complement(1094600..1095955) [1356 bp, 451 aa]
           {ON} YNL317W (PFS2) - Polyadenylation Factor I subunit
           [contig 124] FULL
          Length = 451

 Score = 36.6 bits (83), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 33/134 (24%), Positives = 59/134 (44%), Gaps = 20/134 (14%)

Query: 61  DLKVIDSDFSAGHLVSSASIDAVKVFDIRTNSCIATIQNESNSPFLSLDSRHGLLAC--- 117
           D++  D   + G + S +  + VK++D R   CI+TI          L  +H +++    
Sbjct: 211 DVRSCDWHPTMGLIASGSKDNLVKLWDPRAGQCISTI----------LGCKHTIISTKFQ 260

Query: 118 ---GTELQGI--DAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGY 172
              G  L  I  D +  I+DIR+    L    D    D   + +HP + ++   G  DG 
Sbjct: 261 PTKGNMLAVISKDKSCRIFDIRQNMKELAVYRD--ESDYMSLTWHPINESMFTVGCYDGS 318

Query: 173 TNIYDLKQDEEEDA 186
              +DL Q+ ++ +
Sbjct: 319 MKHFDLLQEPQDSS 332

>Kpol_1041.35 s1041 complement(87507..89612) [2106 bp, 701 aa] {ON}
           complement(87507..89612) [2106 nt, 702 aa]
          Length = 701

 Score = 36.6 bits (83), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 40/81 (49%), Gaps = 9/81 (11%)

Query: 106 LSLDSRHGLLACGTELQGIDAAVHIYDIRKWDTP----LRSLIDSHHDDVTCIKFHPSDV 161
           +S++  +GLLA G E    D+ V  +D R         L + IDS    VT   F    +
Sbjct: 189 VSINQVNGLLAVGLE----DSVVEFWDPRARSRVSKLYLENQIDSSSFQVTATSFRNDGL 244

Query: 162 NILLSGSTDGYTNIYDLKQDE 182
           N    G+++GYT +YDL+  E
Sbjct: 245 N-FACGTSNGYTYLYDLRTSE 264

>CAGL0B01529g Chr2 (137174..138283) [1110 bp, 369 aa] {ON} highly
           similar to uniprot|P39108 Saccharomyces cerevisiae
           YDR142c PAS7 peroxisomal import protein -peroxin
          Length = 369

 Score = 36.6 bits (83), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 45/96 (46%), Gaps = 7/96 (7%)

Query: 240 RKAWDCDYVVDIYPGLIATGKTQENAG--ELRLIP-FKNEKIYTEKCFV--IPHAHGDEV 294
           + A  CD+     P +IAT     + G  ++R++P   N++ +     V  I +AH D  
Sbjct: 222 KGALSCDFN-KYRPNIIATSGVDNSIGIWDIRMLPNSSNQQGFQTGTLVNEIVNAH-DLA 279

Query: 295 VRDIFISAHQSDMLYSCGEDGYVKIWKSTQGPLNTP 330
           V+ +  S H SD+L S   D   KIWK      N P
Sbjct: 280 VKKVCWSPHHSDILLSTSYDMSCKIWKDVSVQNNVP 315

>Skud_12.56 Chr12 (118914..120383) [1470 bp, 489 aa] {ON} YLL011W
           (REAL)
          Length = 489

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 45/191 (23%), Positives = 86/191 (45%), Gaps = 29/191 (15%)

Query: 29  LLTGLSNGEIRLLDWATCKSLQNIKASETAINDLKVID-------SDFSAGHLVSSASID 81
           L TG ++G I+  + +T +   + KA    I  L V         SD+   + + S S D
Sbjct: 83  LATGSADGVIKYWNMSTREEFVSFKAHYGLITGLCVTQPHFHDKKSDWKNQNFMLSCSDD 142

Query: 82  -AVKVFDIRTNSCIATIQNESNSPFLSLDSRHGLLAC---GTELQGID------------ 125
             VK++ I     +    N+ +S   S+ +  GL+      +  QGID            
Sbjct: 143 KTVKLWSIN----VDDYSNKRSSDNDSVTNEEGLVRTFDGESAFQGIDSHRENSTFATGG 198

Query: 126 AAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQDEEED 185
           A +H++D+ +   P+ +L     D++T ++F+ ++ +IL S  +D    +YDL+ +    
Sbjct: 199 AKIHLWDVNRL-KPISNL-SWGADNITSVRFNQNETDILASTGSDNSIVLYDLRTNSPTQ 256

Query: 186 ALHQVINYASI 196
            + Q +   +I
Sbjct: 257 KIVQTMRTNAI 267

>ACR097W Chr3 (529784..531187) [1404 bp, 467 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR212W (STE4)
          Length = 467

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 53/97 (54%), Gaps = 11/97 (11%)

Query: 123 GIDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQDE 182
           G D  ++I+D ++  T ++S   S   DV+ +KF   + N + +GS DG TN+YDL+ D 
Sbjct: 281 GSDGYLYIWD-KRVPTSVQSFFVSD-SDVSKVKFF-RNGNTIATGSDDGCTNLYDLRSD- 336

Query: 183 EEDALHQVINYASIHSCGWLSP--KRIYTLSHMETFA 217
                 ++ NY+   S    +P  ++ Y +S+M+  A
Sbjct: 337 -----CRIANYSLSRSIHGATPVQQQTYIMSNMDYTA 368

>KAFR0A03380 Chr1 (690272..692272) [2001 bp, 666 aa] {ON} Anc_1.247
           YKR036C
          Length = 666

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 29/128 (22%), Positives = 64/128 (50%), Gaps = 12/128 (9%)

Query: 60  NDLKVIDSDFSAGHLVSSASID-AVKVFDIRTNSCIATIQ-NESNSPFLSLDSRHGLLAC 117
           +++  +D DF  G L ++  +D  +K++D+  ++ I  ++ +++    L +D  + ++  
Sbjct: 366 DNITTLDFDFPNGTLSTAGHLDHTIKLWDLTKSTQIGELKGHKATVNSLQMDLTYNMVIS 425

Query: 118 G-----TELQGIDAAVHIYDIRKWDTPLRSLIDSHHDDVTCI-KFHPSDVNILLSGSTDG 171
                  +L  +D  +  ++  ++  P     DSH D++T I  +H +    L+SGS D 
Sbjct: 426 AGKDATVKLWNVDLGIESFNTERYFNPCIYTFDSHTDEITAISSYHEN----LVSGSRDK 481

Query: 172 YTNIYDLK 179
               +DLK
Sbjct: 482 TIRQWDLK 489

 Score = 32.3 bits (72), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 57/123 (46%), Gaps = 25/123 (20%)

Query: 73  HLVSSASIDAVKVFDIRTNSCIATI-------QNE---------SNSPFLSLDSRHGLLA 116
           +LVS +    ++ +D++T  CI  +       Q E         S  P  +L  R   LA
Sbjct: 473 NLVSGSRDKTIRQWDLKTGKCIQILNIGFLNSQKELLGTVDPIRSPPPIGALQCRDAALA 532

Query: 117 CGTELQGIDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIY 176
            G    G D  V ++D+R     +RSL   H + +T +KF   D+++ ++GS D     +
Sbjct: 533 TG----GQDGIVRLWDLR-IGKVVRSL-SGHENAITALKF--DDLHV-VTGSLDKTAITW 583

Query: 177 DLK 179
           DL+
Sbjct: 584 DLR 586

>KNAG0I01050 Chr9 complement(200338..203817) [3480 bp, 1159 aa] {ON}
           Anc_8.288 YDR128W
          Length = 1159

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 1/56 (1%)

Query: 128 VHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQDEE 183
           V I+D+R   TPL  L   H+  V  I F   + N ++S S DG    +DL ++E+
Sbjct: 183 VFIWDLRHGSTPLHKLT-GHNSGVNSIDFSRFEENKIMSSSNDGTVKFWDLSKEEK 237

>Suva_14.22 Chr14 (36853..38262) [1410 bp, 469 aa] {ON} YNL317W
           (REAL)
          Length = 469

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 38/142 (26%), Positives = 62/142 (43%), Gaps = 22/142 (15%)

Query: 61  DLKVIDSDFSAGHLVSSASIDAVKVFDIRTNSCIATIQNESNSPFLSLDSRHGLLAC--- 117
           D+K  D     G + S++  + VK++D R+ +CI++I          L  +H +L     
Sbjct: 223 DVKSCDWHPEMGLIASASKDNLVKLWDPRSGNCISSI----------LKFKHTVLKTRFQ 272

Query: 118 ---GTELQGI--DAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGY 172
              G  L  I  D +  ++DIR     L  + D    D   +++HP + ++      DG 
Sbjct: 273 PTKGNLLMAISKDKSCRVFDIRYSMKELMCVRD--ETDYMTLEWHPINESMFTLACYDGS 330

Query: 173 TNIYDLKQDEEEDALHQVINYA 194
              +DL QD  E  L   I YA
Sbjct: 331 LKHFDLLQDLNEPIL--TIPYA 350

>ZYRO0D06556g Chr4 complement(564778..568221) [3444 bp, 1147 aa]
           {ON} similar to uniprot|Q03897 Saccharomyces cerevisiae
           YDR128W Hypothetical ORF
          Length = 1147

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 34/131 (25%), Positives = 58/131 (44%), Gaps = 28/131 (21%)

Query: 64  VIDSDFSAGH--LVSSASIDA-VKVFDIRTNSCIATIQNESNSPFLSLDSRHGLLACGTE 120
           + D +FS  H  ++++ SID  V  +D+R             SP     +  G L+  ++
Sbjct: 117 ITDINFSPQHPDILATCSIDTYVHAWDLR-------------SPQRPFYTTSGWLSGASQ 163

Query: 121 L------QGIDAAVH-----IYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGST 169
           +      Q + A+ H     I+D+RK  TPL  L+  H   V  + F+      L++GS 
Sbjct: 164 VKWSFNDQNVLASAHGNDVCIWDLRKGSTPLGKLV-GHGSSVNSVDFNRFKRTELMTGSN 222

Query: 170 DGYTNIYDLKQ 180
           DG    +D  +
Sbjct: 223 DGSVKFWDYSK 233

>KNAG0C03490 Chr3 (684848..685936) [1089 bp, 362 aa] {ON} Anc_7.405
           YER107C
          Length = 362

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 29/146 (19%), Positives = 61/146 (41%), Gaps = 17/146 (11%)

Query: 74  LVSSASIDA-VKVFDIRTNSCIATIQNESNSPFLSLDSRHGLLACGTELQGIDAAVHIYD 132
           + S +S D  V+++D+++ +     Q E  +P LS  +R           G D A+ I+D
Sbjct: 48  MFSVSSWDGKVRIWDVQSGTAQGRSQYEHAAPVLS--TRWSNDGTKVASGGCDNAIKIFD 105

Query: 133 IRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQDEEEDALHQVIN 192
           +    +    L D+    V  +   P++  +L++GS D     +D +Q +    +     
Sbjct: 106 VATGQSQQLGLHDAPVKAVRFVNCGPTNTEMLVTGSWDKSIKYWDFRQPQPVSTV----- 160

Query: 193 YASIHSCGWLSPKRIYTLSHMETFAI 218
                    + P R+Y + + +   +
Sbjct: 161 ---------IMPDRVYAMDNKQQLLV 177

>KAFR0A06990 Chr1 complement(1405904..1408543,1408655..1408672)
           [2658 bp, 885 aa] {ON} Anc_6.239 YGL137W
          Length = 885

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 33/156 (21%), Positives = 70/156 (44%), Gaps = 15/156 (9%)

Query: 29  LLTGLSNGEIRLLDWATCKSLQNIKASETAINDLKVIDSDFSAGHLVSSASIDAVKVFDI 88
           +LT L +G I + ++ T   +++I+ +ET +   K I        ++  +    ++VF+ 
Sbjct: 28  VLTTLYSGRIEIWNYETQHEVRSIQVTETPVRAGKFIAR---KNWIIVGSDDFRIRVFNY 84

Query: 89  RTNSCIATIQNESNSPFLSLDSRHG---LLACGTELQGIDAAVHIYDIRK-WDTPLRSLI 144
            T   +  +  E++  ++   + H     +  G++    D  + +++  K W+  L    
Sbjct: 85  NTGEKV--VDFEAHPDYIRSIAVHPTKPYVLSGSD----DLTIKLWNWEKNWN--LEQTF 136

Query: 145 DSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQ 180
           + H   V C+ F+P D N   SG  D    ++ L Q
Sbjct: 137 EGHEHFVMCVAFNPKDPNTFASGCLDRTVKVWSLGQ 172

 Score = 35.4 bits (80), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 38/173 (21%), Positives = 77/173 (44%), Gaps = 14/173 (8%)

Query: 7   VESNFFGSENW--CLKLQPSYKHGLLTGLSNGEIRLLDWATCKSLQNIKASETAINDLKV 64
           +E  F G E++  C+   P   +   +G  +  +++  W+  +S  N   +      +  
Sbjct: 132 LEQTFEGHEHFVMCVAFNPKDPNTFASGCLDRTVKV--WSLGQSTPNFTMNTGQERGVNY 189

Query: 65  ID--SDFSAGHLVSSASIDAVKVFDIRTNSCIATIQNE-SNSPFLSLDSRHGLLACGTEL 121
           +D        +LV+S+    VK++D +T SC+AT++   SN  F        ++  G+E 
Sbjct: 190 VDYYPLPDKPYLVTSSDDLTVKIWDYQTKSCVATLEGHMSNVSFAVFHPTLPIIISGSE- 248

Query: 122 QGIDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDV-NILLSGSTDGYT 173
              D  + I++   +   +   ++   +   CI  HP+   N + SG  +G+T
Sbjct: 249 ---DGTLKIWNSSTY--KVEKTLNLGLERSWCIATHPTGRKNYIASGFDNGFT 296

>AEL314W Chr5 (52978..55125) [2148 bp, 715 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YJL112W (MDV1) and YKR036C
           (CAF4)
          Length = 715

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 35/132 (26%), Positives = 62/132 (46%), Gaps = 30/132 (22%)

Query: 69  FSAGHLVSSASIDAVKVFDIRTNSCIATI-----------QNESNSPFLSLDSRHGL--- 114
           F A +LVS +    ++ +D+    C+ T+           ++   S FL+ ++ H +   
Sbjct: 513 FEANNLVSGSQDRTIRQWDLNNGKCVQTLDINFATGGNLSRSMIGSGFLNTNNDHPIIGA 572

Query: 115 -------LACGTELQGIDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSG 167
                  LA GT+    D  V ++D+R     +R+L + H D VT ++F   D   L++G
Sbjct: 573 IQCYDAALATGTK----DGIVRLWDLRSGRV-VRTL-EGHSDAVTSLQF---DSLNLVTG 623

Query: 168 STDGYTNIYDLK 179
           S D    I+DL+
Sbjct: 624 SLDNSIRIWDLR 635

>SAKL0A03872g Chr1 (361507..361524,361720..364338) [2637 bp, 878 aa]
           {ON} similar to uniprot|P41811 Saccharomyces cerevisiae
           YGL137W SEC27 Involved in beta'-subunit of yeast
           coatomer
          Length = 878

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 29/120 (24%), Positives = 59/120 (49%), Gaps = 9/120 (7%)

Query: 73  HLVSSASIDAVKVFDIRTNSCIATIQNE-SNSPFLSLDSRHGLLACGTELQGIDAAVHIY 131
           +L++S+   +VK++D +T SC+AT++   +N  +        ++  G+E    D  V I+
Sbjct: 200 YLITSSDDRSVKIWDYQTKSCVATLEGHMANVSYAIFHPSLPIIISGSE----DGTVKIW 255

Query: 132 DIRKWDTPLRSLIDSHHDDVTCIKFHPS-DVNILLSGSTDGYTNIYDLKQDEEEDALHQV 190
           +   +   L   ++   +   C+  HP+   N + SG  +G+ N+  +  DE   +L  V
Sbjct: 256 NANTY--KLEKTLNLGLERSWCVAAHPTGKRNYVASGFDNGF-NVLSMGNDEPRLSLDPV 312

>CAGL0K09284g Chr11 (915766..918501) [2736 bp, 911 aa] {ON} highly
           similar to uniprot|P25635 Saccharomyces cerevisiae
           YCR057c PWP2 periodic tryptophan protein
          Length = 911

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 43/216 (19%), Positives = 81/216 (37%), Gaps = 55/216 (25%)

Query: 3   SYSLVESNFFGSENWCLKLQPSYKHG--LLTGLSNGEIRLLDWATCKSLQNIKASETAIN 60
           S+ + + NFF +    +K    + +   L+ G SNGE RL +      +Q +   +  +N
Sbjct: 243 SWRITKKNFFYANQAKVKCCTFHINSNLLIVGFSNGEFRLYEMPEFVMVQQLSMGQNPVN 302

Query: 61  DLKVIDSD----FSA---------------------GH---------------LVSSASI 80
            + V +S     F +                     GH               +V++A  
Sbjct: 303 TVSVNNSGEWLAFGSSKLGQLLVYEWQSESYILKQQGHFDATNSLTYSPDGSRVVTAAED 362

Query: 81  DAVKVFDIRTNSCIATIQNESNSPFLSLDSRHGLLACGTELQGIDAAVHIYDIRKWD--- 137
             +KV+D+ +  C+AT +  +++      ++ G +     L G         +R WD   
Sbjct: 363 GKIKVWDVASGFCLATFEEHTSAVTAVQFAKKGQVLFSASLDGT--------VRAWDLIR 414

Query: 138 -TPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGY 172
               R    +     TC+   PS   ++ +GSTD +
Sbjct: 415 YRNFRVFTATERVQFTCLAVEPSG-EVVSAGSTDSF 449

>CAGL0K03377g Chr11 complement(307358..310294) [2937 bp, 978 aa]
           {ON} similar to uniprot|Q03177 Saccharomyces cerevisiae
           YMR102c
          Length = 978

 Score = 36.6 bits (83), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 25/44 (56%), Gaps = 1/44 (2%)

Query: 140 LRSLIDSHHDD-VTCIKFHPSDVNILLSGSTDGYTNIYDLKQDE 182
           +RSL    H D VTC+KFHP+D    +SG  D    ++ +  DE
Sbjct: 443 MRSLKSFQHPDFVTCVKFHPTDDRFFISGCLDQKCRLWSILDDE 486

>Skud_14.22 Chr14 (34087..35490) [1404 bp, 467 aa] {ON} YNL317W
           (REAL)
          Length = 467

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 38/142 (26%), Positives = 62/142 (43%), Gaps = 22/142 (15%)

Query: 61  DLKVIDSDFSAGHLVSSASIDAVKVFDIRTNSCIATIQNESNSPFLSLDSRHGLLAC--- 117
           D+K  D     G + S++  + VK++D R+ +CI++I          L  +H +L     
Sbjct: 221 DVKSCDWHPEMGLIASASKDNLVKLWDPRSGNCISSI----------LKFKHTVLKTRFQ 270

Query: 118 ---GTELQGI--DAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGY 172
              G  L  I  D +  ++DIR     L  + D    D   +++HP + ++      DG 
Sbjct: 271 PTKGNLLMAISKDKSCRVFDIRYSMRELMCVRDE--TDYMTLEWHPINESMFTLACYDGS 328

Query: 173 TNIYDLKQDEEEDALHQVINYA 194
              +DL QD  E  L   I YA
Sbjct: 329 LKHFDLLQDLNEPIL--TIPYA 348

>Kwal_56.24399 s56 (981153..982262) [1110 bp, 369 aa] {ON} [contig
           163] FULL
          Length = 369

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 59/139 (42%), Gaps = 22/139 (15%)

Query: 30  LTGLSNGEIRLLDWATCKSLQNIKASETAINDLKVIDSDFSAGHLVSSASIDAVKVFDIR 89
           +TG S+  + L+D  T + L+N       +N ++ +++D       S +   A+K++D  
Sbjct: 135 VTGSSDTRLALVDLHTGRKLRNFAGHTRVVNQVRALNTD----RFASVSDDGALKIWDAH 190

Query: 90  TNSCIATIQNESNSPFLSLDSRHGLLACGT-ELQGIDAAVHIYDIRK--------WDTPL 140
           T S +  I +E   P  +L S             G+D  +  YD+R+        W TP 
Sbjct: 191 TKSPVWQISSE--FPLFTLTSSSSSSDDNILYTSGLDPVIRAYDLRQNNGQELFNWSTP- 247

Query: 141 RSLIDSHHDDVTCIKFHPS 159
                 H D VT I  + S
Sbjct: 248 ------HTDSVTSIHINAS 260

>TBLA0D04870 Chr4 complement(1194448..1195431) [984 bp, 327 aa] {ON}
           Anc_1.399 YNL006W
          Length = 327

 Score = 35.8 bits (81), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 54/108 (50%), Gaps = 9/108 (8%)

Query: 74  LVSSASIDAVKVFDIRTNSCIATIQN-ESNSPFLSLDSRHGLLACGTELQGIDAAVHIYD 132
           LVS+     ++ ++  T  C  TIQ+ ES    L + S   LLA        + +V +YD
Sbjct: 5   LVSAGYDHTIRFWEALTGVCSRTIQHPESQVNRLEISSDKTLLAAAA-----NQSVRLYD 59

Query: 133 IRKWD-TPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLK 179
           ++  + TPL + +D H  +VT + F   +   + + S DG   ++D++
Sbjct: 60  LQSANPTPL-ACLDGHGGNVTAVAFQ-RERQWIATASEDGAVRVWDVR 105

>TPHA0A00380 Chr1 complement(55881..59813) [3933 bp, 1310 aa] {ON}
           Anc_3.22 YOL138C
          Length = 1310

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 37/84 (44%), Gaps = 7/84 (8%)

Query: 126 AAVHIYDIRKWDTPLRSLIDS---HHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQDE 182
             + IYDI K +   ++LI S   H   V    F+  D N+L+SG  DG   I+DL+   
Sbjct: 203 TVISIYDINKAEKLDKTLITSYSEHTRAVNSFDFNMVDSNLLISGGQDGCIKIWDLRTGS 262

Query: 183 EEDALHQVINYA----SIHSCGWL 202
              +    IN      SI    W+
Sbjct: 263 LNGSTRSDININTASDSIRDVKWM 286

>TPHA0L02130 Chr12 complement(441224..445750) [4527 bp, 1508 aa] {ON}
            Anc_5.49 YHR186C
          Length = 1508

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 39/161 (24%), Positives = 68/161 (42%), Gaps = 26/161 (16%)

Query: 70   SAGHLVSSASIDAVKVFDIRTNSCIATIQNESNSPFLSLDSRHGLLACGTELQGI-DAAV 128
            S G L+ +  +  ++V+D  + S    I  +++S   S+ S    LA  T + G  D ++
Sbjct: 1274 SKGSLLVTGDVKVIRVWDAHSESIEVDIPVKTSSLVTSITSDQ--LAGDTVVCGFSDGSI 1331

Query: 129  HIYD---------IRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLK 179
             +YD         +R W    RS     H  +  +         L SG+TDG   ++D++
Sbjct: 1332 RVYDRRLNSRDAMVRLW----RSNEGKKHYPINYVHLQRGGFRELASGTTDGTVELWDIR 1387

Query: 180  QDEEEDALHQVINYASIHSCGWLSPKRIYTLSHMETFAIHE 220
              +        I   +I S    S  RI T++ M+   +HE
Sbjct: 1388 NQDP-------ITSFNIGSSNQSSESRISTMTKMQ---LHE 1418

>YJL112W Chr10 (205305..207449) [2145 bp, 714 aa] {ON}
           MDV1Peripheral protein of the cytosolic face of the
           mitochondrial outer membrane, required for mitochondrial
           fission; interacts with Fis1p and with the
           dynamin-related GTPase Dnm1p; contains WD repeats
          Length = 714

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 54/129 (41%), Gaps = 32/129 (24%)

Query: 74  LVSSASIDAVKVFDIRTNSCIATI-----------------------QNESNSPFLSLDS 110
           LVS +    ++ +D+R+  C+ TI                       Q        +L S
Sbjct: 515 LVSGSQDRTIRQWDLRSGKCLQTIDLSFANVLTTSTNVDLSKSTLLTQRNERPSIGALQS 574

Query: 111 RHGLLACGTELQGIDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTD 170
               LA GT+    D  V ++D+R     +R+L   H D +T +KF   D   L++GS D
Sbjct: 575 FDAALATGTK----DGVVRLWDLRSGKV-IRTL-KGHTDAITSLKF---DSACLVTGSYD 625

Query: 171 GYTNIYDLK 179
               I+DL+
Sbjct: 626 RTVRIWDLR 634

 Score = 31.6 bits (70), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 32/137 (23%), Positives = 59/137 (43%), Gaps = 26/137 (18%)

Query: 62  LKVIDSDFSAGHLVSSASID-AVKVFDIRTNSCIATIQNE-SNSPFLSLDSRHGLLACGT 119
           L  +D D   G L ++  +D  VK++D+   + I  +    +    + ++  +G L  G 
Sbjct: 401 LTCLDFDAPFGTLCTAGYLDHTVKIWDLSKQNKIGELAGHLATINCMQINRDYGTLVTG- 459

Query: 120 ELQGIDAAVHIYDIR-----------------KWDTPLRSLIDSHHDDVTCIKFHPSDVN 162
              G DAA+ ++++                    D+P     ++H D+VT +   PS   
Sbjct: 460 ---GRDAALKLWNLNLAQQLYQETQNLTSPTNHIDSPCVHTFEAHTDEVTALSLDPS--- 513

Query: 163 ILLSGSTDGYTNIYDLK 179
            L+SGS D     +DL+
Sbjct: 514 FLVSGSQDRTIRQWDLR 530

>Skud_7.561 Chr7 (920014..921196,921300..921898) [1782 bp, 593 aa]
           {ON} YGR225W (REAL)
          Length = 593

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 31/62 (50%), Gaps = 4/62 (6%)

Query: 106 LSLDSRHGLLACGTELQGIDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILL 165
           +SL+   GLLA G    G D +  ++DI   D P++  +  H   V  I F P   ++L 
Sbjct: 396 ISLNEHSGLLAVG----GNDNSCSLWDISNLDKPVKKFVLPHKAAVKAIAFCPWSKSLLA 451

Query: 166 SG 167
           +G
Sbjct: 452 TG 453

>Kpol_2001.65 s2001 (178299..181919) [3621 bp, 1206 aa] {ON}
           (178299..181919) [3621 nt, 1207 aa]
          Length = 1206

 Score = 36.2 bits (82), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 39/159 (24%), Positives = 70/159 (44%), Gaps = 15/159 (9%)

Query: 29  LLTGLSNGEIRLLDWATCKSLQNIKASETAINDLKVIDSDFSAGHLVSSASIDAVKVFDI 88
           +L  L +  I+L D+     L   +  E  +   + ID   +    VS+     +KV+ +
Sbjct: 26  VLVALFSSTIQLWDYRMGTLLHRYEDHEGPV---RGIDFHPTQPLFVSAGDDYTIKVWSL 82

Query: 89  RTNSCIATIQNESNSPFLSLDSRHGLLACGTELQGIDAAVHIYDIRKWDTPLR---SLID 145
            TN C+ T+          LD    +     EL  I +A     IR W+   R   + I 
Sbjct: 83  ETNKCLYTLDGH-------LDYVRTVF-FHKELPWIISASDDQTIRIWNWQNRKEIACIT 134

Query: 146 SHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQDEEE 184
            H+  V C +FHP++ ++++S S D    ++D+ +  E+
Sbjct: 135 GHNHFVMCAQFHPTE-DLIVSASLDETVRVWDISKLREK 172

>TPHA0C01150 Chr3 (263944..266007) [2064 bp, 687 aa] {ON} Anc_7.231
           YIL046W
          Length = 687

 Score = 36.2 bits (82), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 42/173 (24%), Positives = 74/173 (42%), Gaps = 19/173 (10%)

Query: 11  FFGSENWCLKLQPSYKHGLLTGLSNGEIRLLDWATCKSLQNIKASETAINDLKVIDSDFS 70
           F G  +  L LQ +++  L TG  +  +   D  T K ++    S   +  L      F 
Sbjct: 336 FKGHMDSVLTLQFTHRL-LFTGSYDSTVAAWDLYTGKLIRRFVGSFDGVKTLH-----FD 389

Query: 71  AGHLVSSASIDAVKVFDIRTNSCIATIQNESNSPFLSLDSRHGLLACGTELQGIDAAVHI 130
              LV+ +    +KV++  T  CI+T +  ++S  +S+DS   ++  G+     D  V +
Sbjct: 390 GQKLVTGSLDKTIKVWNYLTGECISTYRGHTDS-VMSVDSFKKIIVSGSA----DKTVKV 444

Query: 131 YDIRKWDTPLRSL--IDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQD 181
                W    RS   +  H + V  +K HP     L S S D    ++D++ +
Sbjct: 445 -----WHVESRSCYTLRGHTEWVNSVKLHPKSF-CLFSCSDDTTIRMWDIRTN 491

>TDEL0A07550 Chr1 complement(1314676..1316223) [1548 bp, 515 aa]
           {ON} Anc_6.340 YCR072C
          Length = 515

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 37/161 (22%), Positives = 69/161 (42%), Gaps = 16/161 (9%)

Query: 70  SAGHLVSSASIDAVKVFDIRTNSCIATIQNESNSPFLSLDSRHG-LLACGTELQGIDAAV 128
           ++  +V+ A  +  +V+D  T + +AT+    N       S  G  +A G+    +D  V
Sbjct: 155 TSSRMVTGAGDNTARVWDCDTQTPMATLSGHQNWVLCVAWSPDGETIATGS----MDCTV 210

Query: 129 HIYDIRKWDTPLRSLIDSHHDDVTCIKFH------PSDVNILLSGSTDGYTNIYDLKQDE 182
            ++D  K   PL   +  H   +T + +       P D   L S S DG   I+D  +  
Sbjct: 211 RLWD-SKAGQPLGDALKGHQKWITSLVWEPLHLVKPGDKPRLASASKDGTIKIWDTSR-- 267

Query: 183 EEDALHQVINYASIHSC-GWLSPKRIYTLSHMETFAIHELN 222
               ++ +  + +  SC  W     +Y+ SH +T  + ++N
Sbjct: 268 -RVCIYTLSGHTNSVSCVKWGGQGLLYSGSHDKTVRVWDMN 307

>TPHA0D03830 Chr4 complement(802754..805492) [2739 bp, 912 aa] {ON}
           Anc_6.325 YCR057C
          Length = 912

 Score = 36.2 bits (82), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 42/216 (19%), Positives = 80/216 (37%), Gaps = 55/216 (25%)

Query: 3   SYSLVESNFFGSENWCLKLQPSYKHG--LLTGLSNGEIRLLDWATCKSLQNIKASETAIN 60
           S+ + E NFF   +  +K    +     L+ G SNGE RL +  +   LQ +   +  +N
Sbjct: 238 SWRISEKNFFFQNHATVKCVTFHAKSNMLIVGFSNGEFRLYELPSFALLQQLSMGQNPVN 297

Query: 61  DLKVIDSD----FSA---------------------GH---------------LVSSASI 80
            + V ++     F +                     GH               +V+S+  
Sbjct: 298 TVSVNETGEWLAFGSSSLGQLLVYEWQSESYILKQQGHFDALNDLTYSPDGSRVVTSSED 357

Query: 81  DAVKVFDIRTNSCIATIQNESNSPFLSLDSRHGLLACGTELQGIDAAVHIYDIRKWD--- 137
             +K++D+ +  C+AT +  ++S      ++ G +     L G         +R WD   
Sbjct: 358 GKIKIWDVVSGFCLATFEEHTSSVTAVQFAKRGQVLFSASLDGT--------VRAWDLIR 409

Query: 138 -TPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGY 172
               R+   +      C+   PS   ++ +GS D +
Sbjct: 410 YRNFRTFTSTDRIQFNCLAVDPSG-EVVCAGSLDNF 444

>TPHA0L01080 Chr12 (226790..229297) [2508 bp, 835 aa] {ON} Anc_8.435
           YLR222C
          Length = 835

 Score = 36.2 bits (82), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 52/111 (46%), Gaps = 9/111 (8%)

Query: 71  AGHLVSSASIDAVKVFDIRTNSCIATIQNESNSPFLSLDSRHGLLACGTELQGIDAAVHI 130
           A +L   +    +K+F + T   + +++  S S  L  D    LLA G    G D +V +
Sbjct: 85  AQYLCYVSQAQLLKIFKLSTGKIVKSMKISSPSYVLETDPTSTLLAIG----GTDGSVTV 140

Query: 131 YDIRKWDTPLRSLIDSHHDDVTCIKFHP---SDVNILLSGSTDGYTNIYDL 178
            DI   +  +   +  H   ++ +KF+    ++  +L SG T+G   I+DL
Sbjct: 141 IDIE--NGYITHSLKGHGATISSLKFYGEQHTNTWLLSSGDTNGMVKIWDL 189

>SAKL0H09900g Chr8 complement(847975..849252) [1278 bp, 425 aa] {ON}
           similar to uniprot|P13712 Saccharomyces cerevisiae
           YBR195C MSI1 Subunit of chromatin assembly factor I
           (CAF- I) regulates the RAS/cAMP pathway via
           sequestration of Npr1p kinase localizes to the nucleus
           and cytoplasm homologous to human retinoblastoma binding
           proteins RbAp48 and RbAp46
          Length = 425

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 28/123 (22%), Positives = 58/123 (47%), Gaps = 11/123 (8%)

Query: 71  AGHLVSSASIDAVKVFDIRTNSCIATIQNESNSPFLSLDS-----RHGLLACGTELQGID 125
           A  L      +++ V D R    + +   ++      ++S      + +L C  +  G  
Sbjct: 263 ASILACCGESNSINVIDTRAQKGVLSSTKDTKHHSRGINSSQFNYHNDMLLCSGDSTG-- 320

Query: 126 AAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSG-STDGYTNIYDLKQDEEE 184
             V+++DIR  +TPL+SL   H   ++  +++P+   IL +   +DG   ++D+ Q+  E
Sbjct: 321 -RVNLWDIRDLETPLKSL--DHGSSISKTQWNPNLSTILATADQSDGLVKLWDIAQEPGE 377

Query: 185 DAL 187
           + L
Sbjct: 378 ELL 380

>Kwal_26.7736 s26 complement(491687..493210) [1524 bp, 507 aa] {ON}
           YMR093W (UTP15) - Protein required for cell viability
           [contig 55] FULL
          Length = 507

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 44/102 (43%), Gaps = 6/102 (5%)

Query: 83  VKVFDIRTNSCIATIQNESNSPFLSLDSRHG-LLACGTELQGIDAAVHIYDIRKWDTPLR 141
           V++F  RT   I T     +  + +   + G LLA G         V +YD       L 
Sbjct: 63  VQLFSSRTRQVIKTFSRFKDVVYSASFRQDGKLLAMG----DATGRVSVYDSYNPRAQLV 118

Query: 142 SLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQDEE 183
           S+  S H      KFHP+D   L++ S D    ++D+ Q +E
Sbjct: 119 SIAASSHP-THVAKFHPADSRTLVTASDDRVVRVWDITQAQE 159

>TPHA0D04500 Chr4 (978756..982382) [3627 bp, 1208 aa] {ON} Anc_7.322
           YDL145C
          Length = 1208

 Score = 36.2 bits (82), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 38/159 (23%), Positives = 71/159 (44%), Gaps = 15/159 (9%)

Query: 29  LLTGLSNGEIRLLDWATCKSLQNIKASETAINDLKVIDSDFSAGHLVSSASIDAVKVFDI 88
           +L  L +  I+L D+     L   +  +  +   + ID   +    VS+     +KV+ +
Sbjct: 26  VLVALFSSTIQLWDYRMGTLLHRFEDHDGPV---RGIDFHPTQPLFVSAGDDYTIKVWSL 82

Query: 89  RTNSCIATIQNESNSPFLSLDSRHGLLACGTELQGIDAAVHIYDIRKWDTPLR---SLID 145
            TN C+ T++         LD    +     EL  I +A     IR W+   R   + I 
Sbjct: 83  ETNKCLYTLEGH-------LDYVRTVF-FHRELPWIISASDDQTIRIWNWQNRKEIACIT 134

Query: 146 SHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQDEEE 184
            H+  V C +FHP++ ++++S S D    ++D+ +  E+
Sbjct: 135 GHNHFVMCAQFHPTE-DLIVSASLDETVRVWDISKLREK 172

>Suva_5.228 Chr5 complement(347755..348852) [1098 bp, 365 aa] {ON}
           YER107C (REAL)
          Length = 365

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 25/136 (18%), Positives = 58/136 (42%), Gaps = 16/136 (11%)

Query: 83  VKVFDIRTNSCIATIQNESNSPFLSLDSRHGLLACGTELQGIDAAVHIYDIRKWDTPLRS 142
           V+++D++        Q ES+SP L   +R         + G D A+ +YD+    T    
Sbjct: 61  VRIWDVQNGVPQGRAQYESSSPVLC--TRWSNDGAKVAIGGCDNALKLYDVASGQTQQVG 118

Query: 143 LIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQDEEEDALHQVINYASIHSCGWL 202
           +  +    +  ++  PS+   +++GS D     +D++Q +    +              +
Sbjct: 119 MHTAPIKVLRYVQCGPSNAECIVTGSWDKTIKYWDMRQPQPVSTV--------------M 164

Query: 203 SPKRIYTLSHMETFAI 218
            P+R+Y++   ++  +
Sbjct: 165 MPERVYSMDSKQSLLV 180

>YMR131C Chr13 complement(533163..534698) [1536 bp, 511 aa] {ON}
           RRB1Essential nuclear protein involved in early steps of
           ribosome biogenesis; physically interacts with the
           ribosomal protein Rpl3p
          Length = 511

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 46/195 (23%), Positives = 89/195 (45%), Gaps = 21/195 (10%)

Query: 10  NFFGSENWCLKLQPSYKHG-LLTGLSNGEIRLLDWATCKSLQNIKASETAINDLKVIDSD 68
           N    E + L   P  K G LL+G  +G+I      T + + + K   T  N+  + D  
Sbjct: 270 NHGNVEGYGLDWSPLIKTGALLSGDCSGQIYFTQRHTSRWVTD-KQPFTVSNNKSIEDIQ 328

Query: 69  FSAGH--LVSSASIDA-VKVFDIRTNS---CIATIQNESNSPFLSLDSRHG-LLACGTEL 121
           +S     + ++A  D  ++++D R+      I+   + ++   +S   + G LLA G + 
Sbjct: 329 WSRTESTVFATAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSDKIGYLLASGDD- 387

Query: 122 QGIDAAVHIYDIRKWDTPLRS-------LIDSHHDDVTCIKFHPSDVNILLSGSTDGYTN 174
              +    ++D+R++ TP  +         D H   +T I F+P D +I+  GS D    
Sbjct: 388 ---NGTWGVWDLRQF-TPSNADAVQPVAQYDFHKGAITSIAFNPLDESIVAVGSEDNTVT 443

Query: 175 IYDLKQDEEEDALHQ 189
           ++DL  + +++ + Q
Sbjct: 444 LWDLSVEADDEEIKQ 458

>KAFR0I01880 Chr9 (386694..388469) [1776 bp, 591 aa] {ON} Anc_7.231
           YIL046W
          Length = 591

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 37/172 (21%), Positives = 75/172 (43%), Gaps = 15/172 (8%)

Query: 10  NFFGSENWCLKLQPSYKHGLLTGLSNGEIRLLDWATCKSLQNIKASETAINDLKVIDSDF 69
           +F G  +  L LQ +YK+ L TG  +  + + D      ++ +      +  L   D   
Sbjct: 247 DFKGHLDGVLSLQFNYKY-LFTGSYDSTVAIWDLYNNILIRRLNGHTDGVKALYFDDKKL 305

Query: 70  SAGHLVSSASIDAVKVFDIRTNSCIATIQNESNSPFLSLDSRHGLLACGTELQGIDAAVH 129
             G L  +     +K+++  T  CI+T +  ++S  +S+D+   ++  G+     D  V 
Sbjct: 306 ITGSLDKT-----IKIWNYVTGQCISTYRGHTDS-VMSVDAFKKIIVSGSA----DKTVK 355

Query: 130 IYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQD 181
           ++ I   ++     +  H + V C+K HP       S S D    ++D++ +
Sbjct: 356 VWHI---ESRTCYTLKGHTEWVNCVKLHPKSFT-CFSCSDDTTIRMWDIRTN 403

>Smik_2.243 Chr2 (432627..434252) [1626 bp, 541 aa] {ON} YBR103W
           (REAL)
          Length = 541

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 49/206 (23%), Positives = 94/206 (45%), Gaps = 40/206 (19%)

Query: 27  HGLLTGLSNGEIRLLDWATCKSLQN-----------IKASETAINDLKVIDSDFSAGHLV 75
           + ++TG+ NGE+RL  W    +LQN           IK S+   + + +   + +    V
Sbjct: 233 NSIVTGVENGELRL--WNKSGALQNVLNFHRAPIVSIKWSKDGTHFISMDVENVTILWNV 290

Query: 76  SSASIDAVKVFDIRTNSCIATIQNESNSPFLSLDSRHGLLACGTELQGID---------- 125
            S +I  ++ FD+R     +T  +E+N+   SL         G +++ +D          
Sbjct: 291 LSGTI--MQHFDLRETGRSST-NSENNTDRDSL---------GVDVEWVDDDKFVIPGPK 338

Query: 126 AAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQDEEED 185
            A+ +Y I +  TP+  L+  HH  ++ ++F+ S+  +LLS S DG   I+       ++
Sbjct: 339 GAIFVYQITE-KTPIGKLV-GHHGPISVLEFNNSN-KLLLSASDDGSLRIWHGGNGNSQN 395

Query: 186 ALHQVINYASIHSCGWLSPKRIYTLS 211
             +   +  SI S  W+   ++ + S
Sbjct: 396 CFYG--HSQSIVSASWVGDDKVISCS 419

>ABL024W Chr2 (353682..355886) [2205 bp, 734 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR102C and YKL121W
          Length = 734

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 32/64 (50%), Gaps = 3/64 (4%)

Query: 124 IDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQDEE 183
           +D  V ++ I +  T L++ +  H D VTC++FHP D     SG  D     + + + E 
Sbjct: 233 MDKTVKLWHINR-TTSLKTFV--HPDFVTCVRFHPHDDRFFFSGCLDHTVRTWSILEGEV 289

Query: 184 EDAL 187
            +A 
Sbjct: 290 AEAF 293

>YDL139C Chr4 complement(211375..212046) [672 bp, 223 aa] {ON}
           SCM3Nonhistone component of centromeric chromatin that
           binds stoichiometrically to CenH3-H4 histones, required
           for kinetochore assembly; required for G2/M progression
           and localization of Cse4p; may protect Cse4p from
           ubiquitylation
          Length = 223

 Score = 35.0 bits (79), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 36/70 (51%), Gaps = 2/70 (2%)

Query: 228 LREPQPLDFGDVRKAWDCDYVVDIYPGLIATGKTQENAGELRLIPFKNEKIY--TEKCFV 285
           L+E        +RK  DC+ V  +YP  I   KT+++ G  R I  +N  +Y  +++  +
Sbjct: 24  LKESGKKSESKIRKHSDCNPVHRVYPPNIEKRKTKKDDGISRPIAERNGHVYIMSKENHI 83

Query: 286 IPHAHGDEVV 295
           IP    DEV+
Sbjct: 84  IPKLTDDEVM 93

>Skud_5.232 Chr5 complement(369506..370603) [1098 bp, 365 aa] {ON}
           YER107C (REAL)
          Length = 365

 Score = 35.4 bits (80), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 28/139 (20%), Positives = 58/139 (41%), Gaps = 22/139 (15%)

Query: 83  VKVFDIRTNSCIATIQNESNSPFLSLDSRHGLLACGTELQGIDAAVHIYDIRKWDTPLRS 142
           V+++D++        Q ES+SP L   +R           G D A+ +YD+    T    
Sbjct: 61  VRIWDVQNGVPQGRAQYESSSPVLC--TRWSSDGTKVASGGCDNALKLYDVASGQT---Q 115

Query: 143 LIDSHHDDVTCIKF---HPSDVNILLSGSTDGYTNIYDLKQDEEEDALHQVINYASIHSC 199
            I  H   +  +++    PS+   +++GS D     +D++Q +    L            
Sbjct: 116 QIGMHSAPIKVLRYVQCGPSNAECVVTGSWDKTIKYWDMRQPQPVSTL------------ 163

Query: 200 GWLSPKRIYTLSHMETFAI 218
             + P+R+Y++   ++  +
Sbjct: 164 --MMPERVYSMDSKQSLLV 180

>Ecym_4255 Chr4 (529455..532268) [2814 bp, 937 aa] {ON} similar to
           Ashbya gossypii AGL196C
          Length = 937

 Score = 35.8 bits (81), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 61/124 (49%), Gaps = 25/124 (20%)

Query: 70  SAGHLVSSASIDAVKVFDIRTNSCIATIQNESNSPFLSLDSRH---------------GL 114
           S G +++S S++ +  +DI+T + + T+ +  + P  S+D+++                L
Sbjct: 34  SPGQIITS-SLENINCWDIKTGNLLKTLSD--SIPPGSIDAKYEKPAEVAYLEYHHETNL 90

Query: 115 LACGTELQGIDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTN 174
           LA G      D  + I+D++     +  + +SH   +T +KF PS    L+SGS D    
Sbjct: 91  LAAGYA----DGVIKIWDMQTQTVLI--IFNSHTAAITFLKFDPSGTR-LISGSRDSNII 143

Query: 175 IYDL 178
           I+DL
Sbjct: 144 IWDL 147

 Score = 30.8 bits (68), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 55/112 (49%), Gaps = 10/112 (8%)

Query: 73  HLVSSASIDAV-KVFDIRTNSCIATIQNESNS-PFLSLDSRHGLLACGTELQGIDAAVHI 130
           +L+++   D V K++D++T + +    + + +  FL  D     L  G+     D+ + I
Sbjct: 89  NLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSR----DSNIII 144

Query: 131 YDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQDE 182
           +D+   +  L  L  SH D +T I F   D   L+S S DG   ++D+K  +
Sbjct: 145 WDLVG-EVGLCKL-RSHKDSITGIWFENDD--WLISTSKDGLIKVWDIKSQQ 192

>Smik_13.329 Chr13 complement(515612..517141) [1530 bp, 509 aa] {ON}
           YMR131C (REAL)
          Length = 509

 Score = 35.8 bits (81), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 45/195 (23%), Positives = 89/195 (45%), Gaps = 21/195 (10%)

Query: 10  NFFGSENWCLKLQPSYKHG-LLTGLSNGEIRLLDWATCKSLQNIKASETAINDLKVIDSD 68
           N    E + L   P  K G LL+G  +G++      T + + + K   T  N+  + D  
Sbjct: 268 NHGNVEGYGLDWSPLIKTGSLLSGDCSGQVYFTQRHTSRWVTD-KQPFTVSNNKSIEDIQ 326

Query: 69  FSAGH--LVSSASIDA-VKVFDIRTNS---CIATIQNESNSPFLSLDSRHG-LLACGTEL 121
           +S     + ++A  D  ++++D R+      I+   + ++   +S   + G LLA G + 
Sbjct: 327 WSRSESTVFATAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSDKIGYLLASGDD- 385

Query: 122 QGIDAAVHIYDIRKWDTPLRS-------LIDSHHDDVTCIKFHPSDVNILLSGSTDGYTN 174
              +    ++D+R++ TP  +         D H   +T I F+P D +I+  GS D    
Sbjct: 386 ---NGTWGVWDLRQF-TPSNADSVQPVAQYDFHKGAITSIAFNPLDESIVAVGSEDNTVT 441

Query: 175 IYDLKQDEEEDALHQ 189
           ++DL  + +++ + Q
Sbjct: 442 LWDLSVEADDEEIKQ 456

>TPHA0F00520 Chr6 (121962..124103) [2142 bp, 713 aa] {ON} Anc_4.77
           YGR145W
          Length = 713

 Score = 35.8 bits (81), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 46/101 (45%), Gaps = 9/101 (8%)

Query: 86  FDIRTNSCIATIQNESNSPFLSLDSRHGLLACGTELQGIDAAVHIYDIRKWDTP----LR 141
           F +  N   AT         +S++S +GL+A G E    D+ V  +D R         L 
Sbjct: 176 FKLDINEEKATAVGGGGVNHVSINSANGLVAVGLE----DSVVEFWDPRARSRVSKLYLE 231

Query: 142 SLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQDE 182
           + ID+    VT   F    +N    G+++GY+ +YDL+  E
Sbjct: 232 NTIDNSDFTVTTTSFRNDGIN-FACGTSNGYSYLYDLRASE 271

>SAKL0A01738g Chr1 (157360..160089) [2730 bp, 909 aa] {ON} highly
           similar to uniprot|P25636 Saccharomyces cerevisiae
           YCR057C PWP2 part of small (ribosomal) subunit (SSU)
           processosome (contains U3 snoRNA) Eight WD-repeats with
           homology with G protein beta subunits flanked by
           nonhomologous N-terminal and C-terminal extensions
           regulatory protein
          Length = 909

 Score = 35.8 bits (81), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 43/184 (23%), Positives = 77/184 (41%), Gaps = 22/184 (11%)

Query: 3   SYSLVESNFFGSENW---CLKLQPSYKHGLLTGLSNGEIRLLDWATCKSLQNIKASETAI 59
           S+ + + NFF +      C    P   + L+ G SNGE RL +      +Q +   + A+
Sbjct: 244 SWRITKKNFFYTNQAKVKCAIFHPQ-SNLLIVGFSNGEFRLYELPHFALIQQLSMGQNAV 302

Query: 60  NDLKVIDSDFSAGHLVS--SASIDAVKVFDIRTNSCIATIQ---NESNSPFLSLDSRHGL 114
           N + + +S    G  ++  S+ +  + V++ ++ S I   Q   +  NS   S D    +
Sbjct: 303 NTVSINNS----GEWLAFGSSKLGQLLVYEWQSESYILKQQGHFDSMNSLTYSPDGSRVV 358

Query: 115 LACGTELQGIDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTN 174
            +        D  + I+D+        +  D H   VT ++F      +L S S DG   
Sbjct: 359 TSSD------DGKIKIWDVVS--GFCLATFDDHTSSVTAVQFAKKG-QVLFSASLDGTVK 409

Query: 175 IYDL 178
            +DL
Sbjct: 410 AWDL 413

>KAFR0I02840 Chr9 complement(570039..571409) [1371 bp, 456 aa] {ON}
           Anc_3.25 YNL317W
          Length = 456

 Score = 35.4 bits (80), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 32/129 (24%), Positives = 59/129 (45%), Gaps = 20/129 (15%)

Query: 61  DLKVIDSDFSAGHLVSSASIDAVKVFDIRTNSCIATIQNESNSPFLSLDSRHGLLAC--- 117
           D+K  D   + G + S++  + +K++D R+ +C++TI          L  +H +L     
Sbjct: 209 DVKSCDWHPTMGLIASASKDNLIKLWDPRSGNCVSTI----------LKFKHTVLKTRFQ 258

Query: 118 ---GTELQGI--DAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGY 172
              G  L  I  D +  ++DIR     L  + D    D   + +HP + ++   G+ DG 
Sbjct: 259 PTKGNLLVAISKDKSCRVFDIRHSMKELMVVRD--EVDYMTLLWHPINESVFTVGNYDGS 316

Query: 173 TNIYDLKQD 181
              +D+ QD
Sbjct: 317 LKHFDILQD 325

>Skud_4.109 Chr4 complement(190191..193796) [3606 bp, 1201 aa] {ON}
           YDL145C (REAL)
          Length = 1201

 Score = 35.8 bits (81), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 40/155 (25%), Positives = 66/155 (42%), Gaps = 19/155 (12%)

Query: 29  LLTGLSNGEIRLLDWATCKSLQNIKASETAINDLKVIDSDFSAGH--LVSSASIDAVKVF 86
           +L  L +  I+L D+     L   +  E  +  L     DF       VS+     +KV+
Sbjct: 26  VLVALFSSTIQLWDYRMGTLLHRFEDHEGPVRGL-----DFHPTQPIFVSAGDDYTIKVW 80

Query: 87  DIRTNSCIATIQNESNSPFLSLDSRHGLLACGTELQGIDAAVHIYDIRKWDTPLR---SL 143
            + TN C+ T+          LD    +     EL  I +A     IR W+   R   + 
Sbjct: 81  SLDTNKCLYTLSGH-------LDYVRTVF-FHRELPWIISASDDQTIRIWNWQNRKEIAC 132

Query: 144 IDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDL 178
           +  H+  V C +FHP+D ++++S S D    I+D+
Sbjct: 133 LTGHNHFVMCAQFHPTD-DLIVSASLDETIRIWDI 166

>NCAS0F01450 Chr6 complement(287070..289796) [2727 bp, 908 aa] {ON}
           Anc_2.450 YKL121W
          Length = 908

 Score = 35.8 bits (81), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 33/59 (55%), Gaps = 3/59 (5%)

Query: 124 IDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQDE 182
           +D  V ++ + +  T L++    H D VTC++FHP+D    +SG  D    ++ + ++E
Sbjct: 347 MDRTVKLWHLER-QTSLKTF--QHQDFVTCVRFHPTDDRFFISGCLDHKVRLWSILENE 402

>NDAI0A03310 Chr1 (750920..753373) [2454 bp, 817 aa] {ON} Anc_4.106
          Length = 817

 Score = 35.8 bits (81), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 28/49 (57%), Gaps = 2/49 (4%)

Query: 136 WDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQDEEE 184
           W TPL S+ + H   VTC+KF P D   L SGS D    I+ L +D ++
Sbjct: 67  WKTPLCSM-NRHAGSVTCVKFSP-DGKYLASGSDDRILLIWTLDEDHQQ 113

>KNAG0A03670 Chr1 complement(472849..474129) [1281 bp, 426 aa] {ON}
           Anc_8.548 YBR195C
          Length = 426

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 56/111 (50%), Gaps = 8/111 (7%)

Query: 81  DAVKVFDIRTNSCIATIQNESNSPFLS---LDSRHGLLACGTELQGIDAAVHIYDIRKWD 137
           D++ +FD R  + +A I+N+  S  ++    +  + LL   T+  G     +++D+RK  
Sbjct: 272 DSLALFDTRAQNAVAKIRNQFKSEGINACKFNWENNLLLASTDSTG---RTNLWDVRKLS 328

Query: 138 TPLRSLIDSHHDDVTCIKFHPSDVNILLS-GSTDGYTNIYDLKQDEEEDAL 187
                  D H   V+ ++++P D ++L + G +DG   I+D   + E+  +
Sbjct: 329 AEPIVHFD-HGGSVSTLEWNPHDHSVLATAGQSDGLIKIWDTSLEIEDKTI 378

>Smik_4.90 Chr4 complement(171469..175074) [3606 bp, 1201 aa] {ON}
           YDL145C (REAL)
          Length = 1201

 Score = 35.8 bits (81), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 40/155 (25%), Positives = 66/155 (42%), Gaps = 19/155 (12%)

Query: 29  LLTGLSNGEIRLLDWATCKSLQNIKASETAINDLKVIDSDFSAGH--LVSSASIDAVKVF 86
           +L  L +  I+L D+     L   +  E  +  L     DF       VS+     +KV+
Sbjct: 26  VLVALFSSTIQLWDYRMGTLLHRFEDHEGPVRGL-----DFHPTQPIFVSAGDDYTIKVW 80

Query: 87  DIRTNSCIATIQNESNSPFLSLDSRHGLLACGTELQGIDAAVHIYDIRKWDTPLR---SL 143
            + TN C+ T+          LD    +     EL  I +A     IR W+   R   + 
Sbjct: 81  SLDTNKCLYTLTGH-------LDYVRTVF-FHRELPWIISASDDQTIRIWNWQNRKEIAC 132

Query: 144 IDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDL 178
           +  H+  V C +FHP+D ++++S S D    I+D+
Sbjct: 133 LTGHNHFVMCAQFHPTD-DLIVSASLDETIRIWDI 166

>Kpol_1038.20 s1038 complement(43719..47660) [3942 bp, 1313 aa] {ON}
           complement(43719..47660) [3942 nt, 1314 aa]
          Length = 1313

 Score = 35.8 bits (81), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 29/57 (50%), Gaps = 3/57 (5%)

Query: 128 VHIYDIRK---WDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQD 181
           + IYDI K    D PL +    H   V    F+ +  ++L+SG  DG   I+DL+ +
Sbjct: 208 ISIYDINKNDNIDNPLVTSFSEHSRAVNSFDFNMTQTSLLISGGQDGQIKIWDLRSN 264

>ZYRO0G10406g Chr7 complement(839502..840677) [1176 bp, 391 aa] {ON}
           similar to uniprot|P53196 Saccharomyces cerevisiae
           YGL004C RPN14 Putative non-ATPase subunit of the 19S
           regulatory particle of the 26S proteasome localized to
           the cytoplasm
          Length = 391

 Score = 35.4 bits (80), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 24/34 (70%), Gaps = 1/34 (2%)

Query: 145 DSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDL 178
           ++H D++TC+KF PS   +LLSGSTD    I+ L
Sbjct: 121 EAHLDEITCLKFFPSG-QVLLSGSTDMRLKIWSL 153

>NCAS0F00190 Chr6 complement(29012..30247) [1236 bp, 411 aa] {ON}
           Anc_6.9 YEL056W
          Length = 411

 Score = 35.4 bits (80), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 58/123 (47%), Gaps = 11/123 (8%)

Query: 59  INDLKVIDSDFSAGHLVSSASIDAVKVFDIRTNSCIATIQNESNSPFLSLD-SRHG--LL 115
           +ND K  + D +    VS  S   +++ D R      T Q + ++PF +L  S+H   L 
Sbjct: 221 VNDCKWSNFDLNVFGSVSEDS--TLQLHDQREKDTF-TSQFKVDAPFNTLAFSKHSQYLF 277

Query: 116 ACGTELQGIDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNI 175
           A      G D+ V+++D R    PL S+   H   VT ++F P    IL++   D    I
Sbjct: 278 AAA----GTDSHVYLFDRRDISRPLHSMA-GHDGAVTNMEFSPDQDGILMTSGEDRRAII 332

Query: 176 YDL 178
           +D+
Sbjct: 333 WDI 335

>YDL145C Chr4 complement(194571..198176) [3606 bp, 1201 aa] {ON}
           COP1Alpha subunit of COPI vesicle coatomer complex,
           which surrounds transport vesicles in the early
           secretory pathway
          Length = 1201

 Score = 35.8 bits (81), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 40/155 (25%), Positives = 66/155 (42%), Gaps = 19/155 (12%)

Query: 29  LLTGLSNGEIRLLDWATCKSLQNIKASETAINDLKVIDSDFSAGH--LVSSASIDAVKVF 86
           +L  L +  I+L D+     L   +  E  +  L     DF       VS+     +KV+
Sbjct: 26  VLVALFSSTIQLWDYRMGTLLHRFEDHEGPVRGL-----DFHPTQPIFVSAGDDYTIKVW 80

Query: 87  DIRTNSCIATIQNESNSPFLSLDSRHGLLACGTELQGIDAAVHIYDIRKWDTPLR---SL 143
            + TN C+ T+          LD    +     EL  I +A     IR W+   R   + 
Sbjct: 81  SLDTNKCLYTLTGH-------LDYVRTVF-FHRELPWIISASDDQTIRIWNWQNRKEIAC 132

Query: 144 IDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDL 178
           +  H+  V C +FHP+D ++++S S D    I+D+
Sbjct: 133 LTGHNHFVMCAQFHPTD-DLIVSASLDETIRIWDI 166

>Suva_4.99 Chr4 complement(182425..186030) [3606 bp, 1201 aa] {ON}
           YDL145C (REAL)
          Length = 1201

 Score = 35.4 bits (80), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 40/155 (25%), Positives = 66/155 (42%), Gaps = 19/155 (12%)

Query: 29  LLTGLSNGEIRLLDWATCKSLQNIKASETAINDLKVIDSDFSAGH--LVSSASIDAVKVF 86
           +L  L +  I+L D+     L   +  E  +  L     DF       VS+     +KV+
Sbjct: 26  VLVALFSSTIQLWDYRMGTLLHRFEDHEGPVRGL-----DFHPTQPIFVSAGDDYTIKVW 80

Query: 87  DIRTNSCIATIQNESNSPFLSLDSRHGLLACGTELQGIDAAVHIYDIRKWDTPLR---SL 143
            + TN C+ T+          LD    +     EL  I +A     IR W+   R   + 
Sbjct: 81  SLDTNKCLYTLSGH-------LDYVRTVF-FHRELPWIISASDDQTIRIWNWQNRKEIAC 132

Query: 144 IDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDL 178
           +  H+  V C +FHP+D ++++S S D    I+D+
Sbjct: 133 LTGHNHFVMCAQFHPTD-DLIVSASLDETIRIWDI 166

>Kwal_56.24163 s56 complement(879667..881856) [2190 bp, 729 aa] {ON}
           YGL137W (SEC27) - encodes beta'-subunit of yeast
           coatomer [contig 165] FULL
          Length = 729

 Score = 35.4 bits (80), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 29/120 (24%), Positives = 59/120 (49%), Gaps = 9/120 (7%)

Query: 73  HLVSSASIDAVKVFDIRTNSCIATIQNE-SNSPFLSLDSRHGLLACGTELQGIDAAVHIY 131
           +L++S+    VK++D +T SC+AT++   +N  +        ++  G+E    D  + ++
Sbjct: 57  YLITSSDDRTVKIWDYQTKSCVATLEGHMANVSYAVFHPSLPIILSGSE----DGTLKVW 112

Query: 132 DIRKWDTPLRSLIDSHHDDVTCIKFHPS-DVNILLSGSTDGYTNIYDLKQDEEEDALHQV 190
           +   +   L   ++   +   CI  HP+   N + SG  +G+T +  L  DE + +L  V
Sbjct: 113 NSNTY--KLEKTLNLGLERSWCIATHPTGKRNYIASGFDNGFT-VLSLGNDEPKLSLDPV 169

>ZYRO0E07392g Chr5 complement(564166..566841,567011..567028) [2694
           bp, 897 aa] {ON} highly similar to uniprot|P41811
           Saccharomyces cerevisiae YGL137W SEC27 Involved in
           beta'-subunit of yeast coatomer
          Length = 897

 Score = 35.4 bits (80), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 32/155 (20%), Positives = 69/155 (44%), Gaps = 13/155 (8%)

Query: 29  LLTGLSNGEIRLLDWATCKSLQNIKASETAINDLKVIDSDFSAGHLVSSASIDAVKVFDI 88
           +LT L +G + + ++ T   +++I+A+++ I   K I        ++       ++VF+ 
Sbjct: 28  VLTTLYSGRVEIWNYETQTEVRSIQATDSPIRSGKFIAR---KNWIIVGCDDYRIRVFNY 84

Query: 89  RTNSCIATIQNESNSPFLSLDSRHG---LLACGTELQGIDAAVHIYDIRKWDTPLRSLID 145
            T   +  +  E++  ++   + H     L  G++    D  V +++  K +  L    +
Sbjct: 85  NTGEKV--VDFEAHPDYIRSIAVHPTKPYLLSGSD----DLTVKLWNWEK-NWALEQTFE 137

Query: 146 SHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQ 180
            H   V C+ F+P D +   SG  D    ++ L Q
Sbjct: 138 GHEHFVMCVAFNPKDPSTFASGCLDSTVKVWSLGQ 172

 Score = 35.4 bits (80), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 26/103 (25%), Positives = 51/103 (49%), Gaps = 8/103 (7%)

Query: 73  HLVSSASIDAVKVFDIRTNSCIATIQNE-SNSPFLSLDSRHGLLACGTELQGIDAAVHIY 131
           ++++S+    VK++D +T SC+AT++   SN  F        ++  G+E    D  + I+
Sbjct: 200 YMITSSDDLTVKIWDYQTKSCVATLEGHMSNVSFAVFHPTLPVIISGSE----DGTLKIW 255

Query: 132 DIRKWDTPLRSLIDSHHDDVTCIKFHPS-DVNILLSGSTDGYT 173
           +   +   L   I+   +   C+  HP+   N + SG  +G+T
Sbjct: 256 NASTYK--LEKTINLGLERSWCLATHPTGKKNYIASGFDNGFT 296

>Skud_13.291 Chr13 complement(506764..508293) [1530 bp, 509 aa] {ON}
           YMR131C (REAL)
          Length = 509

 Score = 35.4 bits (80), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 45/190 (23%), Positives = 88/190 (46%), Gaps = 21/190 (11%)

Query: 15  ENWCLKLQPSYKHG-LLTGLSNGEIRLLDWATCKSLQNIKASETAINDLKVIDSDFSAGH 73
           E + L   P  K G LL+G  +G+I      T + + + K   T  N+  + D  +S   
Sbjct: 273 EGYGLDWSPLIKTGALLSGDCSGQIYFTQRHTSRWVTD-KQPFTVSNNKSIEDIQWSRTE 331

Query: 74  --LVSSASIDA-VKVFDIRTNS---CIATIQNESNSPFLSLDSRHG-LLACGTELQGIDA 126
             + ++A  D  ++++D R+      I+   + ++   +S   + G LLA G +    + 
Sbjct: 332 STVFATAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSDKIGYLLASGDD----NG 387

Query: 127 AVHIYDIRKWDTPLRS-------LIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLK 179
              ++D+R++ TP  +         D H   +T I F+P D +I+  GS D    ++DL 
Sbjct: 388 TWGVWDLRQF-TPSNADTVQPVAQYDFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLS 446

Query: 180 QDEEEDALHQ 189
            + +++ + Q
Sbjct: 447 VEADDEEIKQ 456

>NDAI0A02090 Chr1 complement(466744..470346) [3603 bp, 1200 aa] {ON}
           Anc_7.322 YDL145C
          Length = 1200

 Score = 35.4 bits (80), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 39/155 (25%), Positives = 67/155 (43%), Gaps = 19/155 (12%)

Query: 29  LLTGLSNGEIRLLDWATCKSLQNIKASETAINDLKVIDSDFSAGH--LVSSASIDAVKVF 86
           +L  L +  I+L D+     L   +  E  +  L     DF       VS+     +KV+
Sbjct: 26  VLVALFSSTIQLWDYRMGTLLHRFEDHEGPVRGL-----DFHPTQPIFVSAGDDYTIKVW 80

Query: 87  DIRTNSCIATIQNESNSPFLSLDSRHGLLACGTELQGIDAAVHIYDIRKWDTPLR---SL 143
            + TN C+ T+Q         LD    +     EL  I +A     IR W+   R   + 
Sbjct: 81  SLETNKCLYTLQGH-------LDYVRTVF-FHHELPWIISASDDQTIRIWNWQNRKEIAC 132

Query: 144 IDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDL 178
           +  H+  V C +FHP++ ++++S S D    ++D+
Sbjct: 133 LTGHNHFVMCAQFHPNE-DLVVSASLDESVRVWDI 166

>Kpol_1045.33 s1045 (77282..78367) [1086 bp, 361 aa] {ON}
           (77284..78369) [1086 nt, 362 aa]
          Length = 361

 Score = 35.0 bits (79), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 53/113 (46%), Gaps = 9/113 (7%)

Query: 74  LVSSASID-AVKVFDIRTNSCIATIQNESNSPFLSLDSRHGLLACGTELQGIDAAVHIYD 132
           L S++S D  V+++DI+  +     Q E ++P L   +R           G D  V +YD
Sbjct: 48  LFSASSWDNKVRIWDIQGGNPQGKAQYEHSAPVLC--TRWSFDGTKVASGGCDNVVKVYD 105

Query: 133 IRKWDTPLRSLIDSHHDDVTCIKF---HPSDVNILLSGSTDGYTNIYDLKQDE 182
           +   ++     + SH   V  ++F    P++   L++GS D     +DL+Q +
Sbjct: 106 L---NSGQNQQVGSHDSAVQSLRFVQCGPTNAECLVTGSWDKTLKYWDLRQPQ 155

>YCR057C Chr3 complement(220457..223228) [2772 bp, 923 aa] {ON}
           PWP2Conserved 90S pre-ribosomal component essential for
           proper endonucleolytic cleavage of the 35 S rRNA
           precursor at A0, A1, and A2 sites; contains eight
           WD-repeats; PWP2 deletion leads to defects in cell cycle
           and bud morphogenesis
          Length = 923

 Score = 35.4 bits (80), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 47/233 (20%), Positives = 88/233 (37%), Gaps = 58/233 (24%)

Query: 3   SYSLVESNFFGSENW---CLKLQPSYKHGLLTGLSNGEIRLLDWATCKSLQNIKASETAI 59
           S+ + + +FF +      C+   P+ +  L  G ++GE RL D      +Q +   +  +
Sbjct: 247 SWRITKKHFFYANQAKVKCVTFHPATRL-LAVGFTSGEFRLYDLPDFTLIQQLSMGQNPV 305

Query: 60  NDLKV----------------------------------IDSDFSA-----GHLVSSASI 80
           N + V                                   DS  S      G  V +AS 
Sbjct: 306 NTVSVNQTGEWLAFGSSKLGQLLVYEWQSESYILKQQGHFDSTNSLAYSPDGSRVVTASE 365

Query: 81  DA-VKVFDIRTNSCIATIQNESNSPFLSLDSRHGLLACGTELQGIDAAVHIYDIRKWD-- 137
           D  +KV+DI +  C+AT +  ++S      ++ G +   + L G         +R WD  
Sbjct: 366 DGKIKVWDITSGFCLATFEEHTSSVTAVQFAKRGQVMFSSSLDGT--------VRAWDLI 417

Query: 138 --TPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGY-TNIYDLKQDEEEDAL 187
                R+   +      C+   PS   ++ +GS D +  +++ ++  +  DAL
Sbjct: 418 RYRNFRTFTGTERIQFNCLAVDPSG-EVVCAGSLDNFDIHVWSVQTGQLLDAL 469

>Suva_3.93 Chr3 complement(133524..136286) [2763 bp, 920 aa] {ON}
           YCR057C (REAL)
          Length = 920

 Score = 35.4 bits (80), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 46/233 (19%), Positives = 89/233 (38%), Gaps = 58/233 (24%)

Query: 3   SYSLVESNFF---GSENWCLKLQPSYKHGLLTGLSNGEIRLLDWATCKSLQNIKASETAI 59
           S+ +   +FF    S+  C+   P+ +  L+ G ++GE RL D      +Q +   +  +
Sbjct: 247 SWRITNKHFFYANQSKVKCVTFHPATRL-LVVGFTSGEFRLYDLPEFTLIQQLSMGQNPV 305

Query: 60  NDLKV----------------------------------IDSDFSA-----GHLVSSASI 80
           N + V                                   DS  S      G  V +AS 
Sbjct: 306 NTVTVNNTGEWLAFGSSKLGQLLVYEWQSESYILKQQGHFDSTNSLAYSPDGSRVVTASD 365

Query: 81  DA-VKVFDIRTNSCIATIQNESNSPFLSLDSRHGLLACGTELQGIDAAVHIYDIRKWD-- 137
           D  +KV+D+ +  C+AT +  ++S      ++ G +   + + G         +R WD  
Sbjct: 366 DGKIKVWDVTSGFCLATFEEHTSSVTAVQFAKRGQVMFSSSMDGT--------VRAWDLI 417

Query: 138 --TPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGY-TNIYDLKQDEEEDAL 187
                R+   +      C+   PS   ++ +GS D +  +++ ++  +  DAL
Sbjct: 418 RYRNFRTFTGTERIQFNCLAVDPSG-EVVCAGSLDNFDIHVWSVQTGQLLDAL 469

>Kwal_47.17310 s47 (345235..346896) [1662 bp, 553 aa] {ON} YER124C
           (DSE1) - Daughter Specific Expression 1 [contig 210]
           FULL
          Length = 553

 Score = 35.0 bits (79), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 47/101 (46%), Gaps = 13/101 (12%)

Query: 124 IDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQDEE 183
           ID  V ++DIR   T  +  ++ H   +  +K+H +D   L S   +GYT  +DL+  + 
Sbjct: 316 IDNQVKVWDIRS--TGAKCTVNGHKGSIKGLKYH-NDTRRLYSSDDEGYTIAWDLQGIDN 372

Query: 184 EDALHQVINYAS--------IHSCG--WLSPKRIYTLSHME 214
               H    + S        I  CG   ++PK + T+S ++
Sbjct: 373 VSECHLATGFLSITEEKISEIKQCGNVVVAPKNLRTVSSIK 413

>Ecym_6067 Chr6 (124870..126438) [1569 bp, 522 aa] {ON} similar to
           Ashbya gossypii ADR242C
          Length = 522

 Score = 35.0 bits (79), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 41/195 (21%), Positives = 90/195 (46%), Gaps = 21/195 (10%)

Query: 10  NFFGSENWCLKLQPSYKHG-LLTGLSNGEIRLLDWATCKSLQNIKASETAINDLKVIDSD 68
           N    E + L   P  K G +LTG  +G + L      + + + K   T  N+  + D  
Sbjct: 281 NHGNVEGYGLDWSPLIKTGSILTGDCSGRVYLTQRTASRWVTD-KQPFTVGNNKSIEDIQ 339

Query: 69  FSAGHLV--SSASIDA-VKVFDIRTNS---CIATIQNESNSPFLSLDSRHG-LLACGTEL 121
           +S   +   ++  +D  ++++D R+      ++ + ++++   +S + + G LLA G + 
Sbjct: 340 WSRAEMTVFATCGVDGHIRIWDTRSKKHKPALSVMVSDTDVNVMSWNEKIGYLLASGDD- 398

Query: 122 QGIDAAVHIYDIRKWD-------TPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTN 174
                   ++D+R++        TP+ +  + H   +T I F+P D +I+   S D    
Sbjct: 399 ---SGTWGVWDLRQFSAQNTEKTTPV-AQYNFHKAAITSISFNPLDESIIAVASEDNTVT 454

Query: 175 IYDLKQDEEEDALHQ 189
           ++DL  + +++ + Q
Sbjct: 455 LWDLSVEADDEEIKQ 469

>TBLA0B09250 Chr2 (2194005..2195585) [1581 bp, 526 aa] {ON}
           Anc_2.401 YMR131C
          Length = 526

 Score = 35.0 bits (79), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 44/188 (23%), Positives = 87/188 (46%), Gaps = 18/188 (9%)

Query: 15  ENWCLKLQPSYKHG-LLTGLSNGEIRLLDWATCKSLQNIKASETAINDLKVIDSDFSAGH 73
           E + L   P  K G LLTG  +GEI L    T K +   K S +  N+  + D  +S   
Sbjct: 291 EGFGLDWSPLIKSGALLTGDCSGEIFLTSRHTSKWITE-KQSFSVGNNKSIEDIQWSKTE 349

Query: 74  --LVSSASIDA-VKVFDIRTNS---CIATIQNESNSPFLSLDSRHGLLACGTELQGIDAA 127
             + ++A  D  ++++D R+      I+T  +  +   +S + +   L    + +G+   
Sbjct: 350 QTVFATAGCDGYIRIWDTRSKKHKPAISTRASNVDVNVISWNEKMEYLLASGDDKGVWG- 408

Query: 128 VHIYDIRKWD------TPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQD 181
             ++D+R++       +P+ +  D H   +T I F+P D + +   S D    ++DL  +
Sbjct: 409 --VWDLRQFSPSQENASPV-AQYDFHKGAITSISFNPLDESTVAVASEDNTVTLWDLSVE 465

Query: 182 EEEDALHQ 189
            +++ + Q
Sbjct: 466 ADDEEIKQ 473

>Smik_5.253 Chr5 complement(382390..383487) [1098 bp, 365 aa] {ON}
           YER107C (REAL)
          Length = 365

 Score = 35.0 bits (79), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 27/139 (19%), Positives = 59/139 (42%), Gaps = 22/139 (15%)

Query: 83  VKVFDIRTNSCIATIQNESNSPFLSLDSRHGLLACGTELQGIDAAVHIYDIRKWDTPLRS 142
           V+++D++        Q+ES+SP L   +R           G D A+ +YD+    T    
Sbjct: 61  VRIWDVQNGVPQGRAQHESSSPVLC--TRWSNDGTKVASGGCDNALKLYDVASGQT---Q 115

Query: 143 LIDSHHDDVTCIKF---HPSDVNILLSGSTDGYTNIYDLKQDEEEDALHQVINYASIHSC 199
            I  H   +  +++    PS+   +++GS D     +D++Q +    +            
Sbjct: 116 QIGMHAAPIKVLRYVQCGPSNAECIVTGSWDKTIKYWDMRQPQPVSTV------------ 163

Query: 200 GWLSPKRIYTLSHMETFAI 218
             + P+R+Y++   ++  +
Sbjct: 164 --MMPERVYSMDSRQSLLV 180

>TDEL0E05480 Chr5 complement(1002913..1005540,1005640..1005657)
           [2646 bp, 881 aa] {ON} Anc_6.239 YGL137W
          Length = 881

 Score = 35.4 bits (80), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 51/103 (49%), Gaps = 8/103 (7%)

Query: 73  HLVSSASIDAVKVFDIRTNSCIATIQNE-SNSPFLSLDSRHGLLACGTELQGIDAAVHIY 131
           +L++S+    VK++D +T SC+AT++   SN  F        ++  G+E    D  + I+
Sbjct: 200 YLITSSDDLTVKIWDYQTKSCVATLEGHMSNVSFAVFHPTLPVIISGSE----DGTLKIW 255

Query: 132 DIRKWDTPLRSLIDSHHDDVTCIKFHPS-DVNILLSGSTDGYT 173
           +   +   L   ++   +   CI  HP+   N + SG  +G+T
Sbjct: 256 NSSTY--KLEKTLNLGLERSWCIATHPAGKKNYIASGFDNGFT 296

 Score = 31.6 bits (70), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 30/155 (19%), Positives = 67/155 (43%), Gaps = 13/155 (8%)

Query: 29  LLTGLSNGEIRLLDWATCKSLQNIKASETAINDLKVIDSDFSAGHLVSSASIDAVKVFDI 88
           +LT L +G + + ++ +   +++I  +E  +   + I        +V  +    ++VF+ 
Sbjct: 28  VLTTLYSGRVEIWNYESQTEVRSITVAEAPVRAGRFIAR---RNWIVVGSDDFRIRVFNY 84

Query: 89  RTNSCIATIQNESNSPFLSLDSRHG---LLACGTELQGIDAAVHIYDIRKWDTPLRSLID 145
            T   +  +  E++  ++   + H     L  G++    D  V +++  K +  L    +
Sbjct: 85  NTGEKV--VDFEAHPDYIRSIAVHPTKPYLLSGSD----DLTVKLWNWEK-NWALEQTFE 137

Query: 146 SHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQ 180
            H   V C+ F+P D +   SG  D    ++ L Q
Sbjct: 138 GHEHFVMCVAFNPKDPSTFASGCLDSTVKVWSLGQ 172

>Kpol_1028.41 s1028 (100720..102258) [1539 bp, 512 aa] {ON}
           (100720..102258) [1539 nt, 513 aa]
          Length = 512

 Score = 35.0 bits (79), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 40/172 (23%), Positives = 68/172 (39%), Gaps = 10/172 (5%)

Query: 13  GSENWCLKLQPSYKHGLLTGLSNGEIRLLDWATCKSLQNIKASETAINDLKVIDSDFSAG 72
           GS   C    P     ++TG  +   R+ D   C + Q   A+ T  ++  +  S    G
Sbjct: 140 GSTILCSAFAPHTSSRMVTGAGDNTARIWD---CDT-QTPMATLTGHHNWVLCVSWSPDG 195

Query: 73  HLVSSASID-AVKVFDIRTNSCIATIQNESNSPFLSLDSRHGLLACGTELQGIDAAVHIY 131
            L+++ S+D  V++++ +T                SL      L    E   +  +    
Sbjct: 196 ELIATGSMDNTVRLWESKTGKPFGDALRGHGKWITSLSWEPIHLVTPGERPRLATSSKDG 255

Query: 132 DIRKWDTPLR---SLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQ 180
            I+ WDT  R     +  H   V+C+K+     N L SGS D    ++D+K 
Sbjct: 256 TIKIWDTTRRVCTMTLSGHTSSVSCVKW--GGQNFLYSGSHDKTVRVWDMKN 305

>AFL118W Chr6 (216252..216269,216423..218903) [2499 bp, 832 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL137W
           (SEC27); 1-intron
          Length = 832

 Score = 35.0 bits (79), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 58/120 (48%), Gaps = 9/120 (7%)

Query: 73  HLVSSASIDAVKVFDIRTNSCIATIQNE-SNSPFLSLDSRHGLLACGTELQGIDAAVHIY 131
           +L++S+    VKV+D +T SC+AT++   SN  +        ++  G+E    D  V I+
Sbjct: 200 YLITSSDDRTVKVWDYQTKSCVATLEGHLSNVSYAVYHPMLPIIISGSE----DGTVKIW 255

Query: 132 DIRKWDTPLRSLIDSHHDDVTCIKFHPS-DVNILLSGSTDGYTNIYDLKQDEEEDALHQV 190
           +   +   L   ++   +   C+  HP+   N + +G  +G+T +  +  DE   +L  V
Sbjct: 256 NSNTY--KLERTLNLGLERSWCVAAHPTGKRNFIAAGFDNGFT-VLAIGNDEPRLSLDPV 312

>SAKL0E03520g Chr5 complement(283754..286654) [2901 bp, 966 aa] {ON}
           similar to uniprot|Q03177 Saccharomyces cerevisiae
           YMR102C Protein of unknown function transcription is
           activated by paralogous transcription factors Yrm1p and
           Yrr1p along with genes involved in multidrug resistance
          Length = 966

 Score = 35.0 bits (79), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 28/52 (53%), Gaps = 2/52 (3%)

Query: 133 IRKWDTPLRSLIDS--HHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQDE 182
           ++ W    + L+ +  H D VTC+KFHP+D    +SG  D    ++ +  DE
Sbjct: 419 VKLWHCDRKQLLKNFPHPDFVTCVKFHPNDDRFFISGCLDHKARLWSILDDE 470

>YNL317W Chr14 (40619..42016) [1398 bp, 465 aa] {ON}  PFS2Integral
           subunit of the pre-mRNA cleavage and polyadenylation
           factor (CPF) complex; plays an essential role in mRNA
           3'-end formation by bridging different processing
           factors and thereby promoting the assembly of the
           processing complex
          Length = 465

 Score = 35.0 bits (79), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 62/142 (43%), Gaps = 22/142 (15%)

Query: 61  DLKVIDSDFSAGHLVSSASIDAVKVFDIRTNSCIATIQNESNSPFLSLDSRHGLLAC--- 117
           D+K  D     G + S++  + VK++D R+ +CI++I          L  +H +L     
Sbjct: 221 DVKSCDWHPEMGLIASASKDNLVKLWDPRSGNCISSI----------LKFKHTVLKTRFQ 270

Query: 118 ---GTELQGI--DAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGY 172
              G  L  I  D +  ++DIR     L  + D    D   +++HP + ++      DG 
Sbjct: 271 PTKGNLLMAISKDKSCRVFDIRYSMKELMCVRD--ETDYMTLEWHPINESMFTLACYDGS 328

Query: 173 TNIYDLKQDEEEDALHQVINYA 194
              +DL Q+  E  L   I YA
Sbjct: 329 LKHFDLLQNLNEPIL--TIPYA 348

>Smik_15.16 Chr15 complement(29410..33390) [3981 bp, 1326 aa] {ON}
           YOL138C (REAL)
          Length = 1326

 Score = 35.4 bits (80), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 43/97 (44%), Gaps = 7/97 (7%)

Query: 126 AAVHIYDIRK---WDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQDE 182
            A+ IYD+ K    D PL + +  H   +    F+  + N+L+SG  D    I+DL+ ++
Sbjct: 233 TAISIYDLNKSSSIDNPLITSLYEHTRSINSFDFNMVESNLLISGGQDSCVKIWDLRSNK 292

Query: 183 EEDALHQ--VINYA--SIHSCGWLSPKRIYTLSHMET 215
            + +      IN A  SI    W+      T S   T
Sbjct: 293 PKSSNRSDISINTASDSIRDVKWMPGYNFATKSEQGT 329

>KLTH0D11132g Chr4 (910259..911572) [1314 bp, 437 aa] {ON} similar
           to uniprot|Q12417 Saccharomyces cerevisiae YPL151C PRP46
           Splicing factor that is found in the Cef1p subcomplex of
           the spliceosome
          Length = 437

 Score = 35.0 bits (79), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 32/146 (21%), Positives = 57/146 (39%), Gaps = 18/146 (12%)

Query: 38  IRLLDWATCKSLQNIKASETAINDLKVIDSDFSAGHLVSSASIDAVKVFDIRTNSCIATI 97
           +RL D  T   +  +   +  IN +K    D     ++S ++   V+++DIR    +  +
Sbjct: 234 VRLWDIRTRVPVMTLAGHKGPINQVKCFPVD---PQIMSGSADSTVRLWDIRAGKAMKIL 290

Query: 98  QNESNSPFLSLDSRHGLLACGTELQGIDAAVHIYDIRKWDTPLRSLIDSHHDD----VTC 153
            + S S              G   +   A     DIR W      L+ +   +    + C
Sbjct: 291 THHSKSV---------RAIAGNPSESSVATASTSDIRSWRLQDGQLLTNFRSEDTGIINC 341

Query: 154 IKFHPSDVNILLSGSTDGYTNIYDLK 179
           +  +P  V  L +G  DG+ + YD K
Sbjct: 342 LSVNPDGV--LFAGGDDGHLSFYDYK 365

>ZYRO0F05808g Chr6 complement(479060..482908) [3849 bp, 1282 aa]
           {ON} similar to uniprot|P38968 Saccharomyces cerevisiae
           YDL195W SEC31 involved in protein transport from
           endoplasmic reticulum to Golgi Component (p150) of COPII
           coat of secretory pathway vesicles
          Length = 1282

 Score = 35.0 bits (79), Expect = 0.32,   Method: Composition-based stats.
 Identities = 39/174 (22%), Positives = 75/174 (43%), Gaps = 24/174 (13%)

Query: 29  LLTGLSNGEIRLLDWATCKSLQNIK--------ASETAINDLKVIDSDFSAGHLVSSA-S 79
           L TG + GEI +  W   K L+N           S T + ++  +  + S  H+ +SA S
Sbjct: 122 LATGGTKGEIFI--WDVNKCLENPNDYTPLTPGNSMTPVEEITSLAWNQSLAHVFASAGS 179

Query: 80  IDAVKVFDIRTNSCIATIQNESNSPFLSL----------DSRHGLLACGTELQGIDAAVH 129
                ++D++    +  +   S +  L            +S     A G++    D ++ 
Sbjct: 180 TSYASIWDLKAKKEVIHLSYTSPNTGLKAPLSVVEWHPKNSTRVATATGSD---NDPSIL 236

Query: 130 IYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQDEE 183
           ++D+R  +TPL+ L   H   V  + +   D N+LLS   D    +++ ++ +E
Sbjct: 237 VWDLRNANTPLQVLSQGHSKGVLSLDWCNQDENLLLSSGRDNTVVLWNPQEGQE 290

>Ecym_3481 Chr3 complement(897444..898958) [1515 bp, 504 aa] {ON}
           similar to Ashbya gossypii ADL322C
          Length = 504

 Score = 35.0 bits (79), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 32/58 (55%), Gaps = 5/58 (8%)

Query: 3   SYSLVESNFFGSEN--WCLKLQPSYKHGLLTGLSNGEIRLLDWATCKSLQNIKASETA 58
           +YSLV  N    +N   CL+  P+    LLTG+ NGE+RL  W+    LQNI +   A
Sbjct: 186 TYSLVHPNVSEKQNEVTCLEWSPN-GESLLTGVENGELRL--WSMEGKLQNILSHHKA 240

>Smik_16.106 Chr16 (194195..196564) [2370 bp, 789 aa] {ON} YGR200C
           (REAL)
          Length = 789

 Score = 35.0 bits (79), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 40/192 (20%), Positives = 71/192 (36%), Gaps = 26/192 (13%)

Query: 144 IDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQDEEEDALHQVINYASIHSCGWLS 203
           +  H  +VTC++F P D + ++S S D +  I+          +  + +Y++        
Sbjct: 55  LKGHESEVTCVRFIP-DSDFMISASEDHHVKIWKFSDHSHLQCIQTIEHYSNTIVALSAL 113

Query: 204 PKRIYTLSHMETFAIHELNDKSDELREPQPLDFGDVRKAWDCDYVVDIYPGLIATGKTQE 263
           P  +       T  I   N  +DE           ++K +        YP  ++  K QE
Sbjct: 114 PNIVSVGCADGTITIWRQNTLNDEFSLAHEF---IIKKGF-------FYPLCLSLSKVQE 163

Query: 264 NAGELRLIPFKNEKIY----------TEKCFVIPHAHGDEVVRDIFISAHQSD----MLY 309
           N   L  I   N  ++           EKC ++    G E         HQ      +L 
Sbjct: 164 NK-YLLAIGGTNVHVFIASFILSNAGIEKCQIVAELEGHEDWVKSLAFRHQETPGDYLLC 222

Query: 310 SCGEDGYVKIWK 321
           S  +D Y+++W+
Sbjct: 223 SGSQDRYIRLWR 234

>Suva_16.60 Chr16 complement(91552..93132) [1581 bp, 526 aa] {ON}
           YPL247C (REAL)
          Length = 526

 Score = 35.0 bits (79), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 36/71 (50%), Gaps = 7/71 (9%)

Query: 130 IYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQDEEEDALHQ 189
           I D+R  ++P+ +L + H   V  IK+HP+  N+LLS S D     +DL     E     
Sbjct: 379 ILDMRNPESPILTL-EGHSSSVNEIKWHPTKRNVLLSCSDDCQVLYWDLNNSFME----- 432

Query: 190 VINYASIHSCG 200
            IN  S+ S G
Sbjct: 433 -INGGSVKSPG 442

>Ecym_6228 Chr6 (425765..427102) [1338 bp, 445 aa] {ON} similar to
           Ashbya gossypii AER337W
          Length = 445

 Score = 35.0 bits (79), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 44/164 (26%), Positives = 77/164 (46%), Gaps = 13/164 (7%)

Query: 20  KLQPSYKHGLLTGLSNGEIRLLDWATCKSLQNIKAS-ETAINDLKVIDSDFSAGHLVSSA 78
           KL  + K      L +G IR    A    L++ KA  E AI D     +D + G+ VS  
Sbjct: 241 KLSTASKKRRKLALKDGSIRRR--APLSLLESHKAPVEQAIFD----SNDSTVGYSVSQD 294

Query: 79  SIDAVKVFDIRTNSCIAT-IQNESNSPFLSLDSRHGLLACGTELQGIDAAVHIYDIRKWD 137
            +  +K +D+ T+ C+ T   + S    + + +R  LLACG+  + I   +H   +    
Sbjct: 295 HM--IKTWDLVTSRCVDTKTTSYSLLSIVEMPARR-LLACGSSARHI--ILHDPRMDSSS 349

Query: 138 TPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQD 181
             ++  +  H++ V  +   P +  +L SGS DG   ++D++ D
Sbjct: 350 KIIQKQLIGHNNFVVSLDTCPENEYMLCSGSHDGTVRVWDVRSD 393

>Smik_3.157 Chr3 complement(218522..221296) [2775 bp, 924 aa] {ON}
           YCR057C (REAL)
          Length = 924

 Score = 35.0 bits (79), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 48/233 (20%), Positives = 87/233 (37%), Gaps = 58/233 (24%)

Query: 3   SYSLVESNFF---GSENWCLKLQPSYKHGLLTGLSNGEIRLLDWATCKSLQNIKASETAI 59
           S+ +   +FF    S+  C+   P+ +  L  G + GE RL D      +Q +   +  +
Sbjct: 245 SWRITSKHFFYANQSKVKCVTFHPATRL-LAVGFTTGEFRLYDMPDFTLIQQLSMGQNPV 303

Query: 60  NDLKV----------------------------------IDSDFSA-----GHLVSSASI 80
           N + V                                   DS  S      G  V +AS 
Sbjct: 304 NTVSVNNTGEWLAFGSSKLGQLLVYEWQSESYILKQQGHFDSTNSLAYSPDGSRVVTASD 363

Query: 81  DA-VKVFDIRTNSCIATIQNESNSPFLSLDSRHGLLACGTELQGIDAAVHIYDIRKWD-- 137
           D  +KV+DI +  C+AT +  ++S      ++ G +   + L G         +R WD  
Sbjct: 364 DGKIKVWDITSGFCLATFEEHTSSVTAVQFAKRGQVMFSSSLDGT--------VRAWDLI 415

Query: 138 --TPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGY-TNIYDLKQDEEEDAL 187
                R+   +      C+   PS   ++ +GS D +  +++ ++  +  DAL
Sbjct: 416 RYRNFRTFTGTERIQFNCLAVDPSG-EVVCAGSLDNFDIHVWSVQTGQLLDAL 467

>TDEL0A06890 Chr1 (1202790..1204133) [1344 bp, 447 aa] {ON}
           Anc_6.276 YPL247C Two N bases added to fix a frameshift
           that can't be corrected using the reads.
          Length = 447

 Score = 34.7 bits (78), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 34/57 (59%), Gaps = 2/57 (3%)

Query: 123 GIDAA-VHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDL 178
            ID++ V I D+R   +PL +L ++H   +  IK+HP+  N+LLS S D     +DL
Sbjct: 331 AIDSSKVLILDMRSPGSPLLTL-EAHTAPINQIKWHPTRRNVLLSASDDCQVLYWDL 386

>NDAI0E01500 Chr5 complement(295871..297157) [1287 bp, 428 aa] {ON}
           Anc_8.631
          Length = 428

 Score = 34.7 bits (78), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 31/59 (52%), Gaps = 3/59 (5%)

Query: 123 GIDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQD 181
           G D   +I+D R      +  +     DVT IKF   D N +++GS DG  N++DL+ D
Sbjct: 251 GSDGYTYIWDTRSPSAVQKFFVS--DSDVTSIKFF-KDGNSIITGSDDGIINMFDLRSD 306

>Ecym_7105 Chr7 complement(205465..206919) [1455 bp, 484 aa] {ON}
           similar to Ashbya gossypii AAL157C
          Length = 484

 Score = 34.7 bits (78), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 50/221 (22%), Positives = 86/221 (38%), Gaps = 44/221 (19%)

Query: 121 LQGID------------AAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGS 168
            QGID            A + ++DI +   PL +L     D++T +KF+ ++ ++LLS  
Sbjct: 178 FQGIDHHKENTSFVTGGAQIELWDINR-RKPLSNL-SWGIDNITAVKFNQNEADLLLSSG 235

Query: 169 TDGYTNIYDLKQDEEEDALHQVINYASIHSCGWLSPKRIYTLSHMETFAIHELNDKSDEL 228
           +D    +YDL+ +       +++     +S  W         + ME F     N      
Sbjct: 236 SDNSVVLYDLRTNS---PTQKIVQTMKTNSMCW---------NPMEPFNFVTAN------ 277

Query: 229 REPQPLDFGDVRKAWDCDYVVDIYPGLIATGKTQENAGELRLIPFKNEKIYTEKCFVIPH 288
            E Q   + D+R      +V   +   I          E+    +      T + F I H
Sbjct: 278 -EDQNAYYYDMRNMSRALHVFKDHVSAIMDVDISPTGEEIVTGSYDK----TIRIFNIKH 332

Query: 289 AHGDEV-----VRDIFISAHQSDMLY--SCGEDGYVKIWKS 322
            H  EV     ++ +F      D  Y  S  +DG V++W+S
Sbjct: 333 GHSREVYHTKRMQHVFQVKFTMDSKYIVSGSDDGNVRLWRS 373

>SAKL0G19536g Chr7 complement(1683650..1684636) [987 bp, 328 aa]
           {ON} highly similar to uniprot|P36104 Saccharomyces
           cerevisiae YKL018W SWD2 Subunit of the COMPASS complex
           which methylates histone H3 on lysine 4 and is required
           in transcriptional silencing near telomeres
          Length = 328

 Score = 34.7 bits (78), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 39/167 (23%), Positives = 71/167 (42%), Gaps = 32/167 (19%)

Query: 27  HG--LLTGLSNGEIRLLDWATCKSLQNIKASETAINDLKVIDSDFSAGHLVSSASIDAVK 84
           HG  LLT  +N  + L D  +C+ L  I + +   +  K   +       + S+++   K
Sbjct: 37  HGQYLLTATANDNMHLYDAVSCRFLNTIASKKYGCHSAKFTHAQ---SECIYSSTM---K 90

Query: 85  VFDIRTNSCIATIQNESNSPFLSLDSRHGLLACGTELQGI---------DAAVHIYDIR- 134
            FDIR       +  E+N  +L   + HG L    E+  +         D +V ++D+R 
Sbjct: 91  SFDIR------HLNLETNQ-YLRYFTGHGALVSDIEMSPLEDVFLSASYDESVRLWDLRT 143

Query: 135 -KWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQ 180
            K    + SL+       TCI + PS +   +    +    +Y+++Q
Sbjct: 144 SKAQAIVPSLVP------TCIAYDPSGLVFAIGNPENHEIGLYNIRQ 184

>NCAS0A01850 Chr1 complement(356138..358243) [2106 bp, 701 aa] {ON}
           Anc_4.77 YGR145W
          Length = 701

 Score = 34.7 bits (78), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 41/81 (50%), Gaps = 9/81 (11%)

Query: 106 LSLDSRHGLLACGTELQGIDAAVHIYDIRKWDTPLRSLIDSHHDD----VTCIKFHPSDV 161
           +S++S +GL+A G E    +  V  +D R      +  +++  D+    VT   F    +
Sbjct: 186 VSVNSTNGLVATGME----ENVVEFWDPRSRSRVAKLFLENQFDNNAFQVTTTSFRNDGL 241

Query: 162 NILLSGSTDGYTNIYDLKQDE 182
           N    G+++GYT +YDL+  E
Sbjct: 242 N-FACGTSNGYTYLYDLRSSE 261

>Skud_10.102 Chr10 (173179..175305) [2127 bp, 708 aa] {ON} YJL112W
           (REAL)
          Length = 708

 Score = 34.7 bits (78), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 44/162 (27%), Positives = 71/162 (43%), Gaps = 34/162 (20%)

Query: 18  CLKLQPSYKHGLLTGLSNGEIRLLDWATCKSLQNIKASETAINDLKVIDSDFSAGHLVSS 77
            L L P++   L++G  +  IR  D  + K +Q              ID  F A  L ++
Sbjct: 501 ALSLDPNF---LVSGSQDRTIRQWDLCSGKCMQ-------------TIDLSF-ANVLTTA 543

Query: 78  ASIDAVKVFDIRTNSCIATIQNESNSPFLSLDSRHGLLACGTELQGIDAAVHIYDIRKWD 137
            ++D  K   +   S   TI         +L S    LA GT+    D  V ++D+R   
Sbjct: 544 TNVDLSKSTLLTQRSERPTIG--------ALQSFDAALATGTK----DGIVRLWDLRSGK 591

Query: 138 TPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLK 179
             +R+L + H D +T +KF   D   L++GS D    ++DL+
Sbjct: 592 V-IRTL-EGHTDAITSLKF---DSACLVTGSYDRTVRVWDLR 628

 Score = 32.0 bits (71), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 36/147 (24%), Positives = 65/147 (44%), Gaps = 27/147 (18%)

Query: 52  IKASETAIND-LKVIDSDFSAGHLVSSASID-AVKVFDIRTNSCIATIQNE-SNSPFLSL 108
           I + E+A +D +  +D D   G L ++  +D  VK++D+     I  +    +    + +
Sbjct: 384 IGSIESAHDDFITCLDFDGPFGTLCTAGYLDHTVKIWDLSKRKKIGELAGHLATINCMQI 443

Query: 109 DSRHGLLACGTELQGIDAAVHIYDIR-----------------KWDTPLRSLIDSHHDDV 151
           D  +G L  G    G DAA+ ++++                  + D+P     ++H D+V
Sbjct: 444 DRDYGTLVTG----GRDAALKLWNLNLAEQLYQETQNLTCPASQIDSPCVFTFEAHIDEV 499

Query: 152 TCIKFHPSDVNILLSGSTDGYTNIYDL 178
           T +   P   N L+SGS D     +DL
Sbjct: 500 TALSLDP---NFLVSGSQDRTIRQWDL 523

>YCR084C Chr3 complement(260311..262452) [2142 bp, 713 aa] {ON}
           TUP1General repressor of transcription, forms complex
           with Cyc8p, involved in the establishment of repressive
           chromatin structure through interactions with histones
           H3 and H4, appears to enhance expression of some genes
          Length = 713

 Score = 34.7 bits (78), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 40/158 (25%), Positives = 71/158 (44%), Gaps = 16/158 (10%)

Query: 29  LLTGLSNGEIRLLDWATCKSLQNIKASETAINDLKVIDSDFSAGHLVSSASIDAVKVFDI 88
           L TG  +  IR+ D    K +  ++  E    D+  +D   S   LVS +    V+++D+
Sbjct: 458 LATGAEDRLIRIWDIENRKIVMILQGHE---QDIYSLDYFPSGDKLVSGSGDRTVRIWDL 514

Query: 89  RTNSCIATIQNESNSPFLSLDSRHG-LLACGTELQGIDAAVHIYD------IRKWDTPLR 141
           RT  C  T+  E     +++    G  +A G+    +D AV ++D      + + D+   
Sbjct: 515 RTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGS----LDRAVRVWDSETGFLVERLDSENE 570

Query: 142 SLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLK 179
           S    H D V  + F   D   ++SGS D    +++L+
Sbjct: 571 SGT-GHKDSVYSVVFT-RDGQSVVSGSLDRSVKLWNLQ 606

>Kpol_1013.37 s1013
           complement(88637..88936,88986..88994,89037..90134) [1407
           bp, 468 aa] {ON}
           complement(88637..88936,88986..88994,89037..90134) [1407
           nt, 469 aa]
          Length = 468

 Score = 34.7 bits (78), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 52/106 (49%), Gaps = 7/106 (6%)

Query: 72  GHLVSSASIDAVKV-FDIRTNSCIATIQNESNSPFLSLDSRHGLLACGTELQGIDAAVHI 130
           G L+++A  D V + +D+R+   I ++   +   + S  S++G     +     D  + I
Sbjct: 322 GSLIATAGADKVGIIWDLRSGKNILSLVGHAKPIYCSDWSQNGYQXXXSG----DGTIKI 377

Query: 131 YDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIY 176
           +D+RK D      I +H + VT +KF   +   L+S S D   N++
Sbjct: 378 WDLRKVDDV--ETILAHKNVVTDLKFEKENSKFLISSSYDKDINVF 421

>KAFR0F02590 Chr6 complement(504740..506842) [2103 bp, 700 aa] {ON}
           Anc_1.247 YKR036C
          Length = 700

 Score = 34.7 bits (78), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 49/207 (23%), Positives = 88/207 (42%), Gaps = 45/207 (21%)

Query: 18  CLKLQPSYKHGLLTGLSNGEIRL------LDWATCK-SLQNIKAS------ETAINDLKV 64
           CL++   + + +++G  +  +RL      LD   C+ + + IK S      E  I+++  
Sbjct: 430 CLQMDARF-NMVISGSKDNTLRLWDLNLALDLFHCEDAEEKIKQSPCVFVFEAHIDEVTA 488

Query: 65  IDSDFSAGHLVSSASIDAVKVFDIRTNSCIATI---------QNESNSPFLSLDSRHGLL 115
           +    ++ HLVS +    ++ +D+    C  T           N + S   S D +  +L
Sbjct: 489 LS--INSSHLVSGSQDRTIRNWDLHQGRCTQTFDLNFPSLLKSNVAPSSRRSRD-KQNML 545

Query: 116 ACGTELQGIDAAVHIYDI-----------RKWDTP----LRSLIDSHHDDVTCIKFHPSD 160
           +       +  A+ IYD+           R WD      +RSL D H D +T +KF   +
Sbjct: 546 SFPNYSPPVVGALQIYDVALATGTRDGIVRLWDLRSGEVIRSL-DGHTDAITSLKFDKYN 604

Query: 161 VNILLSGSTDGYTNIYDLKQDEEEDAL 187
           +   ++GS D    I+DL+     D L
Sbjct: 605 I---ITGSIDKTVRIWDLRTGLSVDTL 628

>YBR097W Chr2 (436951..441315) [4365 bp, 1454 aa] {ON}
            VPS15Myristoylated serine/threonine protein kinase
            involved in vacuolar protein sorting; functions as a
            membrane-associated complex with Vps34p; active form
            recruits Vps34p to the Golgi membrane; interacts with the
            GDP-bound form of Gpa1p
          Length = 1454

 Score = 34.7 bits (78), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 54/241 (22%), Positives = 98/241 (40%), Gaps = 49/241 (20%)

Query: 36   GEIRLLDWATCK--SLQNIKASETAINDLKVIDSDFSAGHLVSSASIDAVKVFDIRTNSC 93
             E++ L+    +  +L+N   +E A+     ++ + S   LV+  ++  V +FDIRT   
Sbjct: 1164 SEVKFLNCECIRKINLKNFGKNEYAVRMRAFVNEEKSL--LVALTNLSRVIIFDIRT--- 1218

Query: 94   IATIQNESNSPFLSLDSRHGLLA--------CGTELQGIDAAVHIYDIRKWDTPLRSLID 145
            +  +Q   NSP      RHG ++        C   L      + I+DIR ++  +RS   
Sbjct: 1219 LERLQIIENSP------RHGAVSSICIDEECCVLILGTTRGIIDIWDIR-FNVLIRSWSF 1271

Query: 146  SHHDDVTCI---KFHPSDVNILLSGSTDGYTNIYD----------LKQDEEEDALH---- 188
              H  +T +   +F+  +  I++ GS+  +  I++          +  DE+    H    
Sbjct: 1272 GDHAPITHVEVCQFYGKNSVIVVGGSSKTFLTIWNFVKGHCQYAFINSDEQPSMEHFLPI 1331

Query: 189  ----QVINYASIHSCGWLSP------KRIYTLSHMETFAIHELNDKSDELREPQPLDFGD 238
                + +N+  I S   LS       K + T     +  +  LN+ S       P  F D
Sbjct: 1332 EKGLEELNFCGIRSLNALSTISVSNDKILLTDEATSSIVMFSLNELSSSKAVISPSRFSD 1391

Query: 239  V 239
            V
Sbjct: 1392 V 1392

>NDAI0I02180 Chr9 complement(499955..501394) [1440 bp, 479 aa] {ON}
           Anc_5.201 YLL011W
          Length = 479

 Score = 34.7 bits (78), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 44/206 (21%), Positives = 87/206 (42%), Gaps = 29/206 (14%)

Query: 12  FGSENWCLKLQPSYKH--GLLTGLSNGEIRLLDWATCKSLQNIKASETAINDLKVIDSDF 69
           +G  +    +  +Y++   L TG ++G I+  + +T   + + KA    I  L V     
Sbjct: 64  YGHRDGVYVIAKNYRNLNKLATGSADGVIKYWNMSTRDEVCSFKAHYGLITGLCVTPEHL 123

Query: 70  SAGH----LVSSASIDAVKVFDIRTNSCIATIQNESNSPFLSLDSRHGLLAC---GTELQ 122
           S       ++S +    VK++ + +   +    +E       L++  GLL         Q
Sbjct: 124 SKNKNDNFMLSCSDDKTVKLWSVNSEDYVNLKDDEQ------LNTTSGLLKTFYSDIAFQ 177

Query: 123 GID------------AAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTD 170
           GID            A + ++D  +  TPL +L     D++T +KF+ ++ +I  S  +D
Sbjct: 178 GIDHHRSNSNFVTGGAQIQLWDSNR-STPLSNL-SWGADNITTVKFNQNETDIFASAGSD 235

Query: 171 GYTNIYDLKQDEEEDALHQVINYASI 196
               +YDL+ +     + Q +   +I
Sbjct: 236 NSIVLYDLRTNSPTQKIVQTMRTNAI 261

>TDEL0C02360 Chr3 (412482..416276) [3795 bp, 1264 aa] {ON} Anc_7.310
           YDL195W
          Length = 1264

 Score = 34.7 bits (78), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 39/176 (22%), Positives = 77/176 (43%), Gaps = 28/176 (15%)

Query: 29  LLTGLSNGEIRLLDWATCKSLQNIKA--------SETAINDLKVIDSDFSAGHLVSSA-S 79
           L +G S GEI + D  TC  L+N +         + T I ++  +  + S  H+ +SA S
Sbjct: 122 LASGGSKGEIYIWDLNTC--LKNSEGYTPLTPGVASTPIEEVTSLAWNQSLAHVFASAGS 179

Query: 80  IDAVKVFDIRTNSCIATIQNESNSPFLSLDSRHGLL------------ACGTELQGIDAA 127
                ++D++    +  I     SP   L S+  ++            A G++ + +   
Sbjct: 180 TSYASIWDLKAKKEV--IHLSYASPSTGLKSQLSVVEWHPKNSTRVATATGSDTEPL--- 234

Query: 128 VHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQDEE 183
           + ++D+R  +TPL+ L   H   +  + +   D  +LLS   D    +++ +  +E
Sbjct: 235 ILVWDLRNANTPLQVLSKGHSKGILSLDWCSQDEELLLSSGRDNTIVLWNPESGQE 290

>Skud_3.133 Chr3 complement(204741..207488) [2748 bp, 916 aa] {ON}
           YCR057C (REAL)
          Length = 916

 Score = 34.7 bits (78), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 47/233 (20%), Positives = 90/233 (38%), Gaps = 58/233 (24%)

Query: 3   SYSLVESNFF---GSENWCLKLQPSYKHGLLTGLSNGEIRLLDWATCKSLQNIKASETAI 59
           S+ + + +FF    S+  C+   P+ +  L  G ++GE RL D      +Q +   +  +
Sbjct: 242 SWRITKKHFFYANQSKVKCVTFHPATRL-LAVGFTSGEFRLYDLPDFTLIQQLSMGQNPV 300

Query: 60  NDLKVIDSD----FSA---------------------GHL--------------VSSASI 80
           N + V  +     F +                     GH               V +AS 
Sbjct: 301 NTVSVNSTGEWLAFGSSKLGQLLVYEWQSESYILKQQGHFDSTNCLAYSPDGSRVVTASD 360

Query: 81  DA-VKVFDIRTNSCIATIQNESNSPFLSLDSRHGLLACGTELQGIDAAVHIYDIRKWD-- 137
           D  +KV+DI +  C+AT +  ++S      ++ G +   + L G         +R WD  
Sbjct: 361 DGKIKVWDITSGFCLATFEEHTSSVTAVQFAKRGQVMFSSSLDGT--------VRAWDLI 412

Query: 138 --TPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGY-TNIYDLKQDEEEDAL 187
                R+   +      C+   PS   ++ +GS D +  +++ ++  +  DAL
Sbjct: 413 RYRNFRTFTGTERIQFNCLAVDPSG-EVVCAGSLDNFDIHVWSVQTGQLLDAL 464

>NCAS0A13940 Chr1 (2740150..2743767) [3618 bp, 1205 aa] {ON}
           Anc_7.322
          Length = 1205

 Score = 34.7 bits (78), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 37/153 (24%), Positives = 66/153 (43%), Gaps = 15/153 (9%)

Query: 29  LLTGLSNGEIRLLDWATCKSLQNIKASETAINDLKVIDSDFSAGHLVSSASIDAVKVFDI 88
           +L  L +  I+L D+     L   +  E  +   + +D   +    VS      +KV+ +
Sbjct: 26  VLVALFSSTIQLWDYRMGTLLHRFEDHEGPV---RSVDFHPTQPIFVSGGDDYTIKVWSL 82

Query: 89  RTNSCIATIQNESNSPFLSLDSRHGLLACGTELQGIDAAVHIYDIRKWDTPLR---SLID 145
            TN C+ T+          LD    +     EL  I +A     IR W+   R   + + 
Sbjct: 83  ETNKCLYTLNGH-------LDYIRTVF-FHKELPWIISASDDQTIRIWNWQNRKEIACLT 134

Query: 146 SHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDL 178
            H+  V C +FHP+D ++++S S D    ++D+
Sbjct: 135 GHNHFVMCAQFHPTD-DLVVSASLDETIRVWDI 166

>Kwal_27.12239 s27 complement(1143763..1144713) [951 bp, 316 aa]
           {ON} YBR175W (SWD3) - YBR175W [contig 22] FULL
          Length = 316

 Score = 34.3 bits (77), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 34/65 (52%), Gaps = 5/65 (7%)

Query: 113 GLLACGTELQGIDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGY 172
           G L C   +   D ++ I+DI    T LR+L  +H + V  I   P D +IL SGS DG 
Sbjct: 111 GNLLCSCSM---DESIKIWDILS-GTLLRTL-SAHSEPVVSIDLPPFDPSILSSGSYDGL 165

Query: 173 TNIYD 177
             I+D
Sbjct: 166 IRIFD 170

>NCAS0G01120 Chr7 complement(199561..201045) [1485 bp, 494 aa] {ON}
           Anc_6.276
          Length = 494

 Score = 34.3 bits (77), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 29/51 (56%), Gaps = 1/51 (1%)

Query: 130 IYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQ 180
           I D+R  ++PL  +++ H   V  IK+HP   N+LLSG  D     +DL +
Sbjct: 357 ILDMRNPESPLM-ILEGHSASVNQIKWHPIKRNVLLSGGDDCQVLYWDLNK 406

>KLTH0H03608g Chr8 (327747..327764,327941..330550) [2628 bp, 875 aa]
           {ON} similar to uniprot|P41811 Saccharomyces cerevisiae
           YGL137W SEC27 Involved in beta'-subunit of yeast
           coatomer
          Length = 875

 Score = 34.7 bits (78), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 25/103 (24%), Positives = 51/103 (49%), Gaps = 8/103 (7%)

Query: 73  HLVSSASIDAVKVFDIRTNSCIATIQNE-SNSPFLSLDSRHGLLACGTELQGIDAAVHIY 131
           +L++S+    VK++D +T SC+AT++   +N  F        ++  G+E    D  + ++
Sbjct: 200 YLITSSDDRTVKIWDYQTKSCVATLEGHMANVSFAVFHPALPIIISGSE----DGTLKVW 255

Query: 132 DIRKWDTPLRSLIDSHHDDVTCIKFHPS-DVNILLSGSTDGYT 173
           +   +   L   ++   +   CI  HP+   N + SG  +G+T
Sbjct: 256 NSNTY--KLEKTLNLGLERSWCIATHPTGKRNYVASGFDNGFT 296

>TDEL0G01280 Chr7 complement(258957..259555,259626..260934) [1908
           bp, 635 aa] {ON} Anc_5.104 YGR225W
          Length = 635

 Score = 34.7 bits (78), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 43/81 (53%), Gaps = 7/81 (8%)

Query: 121 LQGIDAAVHIYDIRKWDTPLRS--LIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYD- 177
           + G+  +V+++  +    P+ S   ++  HD VTC+ F P ++ + + G+  G   ++D 
Sbjct: 267 MVGLGCSVYMWSDKHGAIPVLSHDYLNRKHDVVTCVSFCPQNL-LFVIGTKQGRVLLFDQ 325

Query: 178 ---LKQDEEEDALHQVINYAS 195
              L++  EED+L  +  Y S
Sbjct: 326 EVCLERHREEDSLTPLYEYQS 346

>TPHA0L01690 Chr12 (355859..358357) [2499 bp, 832 aa] {ON} Anc_8.544
           YBR198C
          Length = 832

 Score = 34.7 bits (78), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 41/164 (25%), Positives = 76/164 (46%), Gaps = 13/164 (7%)

Query: 17  WCLKLQPSYKHGLLTGLSNGEIRLLDWATCKSLQNIKASETAINDLKVIDSDFSAGHLVS 76
           W ++  P   H   T   +   RL  W+ C  +  ++     I+D+  +    +  ++ +
Sbjct: 599 WDVQFSP-VGHYFATASHDQTARL--WS-CDHIFPLRIFSGHISDVDCVTFHPNGCYIFT 654

Query: 77  SASIDAVKVFDIRTNSCIATIQNESNSPFLSLD-SRHGL-LACGTELQGIDAAVHIYDIR 134
            +S    +++DI T   +      + +P LS+  +  GL LA G+E    D  +HI+DI 
Sbjct: 655 GSSDKTCRMWDITTGESVRLFIGHT-APILSVAVAPDGLRLATGSE----DGVIHIWDIG 709

Query: 135 KWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDL 178
              + L+ LI      V  + ++  + NIL+SG +D    I+DL
Sbjct: 710 TGKS-LKKLIGHGKSAVNSLSYN-KESNILVSGGSDNSVRIWDL 751

>YHR186C Chr8 complement(475999..480672) [4674 bp, 1557 aa] {ON}
            KOG1Subunit of TORC1, a rapamycin-sensitive complex
            involved in growth control that contains Tor1p or Tor2p,
            Lst8p and Tco89p; contains four HEAT repeats and seven
            WD-40 repeats; may act as a scaffold protein to couple
            TOR and its effectors
          Length = 1557

 Score = 34.7 bits (78), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 46/199 (23%), Positives = 83/199 (41%), Gaps = 28/199 (14%)

Query: 16   NWCLKL-------QP------SYKHGLLTGLSNGEIRLLDWATCKSLQNIKASE---TAI 59
            NW  KL       QP       ++  L+T      I + DW   K+L          T +
Sbjct: 1198 NWSKKLISLNNKSQPKLMKFAQFEDQLITADDRSTITVFDWEKGKTLSKFSNGTPFGTKV 1257

Query: 60   NDLKVIDSDFSAGHLVSSASIDAVKVF----DIRTNSCIATIQNESNSPFLSLDSRHGLL 115
             DLK+I+ D SA  L++ +S   +K++    D+ T   ++  +  ++   L      GLL
Sbjct: 1258 TDLKLINEDDSA-LLLTGSSDGVIKIYRDYQDVDTFKIVSAWRGLTD--MLLTPRSTGLL 1314

Query: 116  ACGTELQG-IDAAVHIYDIRKWDTPLRSL-IDSHHDDVTCIKFHPSDV---NILLSGSTD 170
                +++G +     +  IR WD    ++ +D      + I    +D    NI ++G  D
Sbjct: 1315 TEWLQIRGSLLTTGDVKVIRVWDAHTETVEVDIPAKTSSLITSLTADQLAGNIFVAGFAD 1374

Query: 171  GYTNIYDLKQDEEEDALHQ 189
            G   +YD + D  +  + +
Sbjct: 1375 GSLRVYDRRLDPRDSMIRR 1393

 Score = 32.0 bits (71), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 26/126 (20%), Positives = 57/126 (45%), Gaps = 16/126 (12%)

Query: 72   GHLVSSASIDAVKVFDIRTNSCIATIQNESNSPFLSLDSRHGLLACGTELQGI-DAAVHI 130
            G L+++  +  ++V+D  T +    I  +++S   SL +    LA    + G  D ++ +
Sbjct: 1322 GSLLTTGDVKVIRVWDAHTETVEVDIPAKTSSLITSLTADQ--LAGNIFVAGFADGSLRV 1379

Query: 131  YD---------IRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQD 181
            YD         IR+W    R+  D     +  +         L+SG+T+G   ++D++ +
Sbjct: 1380 YDRRLDPRDSMIRRW----RAGNDKQGVWINNVHLQRGGYRELVSGATNGVVELWDIRSE 1435

Query: 182  EEEDAL 187
            +  ++ 
Sbjct: 1436 DPVESF 1441

>ZYRO0G03146g Chr7 complement(238354..239886) [1533 bp, 510 aa] {ON}
           highly similar to uniprot|Q04305 Saccharomyces
           cerevisiae YMR093W UTP15 Nucleolar protein component of
           the small subunit (SSU) processome containing the U3
           snoRNA that is involved in processing of pre-18S rRNA
          Length = 510

 Score = 34.3 bits (77), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 45/111 (40%), Gaps = 4/111 (3%)

Query: 73  HLVSSASIDAVKVFDIRTNSCIATIQNESNSPFLSLDSRHGLLACGTELQGIDAAVHIYD 132
           H  +  S   V++F  RT   I T     +  + +     G L C  +  G+   V +YD
Sbjct: 53  HDFAVTSSTRVQLFSSRTRQVIKTFSRFKDVVYSASFRNDGKLLCAGDATGL---VSVYD 109

Query: 133 IRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQDEE 183
                  L S+  S H      KFH  D   L++ S D  T ++D+ Q  E
Sbjct: 110 SYNPRALLVSINASTHP-THVTKFHSHDSKSLVTASDDRITRVWDISQSYE 159

>Ecym_4280 Chr4 complement(600066..603464) [3399 bp, 1132 aa] {ON}
           similar to Ashbya gossypii AGR067W
          Length = 1132

 Score = 34.7 bits (78), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 44/174 (25%), Positives = 69/174 (39%), Gaps = 25/174 (14%)

Query: 22  QPSYKHGLLTGLSNGEIRLLDWATCKSLQNIKASETAINDLKVIDSDFSAGH--LVSSAS 79
            PS  H ++   S    + L W   ++  N    E   +   + D +F   H  L+++ S
Sbjct: 78  HPSKPHWVV---STSNQKALVWNLSRTSSNAIEYELHGHFRAITDINFHPSHPELLATCS 134

Query: 80  IDA-VKVFDIRTNSCIATIQNESNSPFLSL-DSRHGLLACGTELQGIDA-------AVHI 130
           ID  V  +D+R+             P+ S  D   G       LQ  +        +V I
Sbjct: 135 IDTYVHAWDMRS----------PQRPYYSTSDWSAGASQVKWNLQNANVLASSHANSVFI 184

Query: 131 YDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQDEEE 184
           +DIRK  TPL  L   ++  V  I F+    N ++S S DG    +D  +   E
Sbjct: 185 WDIRKGCTPLYKL-SGNNSSVNNIDFNKVKENEIMSSSNDGTVKFWDYSKSSTE 237

>Suva_4.53 Chr4 (95619..99434) [3816 bp, 1271 aa] {ON} YDL195W
           (REAL)
          Length = 1271

 Score = 34.7 bits (78), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 32/59 (54%)

Query: 125 DAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQDEE 183
           D ++ ++D+R  +TPL++L   H   +  + +   D N+LLS   D    +++ +  EE
Sbjct: 234 DPSILVWDLRNANTPLQTLSQGHQKGILSLDWCHQDENLLLSSGRDNTVLLWNPESAEE 292

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.413 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 42,605,790
Number of extensions: 1951147
Number of successful extensions: 7565
Number of sequences better than 10.0: 578
Number of HSP's gapped: 7534
Number of HSP's successfully gapped: 695
Length of query: 389
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 278
Effective length of database: 40,753,473
Effective search space: 11329465494
Effective search space used: 11329465494
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)