Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_14.2072.152ON61761729860.0
YNL121C (TOM70)2.152ON61761728180.0
Skud_14.2112.152ON61761727820.0
Suva_14.2192.152ON61761727620.0
Kpol_1048.212.152ON59754619410.0
ZYRO0G06512g2.152ON60454419030.0
SAKL0E10956g2.152ON60055318980.0
TDEL0B051402.152ON59954918980.0
KLTH0B05170g2.152ON59354618800.0
Kwal_33.147672.152ON59457118450.0
TPHA0I015102.152ON60355918280.0
NCAS0G024802.152ON59654118270.0
TBLA0C055302.152ON61054518110.0
Ecym_82042.152ON59756617600.0
ABR131W2.152ON59454417470.0
NDAI0F028102.152ON60955517390.0
KLLA0F24046g2.152ON60454417160.0
KNAG0H035302.152ON61457016760.0
NCAS0B070102.152ON62555916690.0
CAGL0L12936g2.152ON60054416640.0
KAFR0F007202.152ON60858016190.0
CAGL0L04048g2.152ON58756715650.0
Skud_8.1782.152ON63855614690.0
Smik_8.1952.152ON63555014550.0
YHR117W (TOM71)2.152ON63955514450.0
Suva_15.3142.152ON64455914430.0
NDAI0B043402.152ON66455713970.0
NCAS0G008105.617ON5841251511e-09
TBLA0E033005.617ON582851457e-09
KLTH0F14542g3.481ON5131031421e-08
AEL224W5.617ON580851422e-08
NDAI0B057903.481ON5231441412e-08
KLLA0A07062g5.617ON581861394e-08
ACR005W6.21ON3271291365e-08
Kpol_1032.86.21ON3431081356e-08
Kwal_55.199355.617ON593861377e-08
YOR027W (STI1)5.617ON589851368e-08
SAKL0G07084g5.617ON585851369e-08
Suva_8.805.617ON586851369e-08
CAGL0H08195g5.617ON583851361e-07
Skud_15.1925.617ON5891241341e-07
KNAG0B032005.617ON579851342e-07
Smik_15.2055.617ON589851323e-07
TPHA0D028805.617ON5851311323e-07
Ecym_30256.21ON3181251259e-07
NDAI0F009105.617ON583851271e-06
Kpol_1018.695.617ON590851261e-06
Kwal_55.211753.481ON5111031252e-06
Ecym_44133.481ON510951242e-06
SAKL0E01210g6.21ON3231151214e-06
TDEL0A048405.617ON576851216e-06
CAGL0D05060g3.481ON510951199e-06
NCAS0A112003.367ON9072591181e-05
KLTH0E02178g5.617ON593931162e-05
TPHA0J003406.21ON3381071152e-05
KNAG0A079003.481ON5121111153e-05
KLLA0D01155g6.21ON335681143e-05
KLLA0B09966g8.506ON3701531143e-05
Kpol_1006.43.367ON7321131153e-05
ZYRO0A05676g5.617ON572861135e-05
NDAI0I022406.21ON350881117e-05
KAFR0C058905.617ON575851127e-05
ZYRO0F08624g8.506ON3791811118e-05
TBLA0A072706.21ON3731031108e-05
Ecym_55825.617ON584851119e-05
TDEL0G044806.21ON3431151109e-05
Kpol_505.413.481ON5131051101e-04
Kwal_27.118908.506ON3341251081e-04
SAKL0F03102g3.481ON5131431092e-04
AAR083C3.481ON5381211082e-04
KAFR0L004106.21ON3311071072e-04
TBLA0C039503.481ON5121051082e-04
Kpol_1037.266.21ON3421151072e-04
KAFR0B066103.481ON511971072e-04
NCAS0H008306.21ON3381611053e-04
TDEL0E027505.352ON5641281064e-04
NDAI0D008106.21ON3491011044e-04
TPHA0D032203.481ON513951055e-04
KNAG0H006103.367ON9731321056e-04
NCAS0F034903.481ON512971047e-04
KLLA0B10912g3.481ON512971039e-04
KNAG0M011706.21ON3391011010.001
NDAI0A051003.367ON10071121030.001
Kpol_513.28.506ON374891010.001
KAFR0H008703.367ON887901020.001
Suva_7.4083.481ON5131011000.002
Ecym_20906.328ON17259950.002
CAGL0E02739g6.21ON34388980.002
Kwal_56.224336.21ON322108970.003
Kpol_1018.1067.412ON753168980.004
YBR155W (CNS1)8.506ON38579970.004
TBLA0H033808.506ON37579960.004
NCAS0A00490singletonON62086970.005
KNAG0B022407.412ON739184970.005
SAKL0B07986g3.367ON880131960.006
KAFR0C018505.352ON646163960.006
NDAI0E040407.412ON783231960.007
Smik_2.2958.506ON385126950.007
KLTH0F10428g3.367ON795119960.007
TDEL0B013108.506ON380122940.007
Smik_4.5795.352ON667162950.008
SAKL0H10934g8.506ON380117940.009
KLLA0B09262g3.367ON94190950.009
Suva_15.1826.21ON34698930.009
Ecym_34593.367ON1115113950.010
YGR123C (PPT1)3.481ON51395940.010
ZYRO0B04224g3.481ON51395940.010
KLTH0E11748g8.506ON37889930.012
TBLA0D004607.412ON835116930.014
Skud_2.2828.506ON38587920.014
Smik_6.2153.481ON51395920.014
TPHA0D038606.328ON12071860.014
CAGL0C01903g7.412ON769168930.015
Kwal_23.36703.367ON802113920.018
KNAG0F040107.546ON1418125920.020
KNAG0I025206.328ON11790840.024
TBLA0G010506.21ON35084890.028
KAFR0E029808.506ON38089890.034
KLTH0C11220g6.21ON32789880.037
KLTH0E10934g8.470ON56892890.038
TBLA0I023106.328ON11661830.039
CAGL0H07425g8.506ON38090880.040
Skud_15.1686.21ON34865880.043
NCAS0D026706.21ON351143870.048
TPHA0E011105.352ON693125880.054
SAKL0H11946g8.470ON57392880.055
Suva_4.4058.506ON38575870.059
YOR007C (SGT2)6.21ON34698870.060
TBLA0H015203.367ON689169870.076
AGL268C8.506ON37979860.078
NCAS0F028705.352ON700125860.082
KAFR0L018707.412ON712165860.094
NDAI0I004406.328ON12860800.099
TPHA0E007407.412ON746146860.11
YBR112C (CYC8)3.367ON966118860.11
NCAS0C043503.5ON1087186850.12
Skud_7.4323.481ON513101850.12
ZYRO0C07788g6.21ON334115840.12
Smik_15.1766.21ON34565840.13
NCAS0B024008.506ON38097840.14
Kwal_27.107407.412ON628122840.15
Kwal_27.117378.470ON57592830.18
YCR060W (TAH1)6.328ON11170770.19
SAKL0F16236g7.546ON140894830.20
Smik_2.2543.367ON1020118830.21
YDR320C (SWA2)5.352ON668111830.22
TDEL0C027207.412ON700140830.23
KNAG0C055005.352ON585125820.23
Ecym_25598.506ON37087820.24
YLR072W8.14ON69393820.29
KNAG0A039508.506ON38689810.29
YBL084C (CDC27)7.412ON758168820.30
Smik_2.367.412ON751168810.32
Suva_2.347.412ON763168810.40
KAFR0J025706.328ON12137750.42
TBLA0B049907.546ON1410131810.43
KLLA0E20857g7.412ON710254800.43
Suva_3.956.328ON11170750.44
Suva_8.1295.689ON74135800.47
KAFR0D023405.689ON69744800.48
TDEL0D055003.481ON51263780.74
Skud_2.247.412ON76977780.75
NDAI0C043205.352ON706175780.78
KAFR0B002507.546ON1420117780.79
SAKL0A01672g6.328ON12862730.80
Smik_12.1328.14ON69693780.82
ZYRO0B03828g7.412ON727120780.86
Ecym_71427.412ON67569770.95
NDAI0G037103.5ON112198780.96
AGL294W7.412ON65669771.0
ZYRO0G07700g4.9ON70446771.1
Kpol_1050.1127.546ON136058771.1
NCAS0E024907.412ON809147771.1
AAR054C6.328ON13361721.2
Skud_15.2455.689ON75035771.2
TBLA0H019705.352ON840121761.3
KLLA0C15455g8.470ON56692751.6
NDAI0C052908.506ON37990742.1
Kpol_1031.648.470ON60789742.1
CAGL0B01375g3.5ON1110182752.2
ACR168W2.665ON707144742.2
AFR453W8.470ON56992732.8
Ecym_56372.665ON71776733.2
Suva_2.4895.352ON659112733.3
Ecym_28207.546ON1398205733.4
TPHA0G002407.546ON1430131733.5
Ecym_51303.265ON88976733.5
KLTH0C06204g7.412ON627168723.7
Kpol_339.135.352ON686113723.8
TBLA0A091705.689ON72699724.5
Skud_2.2403.367ON98497724.5
CAGL0K09240g6.328ON14243684.5
TPHA0L014208.506ON374174714.9
CAGL0G10087g7.546ON141195715.3
Kpol_1028.516.328ON11763675.5
TPHA0L012108.470ON58878715.6
TDEL0D055703.489ON649126706.3
TDEL0B016608.470ON549104706.7
YOR080W (DIA2)5.689ON73235706.7
KNAG0K026303.5ON1076179716.8
Suva_16.5217.546ON142473707.7
AEL281C7.546ON139079708.4
YLR445W (GMC2)4.331ON18849679.0
NDAI0G048701.456ON39469699.6
Kwal_34.160921.456ON39581689.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_14.207
         (617 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {...  1154   0.0  
YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON} ...  1090   0.0  
Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {...  1076   0.0  
Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {...  1068   0.0  
Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {O...   752   0.0  
ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {...   737   0.0  
SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} simila...   735   0.0  
TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {O...   735   0.0  
KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} simila...   728   0.0  
Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {...   715   0.0  
TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {O...   708   0.0  
NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {O...   708   0.0  
TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa] ...   702   0.0  
Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}...   682   0.0  
ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic ho...   677   0.0  
NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.1...   674   0.0  
KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} simi...   665   0.0  
KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.1...   650   0.0  
NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON} Anc_2...   647   0.0  
CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON} sim...   645   0.0  
KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {O...   628   0.0  
CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} simil...   607   0.0  
Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W ...   570   0.0  
Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W ...   565   0.0  
YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}  TOM71Mitoc...   561   0.0  
Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117...   560   0.0  
NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON} Anc_2...   542   0.0  
NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {O...    63   1e-09
TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {O...    60   7e-09
KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]...    59   1e-08
AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic ho...    59   2e-08
NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa] ...    59   2e-08
KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {...    58   4e-08
ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic hom...    57   5e-08
Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON...    57   6e-08
Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027...    57   7e-08
YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90...    57   8e-08
SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly...    57   9e-08
Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W (...    57   9e-08
CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {...    57   1e-07
Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027...    56   1e-07
KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {O...    56   2e-07
Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027...    55   3e-07
TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.6...    55   3e-07
Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON} si...    53   9e-07
NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}     54   1e-06
Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON} (1971...    53   1e-06
Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {...    53   2e-06
Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}...    52   2e-06
SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}...    51   4e-06
TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.6...    51   6e-06
CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {...    50   9e-06
NCAS0A11200 Chr1 complement(2220419..2223142) [2724 bp, 907 aa] ...    50   1e-05
KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly...    49   2e-05
TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON...    49   2e-05
KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa] ...    49   3e-05
KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {...    49   3e-05
KLLA0B09966g Chr2 complement(872760..873872) [1113 bp, 370 aa] {...    49   3e-05
Kpol_1006.4 s1006 complement(17836..20034) [2199 bp, 732 aa] {ON...    49   3e-05
ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly...    48   5e-05
NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.2...    47   7e-05
KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON} Anc_5...    48   7e-05
ZYRO0F08624g Chr6 (691992..693131) [1140 bp, 379 aa] {ON} simila...    47   8e-05
TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa] ...    47   8e-05
Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {O...    47   9e-05
TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.2...    47   9e-05
Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}...    47   1e-04
Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155...    46   1e-04
SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly...    47   2e-04
AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON} S...    46   2e-04
KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}...    46   2e-04
TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {O...    46   2e-04
Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {O...    46   2e-04
KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON} Anc_3...    46   2e-04
NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {O...    45   3e-04
TDEL0E02750 Chr5 (529920..531614) [1695 bp, 564 aa] {ON} Anc_5.3...    45   4e-04
NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {O...    45   4e-04
TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {O...    45   5e-04
KNAG0H00610 Chr8 (99931..102852) [2922 bp, 973 aa] {ON} Anc_3.36...    45   6e-04
NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {O...    45   7e-04
KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} simila...    44   9e-04
KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {...    44   0.001
NDAI0A05100 Chr1 (1157935..1160958) [3024 bp, 1007 aa] {ON} Anc_...    44   0.001
Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)...    44   0.001
KAFR0H00870 Chr8 (162118..164781) [2664 bp, 887 aa] {ON} Anc_3.3...    44   0.001
Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON...    43   0.002
Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON} ...    41   0.002
CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {...    42   0.002
Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {O...    42   0.003
Kpol_1018.106 s1018 (280224..282485) [2262 bp, 753 aa] {ON} (280...    42   0.004
YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}  CNS1TPR-co...    42   0.004
TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.5...    42   0.004
NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON}       42   0.005
KNAG0B02240 Chr2 complement(434466..436685) [2220 bp, 739 aa] {O...    42   0.005
SAKL0B07986g Chr2 complement(675999..678641) [2643 bp, 880 aa] {...    42   0.006
KAFR0C01850 Chr3 (369596..371536) [1941 bp, 646 aa] {ON} Anc_5.3...    42   0.006
NDAI0E04040 Chr5 (900685..903036) [2352 bp, 783 aa] {ON} Anc_7.4...    42   0.007
Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W ...    41   0.007
KLTH0F10428g Chr6 (902697..905084) [2388 bp, 795 aa] {ON} highly...    42   0.007
TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {O...    41   0.007
Smik_4.579 Chr4 complement(1032558..1034561) [2004 bp, 667 aa] {...    41   0.008
SAKL0H10934g Chr8 complement(945834..946976) [1143 bp, 380 aa] {...    41   0.009
KLLA0B09262g Chr2 (814303..817128) [2826 bp, 941 aa] {ON} highly...    41   0.009
Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {...    40   0.009
Ecym_3459 Chr3 (864878..868225) [3348 bp, 1115 aa] {ON} similar ...    41   0.010
YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}  ...    41   0.010
ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly...    41   0.010
KLTH0E11748g Chr5 (1043203..1044339) [1137 bp, 378 aa] {ON} simi...    40   0.012
TBLA0D00460 Chr4 complement(113831..116338) [2508 bp, 835 aa] {O...    40   0.014
Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W ...    40   0.014
Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON...    40   0.014
TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.32...    38   0.014
CAGL0C01903g Chr3 complement(199487..201796) [2310 bp, 769 aa] {...    40   0.015
Kwal_23.3670 s23 (387536..389944) [2409 bp, 802 aa] {ON} YBR112C...    40   0.018
KNAG0F04010 Chr6 (757749..762005) [4257 bp, 1418 aa] {ON} Anc_7....    40   0.020
KNAG0I02520 Chr9 complement(487699..488052) [354 bp, 117 aa] {ON...    37   0.024
TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {O...    39   0.028
KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.5...    39   0.034
KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar...    39   0.037
KLTH0E10934g Chr5 (981831..983537) [1707 bp, 568 aa] {ON} simila...    39   0.038
TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.32...    37   0.039
CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly...    39   0.040
Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {...    39   0.043
NCAS0D02670 Chr4 complement(512529..513584) [1056 bp, 351 aa] {O...    38   0.048
TPHA0E01110 Chr5 (228116..230197) [2082 bp, 693 aa] {ON} Anc_5.3...    39   0.054
SAKL0H11946g Chr8 complement(1020512..1022233) [1722 bp, 573 aa]...    39   0.055
Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W ...    38   0.059
YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON} ...    38   0.060
TBLA0H01520 Chr8 (344716..346785) [2070 bp, 689 aa] {ON} Anc_3.3...    38   0.076
AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON} S...    38   0.078
NCAS0F02870 Chr6 complement(573068..575170) [2103 bp, 700 aa] {O...    38   0.082
KAFR0L01870 Chr12 (345757..347895) [2139 bp, 712 aa] {ON} Anc_7....    38   0.094
NDAI0I00440 Chr9 complement(89650..90036) [387 bp, 128 aa] {ON} ...    35   0.099
TPHA0E00740 Chr5 complement(142456..144696) [2241 bp, 746 aa] {O...    38   0.11 
YBR112C Chr2 complement(462870..465770) [2901 bp, 966 aa] {ON}  ...    38   0.11 
NCAS0C04350 Chr3 (891570..894833) [3264 bp, 1087 aa] {ON} Anc_3....    37   0.12 
Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON...    37   0.12 
ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} simila...    37   0.12 
Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {...    37   0.13 
NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {O...    37   0.14 
Kwal_27.10740 s27 complement(476617..478503) [1887 bp, 628 aa] {...    37   0.15 
Kwal_27.11737 s27 (926622..928349) [1728 bp, 575 aa] {ON} YDR244...    37   0.18 
YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Compone...    34   0.19 
SAKL0F16236g Chr6 (1313573..1317799) [4227 bp, 1408 aa] {ON} sim...    37   0.20 
Smik_2.254 Chr2 complement(447517..450579) [3063 bp, 1020 aa] {O...    37   0.21 
YDR320C Chr4 complement(1106095..1108101) [2007 bp, 668 aa] {ON}...    37   0.22 
TDEL0C02720 Chr3 (477529..479631) [2103 bp, 700 aa] {ON} Anc_7.4...    37   0.23 
KNAG0C05500 Chr3 (1069670..1071427) [1758 bp, 585 aa] {ON} Anc_5...    36   0.23 
Ecym_2559 Chr2 (1089202..1090314) [1113 bp, 370 aa] {ON} similar...    36   0.24 
YLR072W Chr12 (278862..280943) [2082 bp, 693 aa] {ON} Protein of...    36   0.29 
KNAG0A03950 Chr1 complement(529620..530780) [1161 bp, 386 aa] {O...    36   0.29 
YBL084C Chr2 complement(67169..69445) [2277 bp, 758 aa] {ON}  CD...    36   0.30 
Smik_2.36 Chr2 complement(61159..63414) [2256 bp, 751 aa] {ON} Y...    36   0.32 
Suva_2.34 Chr2 complement(63832..65304,65365..66183) [2292 bp, 7...    36   0.40 
KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.3...    33   0.42 
TBLA0B04990 Chr2 (1171599..1175831) [4233 bp, 1410 aa] {ON} Anc_...    36   0.43 
KLLA0E20857g Chr5 (1860517..1862649) [2133 bp, 710 aa] {ON} simi...    35   0.43 
Suva_3.95 Chr3 (137419..137754) [336 bp, 111 aa] {ON} YCR060W (R...    33   0.44 
Suva_8.129 Chr8 (231888..234113) [2226 bp, 741 aa] {ON} YOR080W ...    35   0.47 
KAFR0D02340 Chr4 complement(473431..475524) [2094 bp, 697 aa] {O...    35   0.48 
TDEL0D05500 Chr4 complement(991567..993105) [1539 bp, 512 aa] {O...    35   0.74 
Skud_2.24 Chr2 complement(50790..53099) [2310 bp, 769 aa] {ON} Y...    35   0.75 
NDAI0C04320 Chr3 complement(983914..986034) [2121 bp, 706 aa] {O...    35   0.78 
KAFR0B00250 Chr2 complement(58608..62870) [4263 bp, 1420 aa] {ON...    35   0.79 
SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {O...    33   0.80 
Smik_12.132 Chr12 (258696..260786) [2091 bp, 696 aa] {ON} YLR072...    35   0.82 
ZYRO0B03828g Chr2 (318153..320336) [2184 bp, 727 aa] {ON} simila...    35   0.86 
Ecym_7142 Chr7 complement(287110..289137) [2028 bp, 675 aa] {ON}...    34   0.95 
NDAI0G03710 Chr7 complement(894337..897702) [3366 bp, 1121 aa] {...    35   0.96 
AGL294W Chr7 (154711..156681) [1971 bp, 656 aa] {ON} Syntenic ho...    34   1.0  
ZYRO0G07700g Chr7 complement(609766..611880) [2115 bp, 704 aa] {...    34   1.1  
Kpol_1050.112 s1050 (249717..252797,252855..252863,252906..25389...    34   1.1  
NCAS0E02490 Chr5 complement(493779..496208) [2430 bp, 809 aa] {O...    34   1.1  
AAR054C Chr1 complement(440706..441107) [402 bp, 133 aa] {ON} Sy...    32   1.2  
Skud_15.245 Chr15 (431002..433254) [2253 bp, 750 aa] {ON} YOR080...    34   1.2  
TBLA0H01970 Chr8 (464239..466761) [2523 bp, 840 aa] {ON} Anc_5.3...    34   1.3  
KLLA0C15455g Chr3 (1341570..1343270) [1701 bp, 566 aa] {ON} simi...    33   1.6  
NDAI0C05290 Chr3 (1224979..1226118) [1140 bp, 379 aa] {ON} Anc_8...    33   2.1  
Kpol_1031.64 s1031 (161135..162958) [1824 bp, 607 aa] {ON} (1611...    33   2.1  
CAGL0B01375g Chr2 complement(123330..126662) [3333 bp, 1110 aa] ...    33   2.2  
ACR168W Chr3 (650615..652738) [2124 bp, 707 aa] {ON} Syntenic ho...    33   2.2  
AFR453W Chr6 (1251460..1253169) [1710 bp, 569 aa] {ON} Syntenic ...    33   2.8  
Ecym_5637 Chr5 (1288532..1290685) [2154 bp, 717 aa] {ON} similar...    33   3.2  
Suva_2.489 Chr2 complement(863483..865462) [1980 bp, 659 aa] {ON...    33   3.3  
Ecym_2820 Chr2 (1590180..1594376) [4197 bp, 1398 aa] {ON} simila...    33   3.4  
TPHA0G00240 Chr7 complement(37417..41709) [4293 bp, 1430 aa] {ON...    33   3.5  
Ecym_5130 Chr5 (275836..278505) [2670 bp, 889 aa] {ON} similar t...    33   3.5  
KLTH0C06204g Chr3 complement(538533..540416) [1884 bp, 627 aa] {...    32   3.7  
Kpol_339.13 s339 complement(21257..23317) [2061 bp, 686 aa] {ON}...    32   3.8  
TBLA0A09170 Chr1 complement(2276263..2278443) [2181 bp, 726 aa] ...    32   4.5  
Skud_2.240 Chr2 complement(431507..434461) [2955 bp, 984 aa] {ON...    32   4.5  
CAGL0K09240g Chr11 complement(914042..914470) [429 bp, 142 aa] {...    31   4.5  
TPHA0L01420 Chr12 (293980..295104) [1125 bp, 374 aa] {ON} Anc_8....    32   4.9  
CAGL0G10087g Chr7 (962823..967058) [4236 bp, 1411 aa] {ON} simil...    32   5.3  
Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {...    30   5.5  
TPHA0L01210 Chr12 (252106..253872) [1767 bp, 588 aa] {ON} Anc_8....    32   5.6  
TDEL0D05570 Chr4 complement(1005376..1007325) [1950 bp, 649 aa] ...    32   6.3  
TDEL0B01660 Chr2 complement(295823..297472) [1650 bp, 549 aa] {O...    32   6.7  
YOR080W Chr15 (474594..476792) [2199 bp, 732 aa] {ON}  DIA2Origi...    32   6.7  
KNAG0K02630 Chr11 (523259..526489) [3231 bp, 1076 aa] {ON} Anc_3...    32   6.8  
Suva_16.521 Chr16 (895057..899331) [4275 bp, 1424 aa] {ON} YPR18...    32   7.7  
AEL281C Chr5 complement(111535..115707) [4173 bp, 1390 aa] {ON} ...    32   8.4  
YLR445W Chr12 (1024189..1024572,1024655..1024837) [567 bp, 188 a...    30   9.0  
NDAI0G04870 Chr7 complement(1173964..1175148) [1185 bp, 394 aa] ...    31   9.6  
Kwal_34.16092 s34 complement(198730..199917) [1188 bp, 395 aa] {...    31   9.9  

>Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 1154 bits (2986), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 576/617 (93%), Positives = 576/617 (93%)

Query: 1   MKNFISKNKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGKKNTITKDDKKEVKGSQKKTK 60
           MKNFISKNK                             GKKNTITKDDKKEVKGSQKKTK
Sbjct: 1   MKNFISKNKTAILATIAATGTALGAYYYYSQLQQQQQQGKKNTITKDDKKEVKGSQKKTK 60

Query: 61  DGSESTAESNTPVYPVSSNGDPDFSNKANFTAEEKDRYALALKDKGNQFFRNKKYDDAIK 120
           DGSESTAESNTPVYPVSSNGDPDFSNKANFTAEEKDRYALALKDKGNQFFRNKKYDDAIK
Sbjct: 61  DGSESTAESNTPVYPVSSNGDPDFSNKANFTAEEKDRYALALKDKGNQFFRNKKYDDAIK 120

Query: 121 YYNWALELKDDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLG 180
           YYNWALELKDDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLG
Sbjct: 121 YYNWALELKDDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLG 180

Query: 181 NFADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMSKLKEKFGDIDTATATPTELSTQA 240
           NFADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMSKLKEKFGDIDTATATPTELSTQA
Sbjct: 181 NFADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMSKLKEKFGDIDTATATPTELSTQA 240

Query: 241 PKELKDKTENLPSITSMASFFGIFKPELTFANYDESNEADKDLMNGLTNLYKRSPESYDK 300
           PKELKDKTENLPSITSMASFFGIFKPELTFANYDESNEADKDLMNGLTNLYKRSPESYDK
Sbjct: 241 PKELKDKTENLPSITSMASFFGIFKPELTFANYDESNEADKDLMNGLTNLYKRSPESYDK 300

Query: 301 ADESFTKAVKLFDEQLXXXXXXXXXXXXLAISLEHTGIFKFLKNDPLGAHEDIKKAIELF 360
           ADESFTKAVKLFDEQL            LAISLEHTGIFKFLKNDPLGAHEDIKKAIELF
Sbjct: 301 ADESFTKAVKLFDEQLDKNNEDEKSKEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIELF 360

Query: 361 PRVNSYIYMALIMADRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDF 420
           PRVNSYIYMALIMADRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDF
Sbjct: 361 PRVNSYIYMALIMADRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDF 420

Query: 421 DKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKND 480
           DKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKND
Sbjct: 421 DKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKND 480

Query: 481 FEKALKQYDLAIELENKLDGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEEASKLDPR 540
           FEKALKQYDLAIELENKLDGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEEASKLDPR
Sbjct: 481 FEKALKQYDLAIELENKLDGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEEASKLDPR 540

Query: 541 SEQAKIGLAQMKLQQEDIDEAITLFEESADLARTMEEKLQAITFAEAAKVQKRIRSDPIL 600
           SEQAKIGLAQMKLQQEDIDEAITLFEESADLARTMEEKLQAITFAEAAKVQKRIRSDPIL
Sbjct: 541 SEQAKIGLAQMKLQQEDIDEAITLFEESADLARTMEEKLQAITFAEAAKVQKRIRSDPIL 600

Query: 601 AAKIQETLAKLREQGLM 617
           AAKIQETLAKLREQGLM
Sbjct: 601 AAKIQETLAKLREQGLM 617

>YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON}
           TOM70Component of the TOM (translocase of outer
           membrane) complex responsible for recognition and
           initial import steps for all mitochondrially directed
           proteins; acts as a receptor for incoming precursor
           proteins
          Length = 617

 Score = 1090 bits (2818), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 540/617 (87%), Positives = 561/617 (90%)

Query: 1   MKNFISKNKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGKKNTITKDDKKEVKGSQKKTK 60
           MK+FI++NK                             GKKNTI KD+KK+ K SQK+T+
Sbjct: 1   MKSFITRNKTAILATVAATGTAIGAYYYYNQLQQQQQRGKKNTINKDEKKDTKDSQKETE 60

Query: 61  DGSESTAESNTPVYPVSSNGDPDFSNKANFTAEEKDRYALALKDKGNQFFRNKKYDDAIK 120
              +STA SN P+YPVSSNG+PDFSNKANFTAEEKD+YALALKDKGNQFFRNKKYDDAIK
Sbjct: 61  GAKKSTAPSNPPIYPVSSNGEPDFSNKANFTAEEKDKYALALKDKGNQFFRNKKYDDAIK 120

Query: 121 YYNWALELKDDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLG 180
           YYNWALELK+DPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLG
Sbjct: 121 YYNWALELKEDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLG 180

Query: 181 NFADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMSKLKEKFGDIDTATATPTELSTQA 240
            FADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMSKLKEKFGDIDTATATPTELSTQ 
Sbjct: 181 KFADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMSKLKEKFGDIDTATATPTELSTQP 240

Query: 241 PKELKDKTENLPSITSMASFFGIFKPELTFANYDESNEADKDLMNGLTNLYKRSPESYDK 300
            KE KDK ENLPS+TSMASFFGIFKPELTFANYDESNEADK+LMNGL+NLYKRSPESYDK
Sbjct: 241 AKERKDKQENLPSVTSMASFFGIFKPELTFANYDESNEADKELMNGLSNLYKRSPESYDK 300

Query: 301 ADESFTKAVKLFDEQLXXXXXXXXXXXXLAISLEHTGIFKFLKNDPLGAHEDIKKAIELF 360
           ADESFTKA +LF+EQL            LAISLEHTGIFKFLKNDPLGAHEDIKKAIELF
Sbjct: 301 ADESFTKAARLFEEQLDKNNEDEKLKEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIELF 360

Query: 361 PRVNSYIYMALIMADRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDF 420
           PRVNSYIYMALIMADRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDF
Sbjct: 361 PRVNSYIYMALIMADRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDF 420

Query: 421 DKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKND 480
           DKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKND
Sbjct: 421 DKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKND 480

Query: 481 FEKALKQYDLAIELENKLDGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEEASKLDPR 540
           F+KALKQYDLAIELENKLDGIYVGIAPLVGKATLLTRNPTVENFIEATNLLE+ASKLDPR
Sbjct: 481 FDKALKQYDLAIELENKLDGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEKASKLDPR 540

Query: 541 SEQAKIGLAQMKLQQEDIDEAITLFEESADLARTMEEKLQAITFAEAAKVQKRIRSDPIL 600
           SEQAKIGLAQMKLQQEDIDEAITLFEESADLARTMEEKLQAITFAEAAKVQ+RIRSDP+L
Sbjct: 541 SEQAKIGLAQMKLQQEDIDEAITLFEESADLARTMEEKLQAITFAEAAKVQQRIRSDPVL 600

Query: 601 AAKIQETLAKLREQGLM 617
           A KIQETLAKLREQGLM
Sbjct: 601 AKKIQETLAKLREQGLM 617

>Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 1076 bits (2782), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 532/617 (86%), Positives = 558/617 (90%)

Query: 1   MKNFISKNKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGKKNTITKDDKKEVKGSQKKTK 60
           MK+FISKNK                             GKK+TITKD+KK+VKGSQKK +
Sbjct: 1   MKSFISKNKTAILATIGATGAAVGAYYYYTQLQQQQQRGKKDTITKDEKKDVKGSQKKAE 60

Query: 61  DGSESTAESNTPVYPVSSNGDPDFSNKANFTAEEKDRYALALKDKGNQFFRNKKYDDAIK 120
              ++ +ES  PVYPVSSNG+PDFS KANFTAEEKD+YALALKDKGNQ+FRNKKYDDAIK
Sbjct: 61  GSKKTASESKAPVYPVSSNGEPDFSKKANFTAEEKDKYALALKDKGNQYFRNKKYDDAIK 120

Query: 121 YYNWALELKDDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLG 180
           YYNWALELK+DPVFYSNLSACYVSVGDLKKVVEMSTKALE+KPDYSKVLLRRASANEGLG
Sbjct: 121 YYNWALELKEDPVFYSNLSACYVSVGDLKKVVEMSTKALEIKPDYSKVLLRRASANEGLG 180

Query: 181 NFADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMSKLKEKFGDIDTATATPTELSTQA 240
           NFADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMS+LKEKFGD+D ATATPTELSTQ 
Sbjct: 181 NFADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMSRLKEKFGDVDAATATPTELSTQP 240

Query: 241 PKELKDKTENLPSITSMASFFGIFKPELTFANYDESNEADKDLMNGLTNLYKRSPESYDK 300
           PKE KDK ENLPSITSMASFFGIFKPELTFANYDE N+ADK+LM+GL NLYKRSPESYD+
Sbjct: 241 PKERKDKQENLPSITSMASFFGIFKPELTFANYDEFNKADKELMDGLANLYKRSPESYDR 300

Query: 301 ADESFTKAVKLFDEQLXXXXXXXXXXXXLAISLEHTGIFKFLKNDPLGAHEDIKKAIELF 360
           ADESFTKA KLF+EQL            LAISLEHTGIFKFLKNDPLGAHEDIKKAIELF
Sbjct: 301 ADESFTKAAKLFEEQLDKSNEDEKLKEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIELF 360

Query: 361 PRVNSYIYMALIMADRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDF 420
           PRVNSYIYMALIMADRNDSTEYYNYFDKALKL+ NNSSVYYHRGQMNFILQNYDQAGKDF
Sbjct: 361 PRVNSYIYMALIMADRNDSTEYYNYFDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDF 420

Query: 421 DKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKND 480
           DKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKND
Sbjct: 421 DKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKND 480

Query: 481 FEKALKQYDLAIELENKLDGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEEASKLDPR 540
           F+KALKQYDLAIELENKLD IYVGIAPLVGKATLLTRNPTVENF+EATNLLE+ASKLDPR
Sbjct: 481 FDKALKQYDLAIELENKLDRIYVGIAPLVGKATLLTRNPTVENFVEATNLLEKASKLDPR 540

Query: 541 SEQAKIGLAQMKLQQEDIDEAITLFEESADLARTMEEKLQAITFAEAAKVQKRIRSDPIL 600
           SEQAKIGLAQMKLQQEDIDEAI LFEESADLARTMEEKLQAITFAEAAKVQ++IRSDPIL
Sbjct: 541 SEQAKIGLAQMKLQQEDIDEAIMLFEESADLARTMEEKLQAITFAEAAKVQQKIRSDPIL 600

Query: 601 AAKIQETLAKLREQGLM 617
           AAKIQETLAKLREQGLM
Sbjct: 601 AAKIQETLAKLREQGLM 617

>Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 1068 bits (2762), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 526/617 (85%), Positives = 556/617 (90%)

Query: 1   MKNFISKNKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGKKNTITKDDKKEVKGSQKKTK 60
           MK+FISKNK                             GKK T+++D+KKE KGSQKK++
Sbjct: 1   MKSFISKNKTAILATIAATGTAVGAYYYYTQLQQQQQQGKKETLSRDEKKEAKGSQKKSE 60

Query: 61  DGSESTAESNTPVYPVSSNGDPDFSNKANFTAEEKDRYALALKDKGNQFFRNKKYDDAIK 120
              +S  ES  P+YPV++NG+PDFS KA+FTAEEKD+YALALKDKGNQ+FRNKKYDDAIK
Sbjct: 61  GSKKSAGESKPPIYPVAANGEPDFSKKADFTAEEKDKYALALKDKGNQYFRNKKYDDAIK 120

Query: 121 YYNWALELKDDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLG 180
           YYNWALELK+DPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLG
Sbjct: 121 YYNWALELKEDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLG 180

Query: 181 NFADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMSKLKEKFGDIDTATATPTELSTQA 240
           NFADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMS+LKEKFGDID ATATPTELSTQ 
Sbjct: 181 NFADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMSRLKEKFGDIDAATATPTELSTQP 240

Query: 241 PKELKDKTENLPSITSMASFFGIFKPELTFANYDESNEADKDLMNGLTNLYKRSPESYDK 300
           PKE KDK E+LPS+TSMASFFGIFKPELTFAN DESNEADK+LMNGL NLYKRSP+SYD+
Sbjct: 241 PKERKDKQESLPSVTSMASFFGIFKPELTFANCDESNEADKELMNGLANLYKRSPDSYDR 300

Query: 301 ADESFTKAVKLFDEQLXXXXXXXXXXXXLAISLEHTGIFKFLKNDPLGAHEDIKKAIELF 360
           ADESFTKAVKLF++QL            LAISLEHTGIFKFLKNDPLGAHEDI KAI+LF
Sbjct: 301 ADESFTKAVKLFEDQLDKDNEDEKVKEKLAISLEHTGIFKFLKNDPLGAHEDITKAIDLF 360

Query: 361 PRVNSYIYMALIMADRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDF 420
           PRVNSYIYMALIMADRNDSTEYYNYFDKALKLD NNSSVYYHRGQMNFILQNYDQAGKDF
Sbjct: 361 PRVNSYIYMALIMADRNDSTEYYNYFDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDF 420

Query: 421 DKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKND 480
           DKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKND
Sbjct: 421 DKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKND 480

Query: 481 FEKALKQYDLAIELENKLDGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEEASKLDPR 540
           F+KALKQYDLAIELENKL+GIYVGIAPLVGKATLLTRNPTVENFIEATNLLE+ASKLDPR
Sbjct: 481 FDKALKQYDLAIELENKLEGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEKASKLDPR 540

Query: 541 SEQAKIGLAQMKLQQEDIDEAITLFEESADLARTMEEKLQAITFAEAAKVQKRIRSDPIL 600
           SEQAKIGLAQMKLQQEDIDEAI LFEESADLARTMEEKLQAITFAEAAKVQ+RIRSDP+L
Sbjct: 541 SEQAKIGLAQMKLQQEDIDEAIALFEESADLARTMEEKLQAITFAEAAKVQQRIRSDPVL 600

Query: 601 AAKIQETLAKLREQGLM 617
           A KIQETLAKLREQGLM
Sbjct: 601 ATKIQETLAKLREQGLM 617

>Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {ON}
           complement(67975..69768) [1794 nt, 598 aa]
          Length = 597

 Score =  752 bits (1941), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/546 (67%), Positives = 435/546 (79%), Gaps = 20/546 (3%)

Query: 72  PVYPVSSNGDPDFSNKANFTAEEKDRYALALKDKGNQFFRNKKYDDAIKYYNWALELKDD 131
           P YP+ SNG+PD  + ANFT E+K+ Y++ALKDKGNQFF+ +KY+DA+KYYN+AL+LK D
Sbjct: 72  PCYPIDSNGEPDLKDSANFTEEQKETYSVALKDKGNQFFKEQKYEDALKYYNYALDLKQD 131

Query: 132 PVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDLSV 191
           PVFYSN+SACYVS+G+L+KVVE STKALELKPDYSK LLRRASANE L NFA+AMFDLSV
Sbjct: 132 PVFYSNISACYVSLGNLEKVVESSTKALELKPDYSKALLRRASANENLENFAEAMFDLSV 191

Query: 192 LSLNGDFNDASIEPMLERNLNKQAMSKLKEKFGDIDTATATPTELSTQAPKELKDKTENL 251
           LSLNGDFN+ASIEPMLERNLNKQAM  LK+K                       D  + L
Sbjct: 192 LSLNGDFNEASIEPMLERNLNKQAMRVLKDKMS--------------------SDAKQQL 231

Query: 252 PSITSMASFFGIFKPELTFANYDESNEADKDLMNGLTNLYKRSPESYDKADESFTKAVKL 311
           PS T +ASFFGIF PE T  N+DESNEAD +L+N L NLYKR  ESY  ADESF+KA + 
Sbjct: 232 PSNTFLASFFGIFTPETTLKNFDESNEADVELLNALVNLYKRKSESYLIADESFSKAAES 291

Query: 312 FDEQLXXXXXXXXXXXXLAISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRVNSYIYMAL 371
           + +QL             A +LE+ GIFKFLKNDPLG+HEDI+++IEL PRVN+YIY AL
Sbjct: 292 YVKQLEANPDDEVLKEKTATALEYNGIFKFLKNDPLGSHEDIQRSIELHPRVNAYIYSAL 351

Query: 372 IMADRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENI 431
           IMAD+ +S  Y+++FDKAL +D N++ VYYHRGQM+F+ Q Y++A  DF+KAKE D  NI
Sbjct: 352 IMADKGESKNYFDFFDKALDVDPNSAPVYYHRGQMHFLSQQYEKAAADFEKAKESDSSNI 411

Query: 432 FPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFEKALKQYDLA 491
           FPYIQLACL Y E KFDDCETLFSEAKRKFP APEVPNF+AE+LTDK DF+ A KQYD+A
Sbjct: 412 FPYIQLACLTYHEGKFDDCETLFSEAKRKFPTAPEVPNFYAEVLTDKGDFDAASKQYDIA 471

Query: 492 IELENKLDGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEEASKLDPRSEQAKIGLAQM 551
             LE  LD I+VG++PLVGKATLL R PTVEN +E+T LLEEA K+D RSEQAKIGLAQ+
Sbjct: 472 KRLEESLDAIHVGVSPLVGKATLLARQPTVENLLESTTLLEEACKMDSRSEQAKIGLAQL 531

Query: 552 KLQQEDIDEAITLFEESADLARTMEEKLQAITFAEAAKVQKRIRSDPILAAKIQETLAKL 611
           KLQQE+IDEAITLFEE++DLAR MEEKLQA TFAEA+KVQK+IR+DP++ AKIQ TLA  
Sbjct: 532 KLQQEEIDEAITLFEEASDLARNMEEKLQATTFAEASKVQKKIRADPVVNAKIQATLAAY 591

Query: 612 REQGLM 617
           REQGL+
Sbjct: 592 REQGLI 597

>ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121C TOM70 Translocase of Outer Mitochondrial
           membrane 70 kDa mitochondrial specialized import
           receptor of the outer membrane
          Length = 604

 Score =  737 bits (1903), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/544 (66%), Positives = 428/544 (78%), Gaps = 20/544 (3%)

Query: 74  YPVSSNGDPDFSNKANFTAEEKDRYALALKDKGNQFFRNKKYDDAIKYYNWALELKDDPV 133
           YPV   G+P   N A  + E+K+ ++ ALKDKGN+FF+ K YD+A+KYY++AL LK DPV
Sbjct: 81  YPVDEKGEPKLDNVAEMSEEQKESWSTALKDKGNEFFKQKDYDNALKYYDYALTLKKDPV 140

Query: 134 FYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDLSVLS 193
           FYSN+SACYVS+  L KVVE STKALELKPDYSK LLRRASANE L N+ DAMFDLSVLS
Sbjct: 141 FYSNISACYVSMNQLDKVVENSTKALELKPDYSKALLRRASANESLENYPDAMFDLSVLS 200

Query: 194 LNGDFNDASIEPMLERNLNKQAMSKLKEKFGDIDTATATPTELSTQAPKELKDKTENLPS 253
           LNGDF  +SIEPMLERNLNKQAM+ LK+K G                    + K + LPS
Sbjct: 201 LNGDFGGSSIEPMLERNLNKQAMTVLKDKLG--------------------QQKNQLLPS 240

Query: 254 ITSMASFFGIFKPELTFANYDESNEADKDLMNGLTNLYKRSPESYDKADESFTKAVKLFD 313
            T++ASFFGIF PE  FANYDE++EAD+ L  GL NLYKRS E Y KADE F++AV  + 
Sbjct: 241 DTALASFFGIFTPETEFANYDETSEADQKLKAGLENLYKRSSEGYQKADEFFSQAVDAYA 300

Query: 314 EQLXXXXXXXXXXXXLAISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRVNSYIYMALIM 373
           +               AI+LEH GIF+FLKNDPLGAHED++KAI+L PRVNSYIYMALIM
Sbjct: 301 KLREGNSDDAALKEKDAIALEHRGIFRFLKNDPLGAHEDVQKAIDLHPRVNSYIYMALIM 360

Query: 374 ADRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFP 433
           AD+  + EYY +FDKA+KLD  N++VYYHRGQM FI   Y++AG+DFDKAK+L+ ENIFP
Sbjct: 361 ADKGKAEEYYEFFDKAIKLDPKNAAVYYHRGQMYFITAQYEKAGQDFDKAKQLNEENIFP 420

Query: 434 YIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFEKALKQYDLAIE 493
           YIQLACLAYRENKFDDCETLFSEAKRKF  APEVPNFFAEIL DK D EKALKQYD+A  
Sbjct: 421 YIQLACLAYRENKFDDCETLFSEAKRKFATAPEVPNFFAEILADKGDLEKALKQYDIAKR 480

Query: 494 LENKLDGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEEASKLDPRSEQAKIGLAQMKL 553
           LE  +DGI+VGI+PLVGKATLL R P+VENFIEAT LLEEA   DPRSEQ K+GLAQ+KL
Sbjct: 481 LEEAVDGIHVGISPLVGKATLLARQPSVENFIEATKLLEEACAKDPRSEQGKVGLAQLKL 540

Query: 554 QQEDIDEAITLFEESADLARTMEEKLQAITFAEAAKVQKRIRSDPILAAKIQETLAKLRE 613
           QQEDID+AI LFEE+A LART++EKLQA TFAEAAKVQKRIR+DP+++AKI+ETLA  + 
Sbjct: 541 QQEDIDDAIKLFEEAASLARTVDEKLQATTFAEAAKVQKRIRADPLVSAKIEETLAAYKA 600

Query: 614 QGLM 617
           QG++
Sbjct: 601 QGVI 604

>SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 600

 Score =  735 bits (1898), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/553 (66%), Positives = 430/553 (77%), Gaps = 20/553 (3%)

Query: 65  STAESNTPVYPVSSNGDPDFSNKANFTAEEKDRYALALKDKGNQFFRNKKYDDAIKYYNW 124
           ++       YPV  NG+P   +    T E+K++YA+ LKDKGN+FF+ KK+DDAIKYYN 
Sbjct: 68  TSGSPTASAYPVDENGEPKLDDIDQLTDEQKEKYAMGLKDKGNEFFKEKKFDDAIKYYNL 127

Query: 125 ALELKDDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFAD 184
           ALELK DPVFYSN SACYVS+G L+KVVE +T AL+LK DYSK LLRRASANE LGN+AD
Sbjct: 128 ALELKKDPVFYSNRSACYVSMGQLEKVVEDTTAALKLKSDYSKCLLRRASANESLGNYAD 187

Query: 185 AMFDLSVLSLNGDFNDASIEPMLERNLNKQAMSKLKEKFGDIDTATATPTELSTQAPKEL 244
           AMFDLS LSL GDFN ASIEPMLERN+NKQAM  LKEK                   +E 
Sbjct: 188 AMFDLSALSLYGDFNGASIEPMLERNMNKQAMLVLKEKL------------------EEK 229

Query: 245 KDKTENLPSITSMASFFGIFKPELTFANYDESNEADKDLMNGLTNLYKRSPESYDKADES 304
           KD    LPS TS+ASFFGIF+PE +F NYDES EAD+ L+ GLTNLYKR+ E YD ADES
Sbjct: 230 KD--HRLPSNTSLASFFGIFEPETSFENYDESVEADRLLLQGLTNLYKRTSEGYDTADES 287

Query: 305 FTKAVKLFDEQLXXXXXXXXXXXXLAISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRVN 364
           FTKA   +   L             AI+LEH GIFKFLKNDPL AH+D+K+A+E  PRVN
Sbjct: 288 FTKAAAAYKTLLEESPENEILKQKAAIALEHVGIFKFLKNDPLSAHDDLKQALEYHPRVN 347

Query: 365 SYIYMALIMADRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAK 424
           SYIY+ALIMAD+  +TEY+  FDKAL+LD N ++VYYHRGQM FI Q Y+ AGKDFDKAK
Sbjct: 348 SYIYLALIMADKGQATEYFENFDKALELDPNCAAVYYHRGQMYFITQQYENAGKDFDKAK 407

Query: 425 ELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFEKA 484
           E +  NIFPYIQLACLAYRENKF+DCETLFSEA+RKFP APEVPNF+AEIL+DK D   A
Sbjct: 408 ECNENNIFPYIQLACLAYRENKFEDCETLFSEARRKFPTAPEVPNFYAEILSDKGDLANA 467

Query: 485 LKQYDLAIELENKLDGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEEASKLDPRSEQA 544
            KQY++A +LE+ LDGI+VGIAPLVGKATLL R PTVENF+EAT   EEA + DPRSEQA
Sbjct: 468 KKQYEIARKLEDALDGIHVGIAPLVGKATLLAREPTVENFVEATQNFEEACEKDPRSEQA 527

Query: 545 KIGLAQMKLQQEDIDEAITLFEESADLARTMEEKLQAITFAEAAKVQKRIRSDPILAAKI 604
           KIGLAQ+KLQQE++DEAITLFEE+ADLAR+ +EKLQA TFAEA K+QK+IR+DPI++AKI
Sbjct: 528 KIGLAQLKLQQEEVDEAITLFEEAADLARSFDEKLQATTFAEATKIQKKIRADPIISAKI 587

Query: 605 QETLAKLREQGLM 617
           +ETLA  R QG++
Sbjct: 588 EETLAAYRAQGMI 600

>TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {ON}
           Anc_2.152 YHR117W
          Length = 599

 Score =  735 bits (1898), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/549 (66%), Positives = 427/549 (77%), Gaps = 20/549 (3%)

Query: 69  SNTPVYPVSSNGDPDFSNKANFTAEEKDRYALALKDKGNQFFRNKKYDDAIKYYNWALEL 128
             TPVYPV  NG+P   N    + E ++ YA ALKD+GN+FF+ K YD+A+KYYN+AL +
Sbjct: 71  GGTPVYPVGQNGEPLLENIEELSQELRETYATALKDRGNEFFKKKDYDNALKYYNYALVV 130

Query: 129 KDDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFD 188
           K DPVFYSN+SACYVS+G L KVVE STKALELKPDYSK LLRRASANE L N+ADAMFD
Sbjct: 131 KKDPVFYSNISACYVSLGQLDKVVENSTKALELKPDYSKALLRRASANESLENYADAMFD 190

Query: 189 LSVLSLNGDFNDASIEPMLERNLNKQAMSKLKEKFGDIDTATATPTELSTQAPKELKDKT 248
           LSVLSLNGDFN +SIEPMLERNLNKQAM  LK+K G+                    + +
Sbjct: 191 LSVLSLNGDFNGSSIEPMLERNLNKQAMFVLKDKLGN--------------------NVS 230

Query: 249 ENLPSITSMASFFGIFKPELTFANYDESNEADKDLMNGLTNLYKRSPESYDKADESFTKA 308
           + LPS T++ASFFGIF PE TFANY+E++EAD  L NGL +LYKRS E Y  ADE+F K+
Sbjct: 231 QQLPSNTALASFFGIFPPETTFANYNENDEADVGLKNGLEDLYKRSSEGYKLADEAFVKS 290

Query: 309 VKLFDEQLXXXXXXXXXXXXLAISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRVNSYIY 368
              F  +L             AI+LEH GIFKFLKNDPL AH+DI+KAI+L PR+NSYIY
Sbjct: 291 ASFFTNKLSEFPDDAVLKEKTAIALEHNGIFKFLKNDPLEAHDDIEKAIQLHPRLNSYIY 350

Query: 369 MALIMADRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDP 428
           MALIMAD+  + EYY YFDKA+ LD N    YYHRGQM +I   Y++AGKDFDKAKE D 
Sbjct: 351 MALIMADKGQAEEYYQYFDKAIALDPNYGPAYYHRGQMYYITGQYEKAGKDFDKAKECDE 410

Query: 429 ENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFEKALKQY 488
            NIFPYIQLACLAYRE+KFDDCETLFSEAKRKFP APEVPNF+AEIL DK D E ALKQY
Sbjct: 411 NNIFPYIQLACLAYREDKFDDCETLFSEAKRKFPTAPEVPNFYAEILGDKGDLEAALKQY 470

Query: 489 DLAIELENKLDGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEEASKLDPRSEQAKIGL 548
           ++A  LE  LDGI+VG+APLVGKATLL R P+VENF EAT LLEEA + DP SEQAK+GL
Sbjct: 471 EIAKRLEEALDGIHVGVAPLVGKATLLARQPSVENFREATLLLEEACRRDPTSEQAKVGL 530

Query: 549 AQMKLQQEDIDEAITLFEESADLARTMEEKLQAITFAEAAKVQKRIRSDPILAAKIQETL 608
           AQ+KLQQE++DEAI LFEE+A+LART++EKLQA TFAEAAKVQKRI++DP+++AKI+ETL
Sbjct: 531 AQLKLQQEEVDEAINLFEEAANLARTVDEKLQATTFAEAAKVQKRIKADPVVSAKIEETL 590

Query: 609 AKLREQGLM 617
           A  R QG+M
Sbjct: 591 AAYRAQGMM 599

>KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 593

 Score =  728 bits (1880), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/546 (64%), Positives = 431/546 (78%), Gaps = 20/546 (3%)

Query: 72  PVYPVSSNGDPDFSNKANFTAEEKDRYALALKDKGNQFFRNKKYDDAIKYYNWALELKDD 131
           P YPV+  G+PD SN A  + E+KD+YA+ LKDKGN+FF+NKKYD+AI+YY+WA+E+K+D
Sbjct: 68  PSYPVNEKGEPDLSNLAELSDEQKDKYAMGLKDKGNEFFKNKKYDEAIQYYSWAIEVKED 127

Query: 132 PVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDLSV 191
           PVFYSN SACYVS+G  +KVVE +T AL+LKPDYSK LLRRASANE LGNFADAMFDLS 
Sbjct: 128 PVFYSNRSACYVSLGQQEKVVEDTTAALKLKPDYSKCLLRRASANESLGNFADAMFDLSA 187

Query: 192 LSLNGDFNDASIEPMLERNLNKQAMSKLKEKFGDIDTATATPTELSTQAPKELKDKTENL 251
           +SL GDF+ ASIEP+LERN+NKQ+M  LKEK                      K +   L
Sbjct: 188 VSLYGDFSGASIEPLLERNMNKQSMLVLKEKLE--------------------KQQEYKL 227

Query: 252 PSITSMASFFGIFKPELTFANYDESNEADKDLMNGLTNLYKRSPESYDKADESFTKAVKL 311
           PS TS+ASFFGIF+PE TF NYD+++EADK L+ GLTNLYKR+ + Y+ AD SF KA   
Sbjct: 228 PSNTSLASFFGIFQPETTFENYDDNSEADKYLLEGLTNLYKRTADGYETADLSFAKARDA 287

Query: 312 FDEQLXXXXXXXXXXXXLAISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRVNSYIYMAL 371
           F   L             AI+LEH GIFKFLKNDP+ AHED+KKA+E FPR N+YIYMAL
Sbjct: 288 FKVLLEQNPEDADLKRKAAIALEHVGIFKFLKNDPISAHEDLKKAVEYFPRPNTYIYMAL 347

Query: 372 IMADRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENI 431
           IMAD+  +TEY++ F+KALKLD + ++VYYHRGQM FI Q ++QAGKDF+KAKEL   NI
Sbjct: 348 IMADKGQATEYFDNFEKALKLDPSCAAVYYHRGQMYFITQQFEQAGKDFEKAKELSESNI 407

Query: 432 FPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFEKALKQYDLA 491
           FPYIQLACL YRE KFDD ETLFSEA+RKFP APEVPNF+AE L+DK D   A KQYD+A
Sbjct: 408 FPYIQLACLTYREGKFDDSETLFSEARRKFPTAPEVPNFYAETLSDKGDLAGARKQYDIA 467

Query: 492 IELENKLDGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEEASKLDPRSEQAKIGLAQM 551
            +LE+ LDGI+VG++PL+GKATLL+R P+VENF+EAT L E+A + DPRSEQAKIGLAQ+
Sbjct: 468 AKLEDALDGIHVGVSPLIGKATLLSREPSVENFVEATQLFEKACQNDPRSEQAKIGLAQL 527

Query: 552 KLQQEDIDEAITLFEESADLARTMEEKLQAITFAEAAKVQKRIRSDPILAAKIQETLAKL 611
           KLQQEDIDEAI LFEE+ADLAR+ +EKLQA TFAEA K+QK+IR+DP+++AKI+ETLA  
Sbjct: 528 KLQQEDIDEAIALFEEAADLARSFDEKLQATTFAEATKIQKKIRADPVVSAKIEETLAAY 587

Query: 612 REQGLM 617
           R QG++
Sbjct: 588 RAQGMI 593

>Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {ON}
           YHR117W (TOM71) - 71-kDa component of the protein
           translocase of the outer membrane of mitochondria
           [contig 101] FULL
          Length = 594

 Score =  715 bits (1845), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/571 (61%), Positives = 439/571 (76%), Gaps = 20/571 (3%)

Query: 47  DDKKEVKGSQKKTKDGSESTAESNTPVYPVSSNGDPDFSNKANFTAEEKDRYALALKDKG 106
           +D KEV    K +K   +   ++  P +PV   G+PD       +AEEKD++A+ LKDKG
Sbjct: 44  EDGKEVGDEPKPSKKKKKGKKKTQGPSFPVDEKGEPDLGKVDELSAEEKDKFAMGLKDKG 103

Query: 107 NQFFRNKKYDDAIKYYNWALELKDDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYS 166
           N+FF+NK+++DA+KYY+ A+E+K+DPVFYSN SACYVS+G  +KVVE +T AL+LKPDYS
Sbjct: 104 NEFFKNKQFEDALKYYSLAIEVKEDPVFYSNRSACYVSLGQQEKVVEDTTAALKLKPDYS 163

Query: 167 KVLLRRASANEGLGNFADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMSKLKEKFGDI 226
           K LLRRASANE LG FADAMFDLS +SL GDFN +SIEP+LERN+NKQAM  LKEK    
Sbjct: 164 KCLLRRASANESLGKFADAMFDLSAVSLYGDFNGSSIEPLLERNMNKQAMLVLKEKLE-- 221

Query: 227 DTATATPTELSTQAPKELKDKTENLPSITSMASFFGIFKPELTFANYDESNEADKDLMNG 286
                             K +   LPS TS+ASFFGIF+PE +F NYDE++EADK L++G
Sbjct: 222 ------------------KQQEYKLPSNTSLASFFGIFQPETSFENYDENSEADKALLDG 263

Query: 287 LTNLYKRSPESYDKADESFTKAVKLFDEQLXXXXXXXXXXXXLAISLEHTGIFKFLKNDP 346
           LTNLYKR+   Y+ AD +F+KA   +   L             AI+LEH GIFKFLKNDP
Sbjct: 264 LTNLYKRTSGGYEAADAAFSKARDEYKTLLEHNSEDASLKQKAAIALEHVGIFKFLKNDP 323

Query: 347 LGAHEDIKKAIELFPRVNSYIYMALIMADRNDSTEYYNYFDKALKLDSNNSSVYYHRGQM 406
           + AHED+KKA+E FPR N+YIYMALIMAD+  +TEY++ F+KAL+LD N ++VYYHRGQM
Sbjct: 324 ISAHEDLKKAVEYFPRPNTYIYMALIMADKGQATEYFDNFEKALELDPNCAAVYYHRGQM 383

Query: 407 NFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPE 466
           +FI Q ++QAGKDF+KAKEL+  NIFPYIQLACL YRE KF D ETLFSEA+RKFP +PE
Sbjct: 384 HFITQQFEQAGKDFEKAKELNESNIFPYIQLACLTYREGKFSDSETLFSEARRKFPTSPE 443

Query: 467 VPNFFAEILTDKNDFEKALKQYDLAIELENKLDGIYVGIAPLVGKATLLTRNPTVENFIE 526
           VPNF+AE L+DK D   A K+YD+A +LE+ LDGI+VG++PL+GKATLL+R P+VENFIE
Sbjct: 444 VPNFYAETLSDKGDIAGAKKEYDIAAKLESALDGIHVGVSPLIGKATLLSREPSVENFIE 503

Query: 527 ATNLLEEASKLDPRSEQAKIGLAQMKLQQEDIDEAITLFEESADLARTMEEKLQAITFAE 586
           AT L E+A + DPRSEQAKIGLAQ+KLQQEDIDEAI LFEE+ADLAR+ +EKLQA TFAE
Sbjct: 504 ATRLFEQACENDPRSEQAKIGLAQLKLQQEDIDEAIALFEEAADLARSFDEKLQATTFAE 563

Query: 587 AAKVQKRIRSDPILAAKIQETLAKLREQGLM 617
           A K+QK+IR+DPI++AKI+ETLA  R QG++
Sbjct: 564 ATKIQKKIRADPIVSAKIEETLAAYRAQGMI 594

>TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {ON}
           Anc_2.152 YHR117W
          Length = 603

 Score =  708 bits (1828), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/559 (61%), Positives = 439/559 (78%), Gaps = 20/559 (3%)

Query: 59  TKDGSESTAESNTPVYPVSSNGDPDFSNKANFTAEEKDRYALALKDKGNQFFRNKKYDDA 118
           T + S S  E+   +YPV+SNG+PD S K +F+ E K++YA+ALKDKGN +F+ + +++A
Sbjct: 65  TDEKSNSKNETAKVIYPVASNGEPDLSGKDSFSDELKEKYAMALKDKGNDYFKKQDFENA 124

Query: 119 IKYYNWALELKDDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEG 178
           +KYYN+AL LK DPVFYSN+SACYVS+G L+KVVE ST+AL+LK DYSK LLRRASA E 
Sbjct: 125 LKYYNYALTLKQDPVFYSNISACYVSLGQLEKVVESSTEALKLKHDYSKALLRRASAYES 184

Query: 179 LGNFADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMSKLKEKFGDIDTATATPTELST 238
           L N+ DAM DLSVLSLNGDFN ASIEPMLERNLNKQAM  LKEK  +             
Sbjct: 185 LANYVDAMVDLSVLSLNGDFNGASIEPMLERNLNKQAMQVLKEKIAE------------- 231

Query: 239 QAPKELKDKTENLPSITSMASFFGIFKPELTFANYDESNEADKDLMNGLTNLYKRSPESY 298
                  +K + LPS TS+ASFFG+FKPE++  N++E++E++K+L+NGLTNLY R+ + Y
Sbjct: 232 -------NKPQLLPSNTSLASFFGVFKPEVSLNNFNENSESEKELLNGLTNLYSRTNDGY 284

Query: 299 DKADESFTKAVKLFDEQLXXXXXXXXXXXXLAISLEHTGIFKFLKNDPLGAHEDIKKAIE 358
             ADESF KAVKL +++              AI+LE+ GI KFLKNDPL AH DI+KAI 
Sbjct: 285 LVADESFQKAVKLLEKEYEENKENNDIKEKYAIALEYNGILKFLKNDPLDAHNDIQKAIF 344

Query: 359 LFPRVNSYIYMALIMADRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGK 418
           +FPRVNSYIY +LI+AD+ ++ E    FD A+ LD+ N++ YYHRGQ+ F+ Q Y++AG 
Sbjct: 345 IFPRVNSYIYNSLILADKGETEESIKNFDAAINLDATNAATYYHRGQLYFLTQQYEKAGI 404

Query: 419 DFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDK 478
           DFDKAKELD  NI PYIQLACLAY+ENKF+DCETLFSEA+RKFP APEVPNF+A++L ++
Sbjct: 405 DFDKAKELDESNILPYIQLACLAYKENKFNDCETLFSEARRKFPTAPEVPNFYADVLLER 464

Query: 479 NDFEKALKQYDLAIELENKLDGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEEASKLD 538
           N+F+KALKQYD++ +LE  ++GI+VGIAP++GKATLL RNP VEN +E+T L EEA KLD
Sbjct: 465 NEFDKALKQYDISKKLEEAVEGIHVGIAPMIGKATLLARNPIVENLLESTELFEEACKLD 524

Query: 539 PRSEQAKIGLAQMKLQQEDIDEAITLFEESADLARTMEEKLQAITFAEAAKVQKRIRSDP 598
           PRSEQAKIGLAQ+KLQQE++DEAI LFEE+A LAR M+EKLQA TFAEA+KVQK++RSDP
Sbjct: 525 PRSEQAKIGLAQLKLQQEEVDEAIALFEEAAFLARNMDEKLQATTFAEASKVQKKVRSDP 584

Query: 599 ILAAKIQETLAKLREQGLM 617
           ++  KIQETLA  ++QGLM
Sbjct: 585 VINQKIQETLAAYQQQGLM 603

>NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {ON}
           Anc_2.152
          Length = 596

 Score =  708 bits (1827), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/541 (64%), Positives = 423/541 (78%), Gaps = 19/541 (3%)

Query: 72  PVYPVSSNGDPDFSNKANFTAEEKDRYALALKDKGNQFFRNKKYDDAIKYYNWALELKDD 131
           P+YP+ +NG+P   +      + K+ +A ALK+KGN  F+ K +++AIKYY +AL LK+D
Sbjct: 68  PIYPIDANGEPVLGDVDLLNDKTKEEWAGALKEKGNALFKKKDFENAIKYYTFALSLKED 127

Query: 132 PVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDLSV 191
           PV+YSN+SACY S+ + +KV+EM+TKAL L+PDYSKVL+RRA+A E LGNF DAMFDLSV
Sbjct: 128 PVYYSNISACYSSLLNYEKVIEMATKALALRPDYSKVLVRRANAYEKLGNFGDAMFDLSV 187

Query: 192 LSLNGDFNDASIEPMLERNLNKQAMSKLKEKFGDIDTATATPTELSTQAPKELKDKTENL 251
            SLN D +DASIEP+LERNLN+QAM  L  K G                   + DK   L
Sbjct: 188 CSLNTDMSDASIEPILERNLNQQAMFVLNTKLG-------------------VTDKKSQL 228

Query: 252 PSITSMASFFGIFKPELTFANYDESNEADKDLMNGLTNLYKRSPESYDKADESFTKAVKL 311
           PS T++ SFFGIFKPEL+FANYD++ E DK+L+NGL NLY+ + E Y+ AD SFTKA + 
Sbjct: 229 PSNTALTSFFGIFKPELSFANYDDTCEGDKELLNGLKNLYRCTAEGYETADLSFTKATEY 288

Query: 312 FDEQLXXXXXXXXXXXXLAISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRVNSYIYMAL 371
           F +QL             AI+LEH GIFKFLKN+PL AHEDIKKA+EL PR+NSYIYMAL
Sbjct: 289 FLKQLSETPDDETVKEKTAIALEHQGIFKFLKNNPLEAHEDIKKALELHPRINSYIYMAL 348

Query: 372 IMADRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENI 431
           I+AD+ D+  Y+  ++KA+KLD  N+++YYHRGQM FI Q Y++AG+DFDKAKELDPENI
Sbjct: 349 ILADKGDTDNYFANYEKAMKLDDKNAALYYHRGQMYFITQQYEKAGEDFDKAKELDPENI 408

Query: 432 FPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFEKALKQYDLA 491
           FPYIQLACL+YRENKFDDCETLFSEA+RKFP + EVPNF+AEIL DK DF+ ALK+Y+ A
Sbjct: 409 FPYIQLACLSYRENKFDDCETLFSEARRKFPNSSEVPNFYAEILADKGDFDAALKEYERA 468

Query: 492 IELENKLDGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEEASKLDPRSEQAKIGLAQM 551
           IELE K D ++VGIAPLVGKATLL R PTVENF+EAT+LLEEA K DPRSEQAKI L Q+
Sbjct: 469 IELEKKQDAVHVGIAPLVGKATLLVRTPTVENFVEATSLLEEAVKEDPRSEQAKISLGQL 528

Query: 552 KLQQEDIDEAITLFEESADLARTMEEKLQAITFAEAAKVQKRIRSDPILAAKIQETLAKL 611
           KLQQEDIDEAI LFE +A LART EEKLQA TFAEAAK+QKRIR+DP ++AKIQET+A L
Sbjct: 529 KLQQEDIDEAIELFESAATLARTFEEKLQATTFAEAAKIQKRIRADPKMSAKIQETIAAL 588

Query: 612 R 612
           R
Sbjct: 589 R 589

>TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa]
           {ON} Anc_2.152 YHR117W
          Length = 610

 Score =  702 bits (1811), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/545 (63%), Positives = 428/545 (78%), Gaps = 21/545 (3%)

Query: 72  PVYPVSSNGDPDFSNKANFTAEEKDRYALALKDKGNQFFRNKKYDDAIKYYNWALELKDD 131
           P+YPV  NG+P+  NK  FT EEK++Y++ALKDKGN  F+  K+++AIKYYNWA+ELK++
Sbjct: 84  PIYPVRDNGEPNLDNKDQFTEEEKEKYSIALKDKGNSLFKADKFEEAIKYYNWAIELKEN 143

Query: 132 PVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDLSV 191
           P+FYSNLSACYVS+  L+++++   KALELKPDYSKVLLRRA+ANE L N+ADAMFDLSV
Sbjct: 144 PIFYSNLSACYVSLNKLEEIIKYCNKALELKPDYSKVLLRRANANEKLENYADAMFDLSV 203

Query: 192 LSLNGDFNDASIEPMLERNLNKQAMSKLKEKFGDIDTATATPTELSTQAPKELKDKTENL 251
           LSLNGD+N ASIEP+LERNLNKQAMS LK+K  +                     K + L
Sbjct: 204 LSLNGDYNGASIEPILERNLNKQAMSVLKDKLKN--------------------SKDDQL 243

Query: 252 PSITSMASFFGIFKPELTFANYDESNEADKDLMNGLTNLYKRSPESYDKADESFTKAVKL 311
           PS TS+++FFGIFKPEL+F NYDE+N+ADK+L+NGLT+L+KR  ESY  AD+SF  A++L
Sbjct: 244 PSDTSLSAFFGIFKPELSFENYDETNDADKELLNGLTHLFKRQSESYLIADKSFMNALEL 303

Query: 312 FDEQLXXXXXXXXXXXXLAISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRVNSYIYMAL 371
           + +QL             +I+ E+ GIF FLKND  GA E+I K+I+L PR+NSYIY AL
Sbjct: 304 YIKQLEETPDDTDLKVKASIAYEYAGIFNFLKNDLSGATENIDKSIKLNPRINSYIYRAL 363

Query: 372 IMADRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENI 431
           I+AD+ +S +Y +YFDKALKLD  + +VYYHR Q+NF+ Q++ +A  DF+KAKE DP NI
Sbjct: 364 IIADKGESQDYLDYFDKALKLDDKSCAVYYHRAQLNFVTQDFAKAAVDFEKAKECDPTNI 423

Query: 432 FPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFEKALKQYDLA 491
           FPYIQLACL YRENKFDDCETLFSEAKRKFP  PEVPNF+AE+LTDK DF+ A+K Y+ A
Sbjct: 424 FPYIQLACLTYRENKFDDCETLFSEAKRKFPTLPEVPNFYAEVLTDKGDFDNAMKNYETA 483

Query: 492 IELEN-KLDGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEEASKLDPRSEQAKIGLAQ 550
             LE    DGI+VG+APL+GKATLL R PT+EN   A  LLEEA+++DPRSEQAKIGLAQ
Sbjct: 484 RRLEEASKDGIHVGVAPLIGKATLLAREPTLENLAAADKLLEEANRIDPRSEQAKIGLAQ 543

Query: 551 MKLQQEDIDEAITLFEESADLARTMEEKLQAITFAEAAKVQKRIRSDPILAAKIQETLAK 610
           +KLQ+E+IDE+I LFEESADLARTMEEKLQA TFAEAAKVQK IR+DPI++ KI+ETLA 
Sbjct: 544 LKLQKEEIDESIRLFEESADLARTMEEKLQATTFAEAAKVQKMIRADPIISKKIEETLAA 603

Query: 611 LREQG 615
            R Q 
Sbjct: 604 YRAQN 608

>Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}
           similar to Ashbya gossypii ABR131W
          Length = 597

 Score =  682 bits (1760), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/566 (60%), Positives = 416/566 (73%), Gaps = 20/566 (3%)

Query: 52  VKGSQKKTKDGSESTAESNTPVYPVSSNGDPDFSNKANFTAEEKDRYALALKDKGNQFFR 111
           V     +T+ G +    +N   YPV SNG+PD S   +FT E+K+RY++A+KDKGN+ F+
Sbjct: 51  VNSPSGETRYGKKKKKRANKKKYPVDSNGEPDLSGVDSFTEEQKERYSMAMKDKGNECFK 110

Query: 112 NKKYDDAIKYYNWALELKDDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLR 171
            KKY++AIKYY+ AL LK DPVFYSN SAC+V +  L+KVVE +T ALELKPDYSK LLR
Sbjct: 111 EKKYEEAIKYYSCALRLKKDPVFYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLR 170

Query: 172 RASANEGLGNFADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMSKLKEKFGDIDTATA 231
           RA+ANE LGNFADAM DLS +SL G +N  SIEP+LERN+NKQAM  LK K  D      
Sbjct: 171 RATANESLGNFADAMLDLSAVSLYGGYNSQSIEPVLERNMNKQAMQVLKRKLAD------ 224

Query: 232 TPTELSTQAPKELKDKTENLPSITSMASFFGIFKPELTFANYDESNEADKDLMNGLTNLY 291
                              LPS TS+ASFFGIF  E +FANYDE +EAD  L+ GL  L 
Sbjct: 225 --------------GSKHQLPSNTSLASFFGIFPSETSFANYDEQSEADNFLLKGLRCLS 270

Query: 292 KRSPESYDKADESFTKAVKLFDEQLXXXXXXXXXXXXLAISLEHTGIFKFLKNDPLGAHE 351
           +R   SY+ +DE F KA  L                 LAI+LEH GIFKFLKN+PL A++
Sbjct: 271 ERKTGSYEMSDEYFNKAADLLSLSHQADSEDPALRMKLAIALEHVGIFKFLKNEPLEAYK 330

Query: 352 DIKKAIELFPRVNSYIYMALIMADRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQ 411
            ++KA++L PR NSYIYMALIMAD+  + EY  YFDKAL+L  N+S+VYYHRGQM F+ Q
Sbjct: 331 LLQKAVDLHPRPNSYIYMALIMADKGQTDEYLQYFDKALELAPNSSAVYYHRGQMYFVTQ 390

Query: 412 NYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFF 471
            ++++GKDFDKAKE +P+NIFPYIQLACLAYRENKF+DCETLFSEA+RKFP APEVPNF+
Sbjct: 391 QFEKSGKDFDKAKECNPDNIFPYIQLACLAYRENKFEDCETLFSEARRKFPTAPEVPNFY 450

Query: 472 AEILTDKNDFEKALKQYDLAIELENKLDGIYVGIAPLVGKATLLTRNPTVENFIEATNLL 531
           AEIL+DK D E ALK+Y+ A +LE+  +GI+VG+APLVGKAT+L R     +F EAT L 
Sbjct: 451 AEILSDKGDLESALKEYEFARKLEDAQEGIHVGVAPLVGKATVLARQSHSGDFAEATALF 510

Query: 532 EEASKLDPRSEQAKIGLAQMKLQQEDIDEAITLFEESADLARTMEEKLQAITFAEAAKVQ 591
           EEA K DPRSEQAKIGLAQ+KLQQE +DEAI LFEE+ DLAR  EEKLQA TFAEAAK+Q
Sbjct: 511 EEACKKDPRSEQAKIGLAQLKLQQEQVDEAIQLFEEATDLARAFEEKLQATTFAEAAKIQ 570

Query: 592 KRIRSDPILAAKIQETLAKLREQGLM 617
           KRIR+DPI++AKIQETL   R QG++
Sbjct: 571 KRIRADPIMSAKIQETLEAYRVQGVV 596

>ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL121C (TOM70) and
           YHR117W (TOM71)
          Length = 594

 Score =  677 bits (1747), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/544 (60%), Positives = 409/544 (75%), Gaps = 20/544 (3%)

Query: 74  YPVSSNGDPDFSNKANFTAEEKDRYALALKDKGNQFFRNKKYDDAIKYYNWALELKDDPV 133
           YPV  NG+PD S  A FT E+K++YA+ALKDKGN+ F++++Y++AIK+Y+ AL+LK+DPV
Sbjct: 70  YPVDQNGEPDLSGMATFTEEQKEKYAMALKDKGNECFKDQRYEEAIKFYDCALKLKEDPV 129

Query: 134 FYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDLSVLS 193
           FYSN SACYV +  L+KVVE +T AL+LKPDYSK LLRRA+ANE LGN+ADAM DLS +S
Sbjct: 130 FYSNRSACYVPLNKLEKVVEDTTAALKLKPDYSKCLLRRATANESLGNYADAMLDLSAVS 189

Query: 194 LNGDFNDASIEPMLERNLNKQAMSKLKEKFGDIDTATATPTELSTQAPKELKDKTENLPS 253
           L G ++  +IEP+LERN+NKQAM  LK+K                        +   LPS
Sbjct: 190 LYGGYSSQTIEPVLERNMNKQAMQVLKQKLSG--------------------GEKHELPS 229

Query: 254 ITSMASFFGIFKPELTFANYDESNEADKDLMNGLTNLYKRSPESYDKADESFTKAVKLFD 313
            TS+ASFF IF  E +  NYDE++EAD+ L+ GL  L+ R   SY+ ADE+FT AV+ F 
Sbjct: 230 NTSLASFFRIFPSETSLENYDETSEADRILLKGLCALHARQAGSYEIADEAFTDAVEKFT 289

Query: 314 EQLXXXXXXXXXXXXLAISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRVNSYIYMALIM 373
                          LAI+LEH GI KFLKN+PL AH  ++KAI+LFPR NSYIYM LIM
Sbjct: 290 AAHEANPDNAALKQKLAIALEHVGILKFLKNEPLEAHNLLQKAIDLFPRPNSYIYMGLIM 349

Query: 374 ADRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFP 433
           AD+  + EY   F+KAL+LD  +S+ YYHR QMNF++Q +DQAGKDFDKAKE DP  ++P
Sbjct: 350 ADKGQADEYAQNFEKALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYP 409

Query: 434 YIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFEKALKQYDLAIE 493
           YIQLACLAYRE KFDDCETLFSEA+R+FP APEVPNF+AEIL+DK DFE ALK+YD A +
Sbjct: 410 YIQLACLAYREKKFDDCETLFSEARRRFPTAPEVPNFYAEILSDKGDFENALKEYDFARK 469

Query: 494 LENKLDGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEEASKLDPRSEQAKIGLAQMKL 553
           LE+  +GI+VG+APLVGKA LL R P+  NF EAT L E A + DPRSEQAKIGLAQ+KL
Sbjct: 470 LEDAQEGIHVGVAPLVGKAALLARQPSASNFAEATKLFELACEKDPRSEQAKIGLAQLKL 529

Query: 554 QQEDIDEAITLFEESADLARTMEEKLQAITFAEAAKVQKRIRSDPILAAKIQETLAKLRE 613
           QQE++DEAI LFE +ADL+R  EEKLQA TFAEAAK+QKRIR+DP+++AKIQETL   R 
Sbjct: 530 QQEEVDEAIKLFEAAADLSRAFEEKLQATTFAEAAKIQKRIRADPVMSAKIQETLDAYRA 589

Query: 614 QGLM 617
           QG++
Sbjct: 590 QGMV 593

>NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.152
           YHR117W
          Length = 609

 Score =  674 bits (1739), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/555 (60%), Positives = 420/555 (75%), Gaps = 21/555 (3%)

Query: 64  ESTAESNTPVYPVSSNGDPDFSNKANFTAEEKDRYALALKDKGNQFFRNKKYDDAIKYYN 123
           E T  +  P+Y V SNG+P+ S+  + T E K+ +A+ALKDKGN+ F+  K++DAIKYY+
Sbjct: 75  EDTPTTKKPIYLVDSNGEPNLSDIDSLTEETKNEWAMALKDKGNELFKTSKFEDAIKYYH 134

Query: 124 WALELKDDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFA 183
           +AL+LKDDP++YSN+SACY S+   +KV+E +TKAL+L+P +SKVL+RRA A E +GNF 
Sbjct: 135 YALKLKDDPIYYSNISACYASLLQYEKVIEYATKALKLRPTFSKVLMRRALAYEAMGNFG 194

Query: 184 DAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMSKLKEKFGDIDTATATPTELSTQAPKE 243
           DAMFD+S  SLNGD NDASIEP+LER LNKQA   LKEK                     
Sbjct: 195 DAMFDISACSLNGDMNDASIEPILERILNKQAEFVLKEKIS------------------- 235

Query: 244 LKDKTENLPSITSMASFFGIFKPELTFANYDESNEADKDLMNGLTNLYKRSPESYDKADE 303
             +K +NLPS T +ASFF +FKPE +FANY+ESNEAD++LMNGLTNLYK S E +  AD+
Sbjct: 236 -ANKEQNLPSSTPLASFFRVFKPETSFANYEESNEADRELMNGLTNLYKNSEEGFQIADK 294

Query: 304 SFTKAVKLFDEQLXXXXXXXXXXXXLAISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRV 363
           SF KA +LF +QL             AI+LE++GI  ++KN+ L AH+ IK AIEL PRV
Sbjct: 295 SFLKAAELFKDQLSQNKDNEAIKEKTAIALEYSGILYYMKNETLKAHDSIKSAIELHPRV 354

Query: 364 NSYIYMALIMADRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKA 423
           NSYIY +LI +D   ++EY   FDKAL+L+ NN ++YYHRGQ  FI Q Y++AGKDFDK 
Sbjct: 355 NSYIYQSLIGSDSTTTSEYLQNFDKALELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKV 414

Query: 424 KELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFEK 483
           KELD  NIF YIQLACLAYRE+KFDDCETLFSEA+RKFP APEVPNFFAE+L D+ + EK
Sbjct: 415 KELDENNIFAYIQLACLAYRESKFDDCETLFSEARRKFPTAPEVPNFFAEVLADRGESEK 474

Query: 484 ALKQYDLAIELENKL-DGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEEASKLDPRSE 542
           A+K++D AIELE K  + I+VGIAPL+GKATLL   PTVENF+E   LL+EA   DPRSE
Sbjct: 475 AMKEFDKAIELEAKTPEEIHVGIAPLIGKATLLISKPTVENFVEGIQLLQEACDKDPRSE 534

Query: 543 QAKIGLAQMKLQQEDIDEAITLFEESADLARTMEEKLQAITFAEAAKVQKRIRSDPILAA 602
           QA++GLAQ+KLQQEDIDEAI LFEE+A+LA++ EEKLQA TFAEAAK+QKRIR+DP + A
Sbjct: 535 QARLGLAQLKLQQEDIDEAIQLFEEAAELAKSYEEKLQATTFAEAAKIQKRIRADPAMDA 594

Query: 603 KIQETLAKLREQGLM 617
           KI++T+ ++R Q  M
Sbjct: 595 KIRQTIEQMRSQMSM 609

>KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 604

 Score =  665 bits (1716), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/544 (59%), Positives = 411/544 (75%), Gaps = 18/544 (3%)

Query: 73  VYPVSSNGDPDFSNKANFTAEEKDRYALALKDKGNQFFRNKKYDDAIKYYNWALELKDDP 132
           VYPV +NG PD S K  FT E+ D+YALALKDKGN+FF+ K ++ AI+YY  A+ LK+DP
Sbjct: 78  VYPVDANGQPDLSKKDEFTPEQVDKYALALKDKGNEFFKAKDFEKAIEYYTLAISLKEDP 137

Query: 133 VFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDLSVL 192
           VFYSN SA YVS+ + +KVVE +T AL+LKPDYSK  LRRASA E LG F+DAMFDLS +
Sbjct: 138 VFYSNRSAAYVSINNFEKVVEDTTAALKLKPDYSKCWLRRASAYENLGQFSDAMFDLSAV 197

Query: 193 SLNGDFNDASIEPMLERNLNKQAMSKLKEKFGDIDTATATPTELSTQAPKELKDKTENLP 252
           SL G+++  S+E +LERN+NKQA   L EK                   KE + K   LP
Sbjct: 198 SLLGEYSGQSVEQLLERNMNKQATKVLGEKL------------------KENQGKESPLP 239

Query: 253 SITSMASFFGIFKPELTFANYDESNEADKDLMNGLTNLYKRSPESYDKADESFTKAVKLF 312
           S TS+ASFFGIF PE +F +YD  NEAD +L  GL NLYK     Y+ ADE FTKA +L+
Sbjct: 240 SNTSLASFFGIFNPETSFDDYDGENEADVELKKGLENLYKCQTGCYELADEEFTKAAELY 299

Query: 313 DEQLXXXXXXXXXXXXLAISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRVNSYIYMALI 372
            ++L             AI+ EH GIFKF KNDP+ AH ++++++ L PR ++YIYMALI
Sbjct: 300 KKELESSPDNESLKKKAAIAFEHVGIFKFFKNDPITAHINLEESLSLNPRPSTYIYMALI 359

Query: 373 MADRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIF 432
           MAD+ ++ +Y  YFDKAL+LD N S+VYYHRGQM+F+++N+ +AG DFDKAKEL+PENIF
Sbjct: 360 MADKGEANQYKEYFDKALELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIF 419

Query: 433 PYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFEKALKQYDLAI 492
            YIQ ACLA+R+++FDDCETLFSEA+RKFP APEVPNF+AEIL  KN  + A+KQYD+AI
Sbjct: 420 AYIQCACLAFRDDRFDDCETLFSEARRKFPTAPEVPNFYAEILAAKNSLDAAIKQYDIAI 479

Query: 493 ELENKLDGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEEASKLDPRSEQAKIGLAQMK 552
           +LE+ L GI+VGIAP++GKAT L RNPTVENF+EA+ L EEA K+DPRSEQAKIGLAQ+K
Sbjct: 480 KLEDALPGIHVGIAPMIGKATALIRNPTVENFVEASELFEEACKIDPRSEQAKIGLAQLK 539

Query: 553 LQQEDIDEAITLFEESADLARTMEEKLQAITFAEAAKVQKRIRSDPILAAKIQETLAKLR 612
           LQQE+ID+AI LFE++ADL+R+ +EKLQA TFAEA KVQK+IR+DP +  KI E +A  R
Sbjct: 540 LQQEEIDDAIQLFEDAADLSRSFDEKLQATTFAEATKVQKKIRADPFIKGKIDEAIAAYR 599

Query: 613 EQGL 616
            QGL
Sbjct: 600 AQGL 603

>KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.152
           YHR117W
          Length = 614

 Score =  650 bits (1676), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/570 (58%), Positives = 411/570 (72%), Gaps = 32/570 (5%)

Query: 56  QKKTKDGSESTAESNTPVYPVSSNGDPDFSNKANFTAEEKDRYALALKDKGNQFFRNKKY 115
           +KKT+  +E      TPVYP++++G+PD S   ++T E+++ YALALKDKGN+ F+ K  
Sbjct: 69  EKKTELATE------TPVYPITASGEPDLSQLDSYTPEQRETYALALKDKGNELFKEKAV 122

Query: 116 DDAIKYYNWALELKDDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASA 175
           ++AIKYY WALE K DPVFY+N+SACYVS+ D +KV+E   KALELKPDYSKVLLRRA+ 
Sbjct: 123 EEAIKYYQWALEFKKDPVFYANISACYVSLNDFEKVLENCNKALELKPDYSKVLLRRANT 182

Query: 176 NEGLGNFADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMSKLKEKFGDIDTATATPTE 235
            E + NFADAMFDLSVLSLN DF+ ASIEPMLERNLNKQAM  LKE+  +          
Sbjct: 183 YENMENFADAMFDLSVLSLNNDFSGASIEPMLERNLNKQAMKMLKERLENT--------- 233

Query: 236 LSTQAPKELKDKTEN-LPSITSMASFFGIFKPELTFANYDESNEADKDLMNGLTNLYKRS 294
                    +DK E  LPS TSMASFFGIFKPE  F  YDE+ EAD+ L  GL  L+  +
Sbjct: 234 ---------QDKFEQPLPSDTSMASFFGIFKPETEFKGYDETCEADRTLQTGLLELFAAT 284

Query: 295 PESYDKADESFTKAV----KLFDEQLXXXXXXXXXXXXLAISLEHTGIFKFLKNDPLGAH 350
              + KAD  F +AV    +LF +               AI+LE++GIFKFLKND +GA 
Sbjct: 285 HVGFVKADTCFNEAVNQYRELFSKASDEEKLAQNLNEKFAIALEYSGIFKFLKNDVIGAQ 344

Query: 351 EDIKKAIELFPRVNSYIYMALIMADRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFIL 410
             + +AI+LFPRVNSYIY+AL  AD  +S+EY   FDKAL+L+ N+S+ YYHRGQ+ FI 
Sbjct: 345 AAVNEAIKLFPRVNSYIYLALTSADNGESSEYVTNFDKALELNPNSSATYYHRGQLYFIT 404

Query: 411 QNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNF 470
           Q+Y +A  DF KAKELD +NIF YIQLACL YRE   D+C+ LF EA+ KFP APEVP F
Sbjct: 405 QDYQKAKADFLKAKELDNDNIFAYIQLACLCYREGDMDECKKLFDEAREKFPVAPEVPTF 464

Query: 471 FAEILTDKNDFEKALKQYDLAIELENKLD---GIYVGIAPLVGKATLLTRNPTVENFIEA 527
           +AEIL DK DF  A KQYD+A  LE  +    GI VG+APLVGKAT+L R P+ ENF EA
Sbjct: 465 YAEILADKGDFSDAAKQYDMAKRLEEAISAKTGIRVGVAPLVGKATVLARQPSPENFAEA 524

Query: 528 TNLLEEASKLDPRSEQAKIGLAQMKLQQEDIDEAITLFEESADLARTMEEKLQAITFAEA 587
           T L EEA K DPRSEQAK+GLAQ+ LQQED+D AI +FEE+ADLART +EKLQA+TFAEA
Sbjct: 525 TTLFEEACKRDPRSEQAKVGLAQLLLQQEDVDSAIKMFEEAADLARTTDEKLQAVTFAEA 584

Query: 588 AKVQKRIRSDPILAAKIQETLAKLREQGLM 617
           AKVQK+IR+DPI+ AK++E LA+ R QG++
Sbjct: 585 AKVQKKIRADPIIRAKVEEALAEYRAQGMI 614

>NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON}
           Anc_2.152
          Length = 625

 Score =  647 bits (1669), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/559 (57%), Positives = 416/559 (74%), Gaps = 16/559 (2%)

Query: 59  TKDGSESTAESNTPVYPVSSNGDPDFSNKANFTAEEKDRYALALKDKGNQFFRNKKYDDA 118
           T D + +TA+  T  YP + + DPD     +   EE+ + ++ LKDKGN++F+ K Y +A
Sbjct: 83  TPDQTTATADVLTS-YPTNDSNDPDMIQITSLPLEEQKKISMQLKDKGNKYFKAKDYTNA 141

Query: 119 IKYYNWALELKDDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEG 178
           IKYYN AL+L  DP+FYSN+SACYVS+G L KV+E STKALEL P+YSK LLRRASANE 
Sbjct: 142 IKYYNLALDLNKDPIFYSNISACYVSLGQLDKVIESSTKALELNPNYSKALLRRASANES 201

Query: 179 LGNFADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMSKLKEKFGDIDTATATPTELST 238
           L N++DA+FDLSVLSLNGD++ ASIEP+LERNLNKQA+  L E+   +           T
Sbjct: 202 LENYSDALFDLSVLSLNGDYSGASIEPILERNLNKQAIKVLNERMNKM-----------T 250

Query: 239 QAPKELKDKTENLPSITSMASFFGIFKPELTFANYDESNEADKDLMNGLTNLYKRSPESY 298
            + KE     + LPS TS+ SFFGIF PELTF NY+E+++AD +L+ GLTNL+KR+ + Y
Sbjct: 251 GSNKE----QQLLPSTTSLVSFFGIFDPELTFQNYNENDQADVELLTGLTNLFKRTDQGY 306

Query: 299 DKADESFTKAVKLFDEQLXXXXXXXXXXXXLAISLEHTGIFKFLKNDPLGAHEDIKKAIE 358
             AD++F KA  LF E+L             AI+LE+ GIF+FLKND LGA  DI+KAI 
Sbjct: 307 LDADKNFVKASSLFMEELAKNPKDKHLLEKTAIALEYNGIFRFLKNDLLGAQTDIEKAIG 366

Query: 359 LFPRVNSYIYMALIMADRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGK 418
            FPRVNSY+Y+ALI AD++ S EY  YFDKAL+L+ ++ SVYYHRGQ+ FI Q+Y +A  
Sbjct: 367 FFPRVNSYLYLALISADKSTSQEYSKYFDKALELNPDSLSVYYHRGQLYFITQDYPKAKV 426

Query: 419 DFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDK 478
           +F+KAKELD  NIFPYIQLACLAYREN FD C+ LF E ++KFP  PEVP F+AEIL DK
Sbjct: 427 EFEKAKELDETNIFPYIQLACLAYRENDFDRCQKLFDETRQKFPTYPEVPTFYAEILADK 486

Query: 479 NDFEKALKQYDLAIELENKLDGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEEASKLD 538
            DF  A+KQYD+A  LE     I+VGIAPLVGKAT+L R P + N  EAT L+E+A ++D
Sbjct: 487 GDFALAIKQYDIATRLEKAQKNIHVGIAPLVGKATVLARQPNLLNLKEATQLMEKACEID 546

Query: 539 PRSEQAKIGLAQMKLQQEDIDEAITLFEESADLARTMEEKLQAITFAEAAKVQKRIRSDP 598
           PRSEQA +GLAQ+KLQ E++D AI LFE++ADL+RTM+EK+QA+TFAEAAK+QKRIR+DP
Sbjct: 547 PRSEQAIVGLAQLKLQNEEVDLAIELFEKAADLSRTMDEKIQAMTFAEAAKIQKRIRADP 606

Query: 599 ILAAKIQETLAKLREQGLM 617
           +++AK+ E LA  R QG++
Sbjct: 607 VISAKVDEALASYRSQGVI 625

>CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121c TOM70 or uniprot|P38825 Saccharomyces cerevisiae
           YHR117w TOM7
          Length = 600

 Score =  645 bits (1664), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/544 (59%), Positives = 410/544 (75%), Gaps = 14/544 (2%)

Query: 76  VSSNGD---PDFSNKANFTAEEKDRYALALKDKGNQFFRNKKYDDAIKYYNWALELKDDP 132
           ++ NGD   PD +     + ++K  YA ALKDKGN  F+ K+++DAI++YN A++L +DP
Sbjct: 67  LTINGDEEKPDMAAMLASSEDQKKVYATALKDKGNALFKEKRFEDAIEFYNHAIKLHEDP 126

Query: 133 VFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDLSVL 192
           VF+SN+SACYVS+GDL KVVE ST+ALELKPDYSK LLRRASA E +G + DAMFD+SVL
Sbjct: 127 VFHSNISACYVSLGDLDKVVESSTRALELKPDYSKALLRRASAYENMGRYQDAMFDISVL 186

Query: 193 SLNGDFNDASIEPMLERNLNKQAMSKLKEKFGDIDTATATPTELSTQAPKELKDKTENLP 252
           SLNGDFN +SIEPMLERNLNKQA+  LKE  G ID +         + P+E ++    LP
Sbjct: 187 SLNGDFNGSSIEPMLERNLNKQALRVLKEDMG-IDASVP-----QAEQPRERQE----LP 236

Query: 253 SITSMASFFGIFKPELTFANYDESNEADKDLMNGLTNLYKRSPESYDKADESFTKAVKLF 312
           S TS++SFFGIFKPE     YDESNEAD  L+ GL  LY  + + Y  ADE F KA KL+
Sbjct: 237 SNTSLSSFFGIFKPETEIPAYDESNEADVTLVRGLKALYGATSDGYQLADECFAKAAKLY 296

Query: 313 DEQLXXXXXXXXXXXXLAISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRVNSYIYMALI 372
            EQL             A +LE+ GIF FLKND   + +++K+A+ L PRVN+YIY+AL 
Sbjct: 297 REQLANNNDAAFKEKA-ATALEYLGIFDFLKNDLDNSEKNLKEALALHPRVNTYIYLALT 355

Query: 373 MADRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIF 432
           MADR  S +Y++YF+KA+ LD NN++VYYHRGQM FI QNY++AG+DF K+KE DP+NIF
Sbjct: 356 MADRGQSEDYFSYFEKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIF 415

Query: 433 PYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFEKALKQYDLAI 492
           PYIQLACLAYRENK  +CE LF EA++ FP APEVPNF+AEIL DK D ++A+KQY++A 
Sbjct: 416 PYIQLACLAYRENKMAECEKLFEEARKTFPTAPEVPNFYAEILADKGDIDEAVKQYNIAY 475

Query: 493 ELENKLDGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEEASKLDPRSEQAKIGLAQMK 552
            LE+    I+VGIAPLVGKAT+L R PT ENF   + LLE+A K DPRSEQAK+GLAQ++
Sbjct: 476 RLESLQKQIHVGIAPLVGKATILARQPTPENFATISQLLEDACKADPRSEQAKVGLAQLR 535

Query: 553 LQQEDIDEAITLFEESADLARTMEEKLQAITFAEAAKVQKRIRSDPILAAKIQETLAKLR 612
           LQQE +DEAI LFEE+A +ART++EKLQAITFAEA KVQKRIR+DP+++ K++ETLA  +
Sbjct: 536 LQQEKVDEAIELFEEAAKMARTVDEKLQAITFAEATKVQKRIRADPVVSKKVEETLAAYQ 595

Query: 613 EQGL 616
            Q +
Sbjct: 596 AQNM 599

>KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {ON}
           Anc_2.152 YHR117W
          Length = 608

 Score =  628 bits (1619), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/580 (55%), Positives = 414/580 (71%), Gaps = 30/580 (5%)

Query: 50  KEVKGSQKKTKDGSESTAESNTPV------------YPVSSNGDPDFSNKANFTAEEKDR 97
           K++K   K+ +D SE+  E                 +P   NG+PDF+   N TA++KD+
Sbjct: 47  KDLKDHDKQAEDKSENATEKKLASKPKKKKVSKASQFPAKENGEPDFTGVDNLTADQKDK 106

Query: 98  YALALKDKGNQFFRNKKYDDAIKYYNWALELKDDPVFYSNLSACYVSVGDLKKVVEMSTK 157
           +A+ LKDKGN++F+ K Y++A+K+Y++AL LK DPVFYSN+SACYVS+ +L KV+EMSTK
Sbjct: 107 WAIELKDKGNEYFKEKDYENALKFYDFALILKKDPVFYSNMSACYVSLNELDKVIEMSTK 166

Query: 158 ALELKPDYSKVLLRRASANEGLGNFADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMS 217
           ALELKPDYSK LLRRA+ANE L N++DAMFDLSVLSLN DFN A+IEPMLERNLNKQA+ 
Sbjct: 167 ALELKPDYSKALLRRATANEQLENYSDAMFDLSVLSLNNDFNGATIEPMLERNLNKQAIK 226

Query: 218 KLKEKFGDIDTATATPTELSTQAPKELKDKTENLPSITSMASFFGIFKPELTFANYDESN 277
            L +K       +  P+          K+++E LPS TSMASFF IF PE++F +YDE +
Sbjct: 227 VLDQK-------SKNPS----------KNESE-LPSNTSMASFFSIFTPEISFDSYDEES 268

Query: 278 EADKDLMNGLTNLYKRSPESYDKADESFTKAVKLFDEQLXXXXXXXXXXXXLAISLEHTG 337
           +ADK+L+NGL  LY      Y+ A+ SF K+++L+   L             AI+LE+ G
Sbjct: 269 DADKELLNGLKELYSAKTGCYEIAESSFNKSMELYKILLESTEDKETISKKFAIALEYVG 328

Query: 338 IFKFLKNDPLGAHEDIKKAIELFPRVNSYIYMALIMADRNDSTEYYNYFDKALKLDSNNS 397
           IF FL+ND + A +   ++I   PRVNSYIY+ALI AD+N+  E   YFD+ALKLD N S
Sbjct: 329 IFNFLRNDLVTAQDLFNQSISASPRVNSYIYLALISADKNEKDESNKYFDEALKLDPNCS 388

Query: 398 SVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEA 457
            +YYHRGQ+NF+ Q+Y  A  DF KAKELD  NIFPYIQLACL+YRE  F+DC+  F  A
Sbjct: 389 PIYYHRGQLNFVTQDYVNAKNDFLKAKELDENNIFPYIQLACLSYREGDFEDCQNQFELA 448

Query: 458 KRKFPEAPEVPNFFAEILTDKNDFEKALKQYDLAIELENKLDGIYVGIAPLVGKATLLTR 517
           ++KFP APE+P F  EIL DK D + A KQY+  I LEN    I+VGIAPL+GKAT L R
Sbjct: 449 RKKFPVAPEIPTFLGEILADKGDLDLAAKQYEFGIRLENTQKSIHVGIAPLIGKATALAR 508

Query: 518 NPTVENFIEATNLLEEASKLDPRSEQAKIGLAQMKLQQEDIDEAITLFEESADLARTMEE 577
            PT ENF EA+ LL++A + DPRSEQA +GLAQ+KLQ+ED+D AI LFE+++D +R+M+E
Sbjct: 509 QPTPENFSEASKLLQDAVEKDPRSEQAIVGLAQLKLQEEDVDTAIELFEKASDYSRSMDE 568

Query: 578 KLQAITFAEAAKVQKRIRSDPILAAKIQETLAKLREQGLM 617
           KLQA TFAEAAKVQKRIR+DP++ AK++ETLA+   QG M
Sbjct: 569 KLQATTFAEAAKVQKRIRADPVIKAKVEETLAQYHAQGFM 608

>CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121c TOM70
           or uniprot|P38825 Saccharomyces cerevisiae YHR117w TOM7
          Length = 587

 Score =  607 bits (1565), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/567 (54%), Positives = 399/567 (70%), Gaps = 20/567 (3%)

Query: 50  KEVKGSQKKTKDGSE-STAESNTPVYPVSSNGDPDFSNKANFTAEEKDRYALALKDKGNQ 108
           K+V+  +K   DG++  TA S      +  N +PD          EK+ YA  LK +GN 
Sbjct: 36  KQVQELKKSLDDGNDVGTASSKVEYKYLMINDEPDIELMKLAETAEKNEYASELKKRGNA 95

Query: 109 FFRNKKYDDAIKYYNWALELKDDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKV 168
           +F+ K Y++AI YY +AL+LK+DPVFYSN++ACY+S+   K+ +E  +KALEL PDYSKV
Sbjct: 96  YFKVKDYENAINYYKFALQLKNDPVFYSNMAACYISLEHNKEAIEACSKALELNPDYSKV 155

Query: 169 LLRRASANEGLGNFADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMSKLKEKFGDIDT 228
           LL+RA+  E +G FADA+ DL+ +SLNGD+NDA+I+P++ER LNKQAM  LK+       
Sbjct: 156 LLKRAAVYENIGKFADALLDLTAVSLNGDYNDATIQPIVERVLNKQAMMALKDHL----- 210

Query: 229 ATATPTELSTQAPKELKDKTENLPSITSMASFFGIFKPELTFANYDESNEADKDLMNGLT 288
                         E  +K + LPS TSMA+FFG+F  E     +D + E+DK L + LT
Sbjct: 211 --------------EASEKNKVLPSYTSMAAFFGVFDAETDIPGHDATEESDKILSDALT 256

Query: 289 NLYKRSPESYDKADESFTKAVKLFDEQLXXXXXXXXXXXXLAISLEHTGIFKFLKNDPLG 348
           +LY ++ E YD+ D  FTKA +L+  +L             AI+ EHT I  FLKNDPL 
Sbjct: 257 HLYSQTKEGYDRCDSEFTKATELYKAKLENDRTNSVTNEKAAIAFEHTAILSFLKNDPLT 316

Query: 349 AHEDIKKAIELFPRVNSYIYMALIMADRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNF 408
           A E + +AI+L PR  SYIY+ L+MAD+    EYY+ F KA+ LD N +++YYHRGQMNF
Sbjct: 317 ARELVDEAIKLHPRPKSYIYLGLLMADKGLDEEYYSNFQKAIDLDPNMAAIYYHRGQMNF 376

Query: 409 ILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVP 468
           I+Q Y++AG+DFDKAKE DP NIFPYIQLAC++YRE  FDDCETLFSEA+RKFP+APEVP
Sbjct: 377 IIQKYEKAGEDFDKAKECDPTNIFPYIQLACMSYREGHFDDCETLFSEARRKFPDAPEVP 436

Query: 469 NFFAEILTDKNDFEKALKQYDLAIELENKLDGIYVGIAPLVGKATLLTRNPTVENFIEAT 528
           NFFAEIL+DK + EKA  +YD AIELE+K + I+VGIAPLVGKAT L + PTVENFIEA 
Sbjct: 437 NFFAEILSDKGEIEKAAAEYDKAIELESKSENIHVGIAPLVGKATTLLKYPTVENFIEAD 496

Query: 529 NLLEEASKLDPRSEQAKIGLAQMKLQQEDIDEAITLFEESADLARTMEEKLQAITFAEAA 588
           +L E+A+  DPRSE+AK+GLAQ KLQQED+D+AI LFEE+A L RT++EKLQA TFAEA 
Sbjct: 497 DLFEQANNEDPRSEKAKMGLAQCKLQQEDLDDAIRLFEEAAILCRTLDEKLQATTFAEAT 556

Query: 589 KVQKRIRSDPILAAKIQETLAKLREQG 615
           KVQ R+R+D  L AK  + L ++R  G
Sbjct: 557 KVQMRVRADERLQAKTMKALDEIRRNG 583

>Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W
           (REAL)
          Length = 638

 Score =  570 bits (1469), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/556 (53%), Positives = 374/556 (67%), Gaps = 29/556 (5%)

Query: 74  YPVSSNGDPDFSNKANFTAEEKDRYALALKDKGNQFFRNKKYDDAIKYYNWALEL-KDDP 132
           YP+ S+G+PD +        ++  YA+ LKDKGN FF +K +DDAIKYY  A+EL  +DP
Sbjct: 100 YPLLSDGEPDMAQLRGLPLSQRQEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDP 159

Query: 133 VFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDLSVL 192
           VFYSN+SACY+S GDL KVVE +TKALE+KPD+SK LLRRASANE LGNF DAMFDLSVL
Sbjct: 160 VFYSNMSACYISTGDLNKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 219

Query: 193 SLNGDFNDASIEPMLERNLNKQAMSKLKEKFGDIDTATATPTELSTQAPKELKDK-TENL 251
           SLNGDF+ ASIEPMLERNLNKQAM  L                      K   D+ +E L
Sbjct: 220 SLNGDFDGASIEPMLERNLNKQAMKVLNANLS-----------------KNSGDRGSEIL 262

Query: 252 PSITSMASFFGIFKPELTFANYDESNEADKD---LMNGLTNLYKRSPESYDKADESFTKA 308
           PS TS+ASFFGIF P+L  +     +  D     L+  L  LY  + E Y  A+  FTKA
Sbjct: 263 PSNTSLASFFGIFDPDLEISRVSSISPPDTAHDMLLEALQRLYSATSEGYLIANALFTKA 322

Query: 309 VKLFDEQLXXXXXXXXXXXXLAISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRVNSYIY 368
              +   L             A++  + GIF+FLKND L A   ++++I L P  NSYI+
Sbjct: 323 TDAYHSLLSASRVDGAIRGNAALAFCYKGIFQFLKNDLLDAQALLQESINLHPTPNSYIF 382

Query: 369 MALIMADRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDP 428
           MAL +AD+ +S E++++F KA+ LD   S  YYHRGQM FILQ+Y  A  DF KA+ L+P
Sbjct: 383 MALTLADKENSQEFFSFFQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNP 442

Query: 429 ENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFEKALKQY 488
            NI+PYIQLACL Y++ KF + E LF+E K KFP  PEVP FFAEILTDK D+  A+KQY
Sbjct: 443 GNIYPYIQLACLLYKQGKFSESEKLFNETKLKFPTLPEVPTFFAEILTDKGDYNTAIKQY 502

Query: 489 DLAIELENKLDGIYVGIAPLVGKATLLTRNPTV-------ENFIEATNLLEEASKLDPRS 541
           D+A  L+     I+VGI PL+GKAT+L R  T        E F  A  LL EA  LDPRS
Sbjct: 503 DIAKRLQEVQRKIHVGIGPLIGKATILARQSTQDPTQLDEEKFNMAIELLTEACDLDPRS 562

Query: 542 EQAKIGLAQMKLQQEDIDEAITLFEESADLARTMEEKLQAITFAEAAKVQKRIRSDPILA 601
           EQAKIGLAQ+KLQ E ID+AI LF++SA LARTM+EKLQA TFAEAAK+QKR+R+DPI++
Sbjct: 563 EQAKIGLAQLKLQMEKIDDAIELFQDSATLARTMDEKLQATTFAEAAKIQKRLRADPIIS 622

Query: 602 AKIQETLAKLREQGLM 617
           AK+++TLA  R  G++
Sbjct: 623 AKMEQTLASYRANGMI 638

>Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W
           (REAL)
          Length = 635

 Score =  565 bits (1455), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/550 (54%), Positives = 373/550 (67%), Gaps = 29/550 (5%)

Query: 79  NGDPDFSNKANFTAEEKDRYALALKDKGNQFFRNKKYDDAIKYYNWALEL-KDDPVFYSN 137
           NG+PD S     T  +K  YA+ LK+KGN FF  K + +AIKYY  A+EL  +DPVFYSN
Sbjct: 104 NGEPDISQLKGLTLSQKQTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSN 163

Query: 138 LSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDLSVLSLNGD 197
           +SACY+S GDL KV+E +TKALE+KPD+SK LLRRASANE LGNF DAMFDLSVLSLNGD
Sbjct: 164 ISACYISTGDLNKVLEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGD 223

Query: 198 FNDASIEPMLERNLNKQAMSKLKEKFGDIDTATATPTELSTQAPKELKDKTENLPSITSM 257
           F+ ASIEPMLERNLNKQAM  L E     D                    ++ LPS TS+
Sbjct: 224 FDGASIEPMLERNLNKQAMKVLNENLSKGD-----------------GRGSQLLPSNTSL 266

Query: 258 ASFFGIFKPELTFANYDESNEADKD---LMNGLTNLYKRSPESYDKADESFTKAVKLFDE 314
            SFFGIF P+L  +  + S+  D     L + L  LY  + E Y  AD+ FT A   +  
Sbjct: 267 TSFFGIFDPDLEISRVNNSSHFDTAYALLSDALQKLYSATNEGYLTADKLFTSATDAY-H 325

Query: 315 QLXXXXXXXXXXXXLAISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRVNSYIYMALIMA 374
            L             A++  +TGIF FLKN+ LGA   ++++I L P  NSYI++AL +A
Sbjct: 326 SLLASQVDGPLKENAALAFCYTGIFHFLKNNLLGAQALLQESINLHPTPNSYIFLALTLA 385

Query: 375 DRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPY 434
           D+ +S E++ YF KA+ LDS     YYHRGQM FILQ+Y  A  DF KA+ L PENI+PY
Sbjct: 386 DKENSQEFFKYFQKAIDLDSEYPPTYYHRGQMYFILQDYVNAKADFQKAQNLYPENIYPY 445

Query: 435 IQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFEKALKQYDLAIEL 494
           IQLACL Y++ KF + E LF+E K KFP  PEVP FFAEILTDK DF  A+KQYD+A  L
Sbjct: 446 IQLACLLYKQGKFTESEALFNETKLKFPTLPEVPAFFAEILTDKGDFSTAIKQYDIAKRL 505

Query: 495 ENKLDGIYVGIAPLVGKATLLTR----NPTV---ENFIEATNLLEEASKLDPRSEQAKIG 547
           E   + I+VGI PL+GKAT+L R    +PT    E F  A  LL +A +LDPRSEQAKIG
Sbjct: 506 EEVQEKIHVGIGPLIGKATILARQSSQDPTQLDEEKFNTAIALLTKACELDPRSEQAKIG 565

Query: 548 LAQMKLQQEDIDEAITLFEESADLARTMEEKLQAITFAEAAKVQKRIRSDPILAAKIQET 607
           LAQ+KLQ E ID+AI LF++SA LARTM+EKLQA TFAEAAK+QKR+R+DPI++AK++ T
Sbjct: 566 LAQLKLQMEKIDDAIELFQDSAILARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEMT 625

Query: 608 LAKLREQGLM 617
           LA  R +G++
Sbjct: 626 LASYRAKGMI 635

>YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}
           TOM71Mitochondrial outer membrane protein with
           similarity to Tom70p; probable minor component of the
           TOM (translocase of outer membrane) complex responsible
           for recognition and import of mitochondrially directed
           proteins
          Length = 639

 Score =  561 bits (1445), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/555 (52%), Positives = 382/555 (68%), Gaps = 28/555 (5%)

Query: 74  YPVSSNGDPDFSNKANFTAEEKDRYALALKDKGNQFFRNKKYDDAIKYYNWALEL-KDDP 132
           YP   NG+PD +     +  ++  YA+ LK++GN FF  K +++AIKYY +A+EL  ++P
Sbjct: 102 YPSLPNGEPDIAQLKGLSPSQRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEP 161

Query: 133 VFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDLSVL 192
           VFYSN+SACY+S GDL+KV+E +TKALE+KPD+SK LLRRASANE LGNF DAMFDLSVL
Sbjct: 162 VFYSNISACYISTGDLEKVIEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 221

Query: 193 SLNGDFNDASIEPMLERNLNKQAMSKLKEKFGDIDTATATPTELSTQAPKELKDKTENLP 252
           SLNGDF+ ASIEPMLERNLNKQAM  L E                    K+    ++ LP
Sbjct: 222 SLNGDFDGASIEPMLERNLNKQAMKVLNENLS-----------------KDEGRGSQVLP 264

Query: 253 SITSMASFFGIFKPELTFANYDESNEADKD---LMNGLTNLYKRSPESYDKADESFTKAV 309
           S TS+ASFFGIF   L  ++ + S+  D     L + L  LY  + E Y  A++  TK+ 
Sbjct: 265 SNTSLASFFGIFDSHLEVSSVNTSSNYDTAYALLSDALQRLYSATDEGYLVANDLLTKST 324

Query: 310 KLFDEQLXXXXXXXXXXXXLAISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRVNSYIYM 369
            ++   L             A++L +TGIF FLKN+ L A   ++++I L P  NSYI++
Sbjct: 325 DMYHSLLSANTVDDPLRENAALALCYTGIFHFLKNNLLDAQVLLQESINLHPTPNSYIFL 384

Query: 370 ALIMADRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPE 429
           AL +AD+ +S E++ +F KA+ L+      YYHRGQM FILQ+Y  A +DF KA+ L+PE
Sbjct: 385 ALTLADKENSQEFFKFFQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPE 444

Query: 430 NIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFEKALKQYD 489
           N++PYIQLACL Y++ KF + E  F+E K KFP  PEVP FFAEILTD+ DF+ A+KQYD
Sbjct: 445 NVYPYIQLACLLYKQGKFTESEAFFNETKLKFPTLPEVPTFFAEILTDRGDFDTAIKQYD 504

Query: 490 LAIELENKLDGIYVGIAPLVGKATLLTR----NPTV---ENFIEATNLLEEASKLDPRSE 542
           +A  LE   + I+VGI PL+GKAT+L R    +PT    E F  A  LL +A +LDPRSE
Sbjct: 505 IAKRLEEVQEKIHVGIGPLIGKATILARQSSQDPTQLDEEKFNAAIKLLTKACELDPRSE 564

Query: 543 QAKIGLAQMKLQQEDIDEAITLFEESADLARTMEEKLQAITFAEAAKVQKRIRSDPILAA 602
           QAKIGLAQ+KLQ E IDEAI LFE+SA LARTM+EKLQA TFAEAAK+QKR+R+DPI++A
Sbjct: 565 QAKIGLAQLKLQMEKIDEAIELFEDSAILARTMDEKLQATTFAEAAKIQKRLRADPIISA 624

Query: 603 KIQETLAKLREQGLM 617
           K++ TLA+ R +G++
Sbjct: 625 KMELTLARYRAKGML 639

>Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117W
           (REAL)
          Length = 644

 Score =  560 bits (1443), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/559 (53%), Positives = 378/559 (67%), Gaps = 35/559 (6%)

Query: 74  YPVSSNGDPDFSNKANFTAEEKDRYALALKDKGNQFFRNKKYDDAIKYYNWALEL-KDDP 132
           YP+  +G+PD       +A ++  +A+ LKDKGN FF  K + DAIKYY +A+EL  +DP
Sbjct: 106 YPLLPHGEPDMDRLRGLSAPQRQAFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDP 165

Query: 133 VFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDLSVL 192
           VFYSN+SACY+S GDL KVVE +TKALE+KPD+SK LLRRASANE LGNF DAMFDLSVL
Sbjct: 166 VFYSNISACYISTGDLDKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 225

Query: 193 SLNGDFNDASIEPMLERNLNKQAMSKLKE---KFGDIDTATATPTELSTQAPKELKDKTE 249
           SLNGDF+  SIEPMLERNLNKQAM  L E   K GD                    DK+ 
Sbjct: 226 SLNGDFDGTSIEPMLERNLNKQAMKVLNESLLKNGD--------------------DKSS 265

Query: 250 N-LPSITSMASFFGIFKPELTFANYDES---NEADKDLMNGLTNLYKRSPESYDKADESF 305
             LPS TS+ASFFGIF P+L  +  +     + A   L   L +LY  + E Y  AD+  
Sbjct: 266 QILPSNTSLASFFGIFDPDLETSRVNTGSLLDSASATLSEALQSLYSATSEGYLIADDLL 325

Query: 306 TKAVKLFDEQLXXXXXXXXXXXXLAISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRVNS 365
           TKA   +   L             A++  + GIF+FLKND L A   ++++I L P  NS
Sbjct: 326 TKATDEYHSLLRANKEDRVIRENAALAFCYAGIFQFLKNDLLDAQALLQESINLHPTPNS 385

Query: 366 YIYMALIMADRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKE 425
           Y++MAL +AD+ +S E++ +F  A+ LD      YYHRGQM FILQ+Y  A  DF KA+ 
Sbjct: 386 YVFMALTVADKENSQEFFKFFQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQS 445

Query: 426 LDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFEKAL 485
           L+P N++PYIQLACL Y+++KF + E+LF+EAK KFP  PEVP F+AEILTDK DF  A+
Sbjct: 446 LNPGNVYPYIQLACLLYKQDKFSEAESLFNEAKLKFPILPEVPTFYAEILTDKGDFNPAI 505

Query: 486 KQYDLAIELENKLDGIYVGIAPLVGKATLLTR----NPTV---ENFIEATNLLEEASKLD 538
           KQYD+A  LE     I+VGI PL+GKAT+L R    +PT    E F  A  LL +A +LD
Sbjct: 506 KQYDIAKRLEEVQKKIHVGIGPLIGKATILARQSSQDPTQLDEEKFNMAIELLTKACELD 565

Query: 539 PRSEQAKIGLAQMKLQQEDIDEAITLFEESADLARTMEEKLQAITFAEAAKVQKRIRSDP 598
           PRSEQAKIGLAQ++LQ E ID AI LF+ESA LARTM+EKLQA TFAEAAK+QKR+R+DP
Sbjct: 566 PRSEQAKIGLAQLELQMEKIDVAIKLFQESATLARTMDEKLQATTFAEAAKIQKRLRADP 625

Query: 599 ILAAKIQETLAKLREQGLM 617
           I++AK+++TLA  R QG++
Sbjct: 626 IISAKMEQTLANYRAQGMI 644

>NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON}
           Anc_2.152 YHR117W
          Length = 664

 Score =  542 bits (1397), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/557 (51%), Positives = 378/557 (67%), Gaps = 31/557 (5%)

Query: 72  PVYPVSSNGDPDFSNKANFTAEE---KDRYALALKDKGNQFFRNKKYDDAIKYYNWALEL 128
           P YP+ S  DPDF+      A     K ++A  LK+KGNQ+F++K  ++AIKYY +AL L
Sbjct: 128 PSYPLDSQNDPDFNEINKLIANNENLKSKFAKELKNKGNQYFKSKDNENAIKYYEYALRL 187

Query: 129 KDDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFD 188
             DPVFYSN+SACY ++  L KV+E S KALELKPDYSK LLRRA+A E LGN  +A++D
Sbjct: 188 DQDPVFYSNISACYFAMNQLDKVIESSNKALELKPDYSKALLRRANAYEALGNNKEALYD 247

Query: 189 LSVLSLNGDFNDASIEPMLERNLNKQAMSKLKEKFGDIDTATATPTELSTQAPKELKDKT 248
            S+LSL G+++   +EP+L R L+K +   L+ K  +                     KT
Sbjct: 248 FSILSLFGEYSGQYLEPLLNRILDKVSTDVLRAKLDN--------------------KKT 287

Query: 249 EN--LPSITSMASFFGIFKPELTFANYDESNEADKDLMNGLTNLYKRSPESYDKADESFT 306
           +N  L S +++ SFFGIF PE T  NY+  +EADK+L+ GL  L K++ E +  AD+ F 
Sbjct: 288 DNFILLSDSALVSFFGIFPPETTITNYNPDDEADKELVQGLEALAKKTSEGFLDADKHFI 347

Query: 307 KAVKLFDEQLXXXXXXXXXXXXL---AISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRV 363
           KA +LF E+L            L   AI+LE++G+FKFLK D LG+  D++KAI+L+PR 
Sbjct: 348 KANELFMEKLLSSEDNDENSGLLEKVAIALEYSGVFKFLKFDLLGSETDLQKAIDLYPRP 407

Query: 364 NSYIYMALIMADRNDS---TEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDF 420
           NSYIYMA+++AD+N+     +Y+ YFDKA  L+ N +  YYHRGQ+  + Q +D+A   F
Sbjct: 408 NSYIYMAMLVADKNNDKNDLDYFKYFDKATTLNPNFAPTYYHRGQLLLVNQKFDEAETFF 467

Query: 421 DKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKND 480
            KAKELD  N++PYIQLAC+AY  + F  C+ LF EA+ KFP  PEVP F+AEIL DK +
Sbjct: 468 LKAKELDDSNVYPYIQLACVAYYNSTFKKCQELFDEARTKFPTLPEVPTFYAEILADKGE 527

Query: 481 FEKALKQYDLAIELENKLDGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEEASKLDPR 540
            E A+KQYD+A  LE     I+VGIAPL+GKA  L R PT ENF   T LLE+A +LDPR
Sbjct: 528 LEAAMKQYDIAYRLETAYKYIHVGIAPLIGKAAALARIPTQENFDTMTELLEKACELDPR 587

Query: 541 SEQAKIGLAQMKLQQEDIDEAITLFEESADLARTMEEKLQAITFAEAAKVQKRIRSDPIL 600
           SEQAKI LAQ+KLQ EDID AI LFEE+ADLART ++KLQA TFAEAAK+QKRI+ +PI 
Sbjct: 588 SEQAKISLAQLKLQTEDIDTAIALFEETADLARTYQDKLQATTFAEAAKIQKRIKENPIY 647

Query: 601 AAKIQETLAKLREQGLM 617
           AAKI+ETLA  R  G++
Sbjct: 648 AAKIEETLATYRADGII 664

>NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {ON}
           Anc_5.617
          Length = 584

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 41/125 (32%), Positives = 65/125 (52%), Gaps = 3/125 (2%)

Query: 102 LKDKGNQFFRNKKYDDAIKYYNWALELKDDP--VFYSNLSACYVSVGDLKKVVEMSTKAL 159
           LK KGN  F +K +  AI+Y+  A+     P  V YSN SACY S+   ++ +  + + +
Sbjct: 7   LKQKGNAAFASKDFTGAIEYFTEAIAASTTPNHVLYSNRSACYTSLKQFQEALNDAQQCV 66

Query: 160 ELKPDYSKVLLRRASANEGLGNFADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMSKL 219
           ++ PD+SK   R  +A+ GLG+  DA  +    +L  D N+ +    LE+    Q   K 
Sbjct: 67  KINPDWSKGYNRMGAAHLGLGDLDDAESNYKK-ALELDSNNKAASEGLEQVHRVQESRKS 125

Query: 220 KEKFG 224
           +  FG
Sbjct: 126 RPDFG 130

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 37/128 (28%), Positives = 62/128 (48%), Gaps = 9/128 (7%)

Query: 42  NTITKDDKKEVKGSQKKTKDGSESTAESNTPVYPVSSNGDPDFSNKANFTAEEKDRYALA 101
           N++ K+ K+E    Q+K +   E   E NT   P+  + + D  N+      +    A A
Sbjct: 204 NSMPKEPKEEQTSEQQKPEPTKE---EKNTEPEPMDVDQEGD--NEGEDETAKAIAAADA 258

Query: 102 LKDKGNQFFRNKKYDDAIKYYNWALELKDDPVFYSNLSACYVSVGDLKKVV----EMSTK 157
            K +GN+ +++ K+D+AI  YN A +L  D  + +N SA     GD +  +    E   +
Sbjct: 259 AKAEGNKLYKSHKFDEAIAEYNKAWDLHKDITYLNNRSAAEFEKGDFETAMNTLNEAVEQ 318

Query: 158 ALELKPDY 165
             EL+ DY
Sbjct: 319 GRELRADY 326

 Score = 37.7 bits (86), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 21/85 (24%), Positives = 43/85 (50%), Gaps = 1/85 (1%)

Query: 106 GNQFFRNKKYDDAIKYYNWALE-LKDDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPD 164
           G ++F    + +A+K Y   ++   +D   YSN +A    +    + ++   KA+E  P+
Sbjct: 397 GKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIKDCEKAIEKDPN 456

Query: 165 YSKVLLRRASANEGLGNFADAMFDL 189
           + +  LR+A+A   + +F  A+  L
Sbjct: 457 FVRAYLRKATAQIAIKDFVKALETL 481

>TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {ON}
           Anc_5.617 YOR027W
          Length = 582

 Score = 60.5 bits (145), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 32/85 (37%), Positives = 51/85 (60%), Gaps = 2/85 (2%)

Query: 103 KDKGNQFFRNKKYDDAIKYYNWALELKDDP--VFYSNLSACYVSVGDLKKVVEMSTKALE 160
           KD+GN  F  K YD+AI+ +  A+E+ + P  V YSN SACY S     K +E + + ++
Sbjct: 9   KDQGNAAFVAKNYDEAIEKFTKAIEVSETPNHVLYSNRSACYTSKKQFVKGLEDANECVK 68

Query: 161 LKPDYSKVLLRRASANEGLGNFADA 185
           + P +SK   R  +A+ G+G+  +A
Sbjct: 69  INPTWSKGYNRVGAAHFGMGDLDEA 93

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 52/98 (53%), Gaps = 4/98 (4%)

Query: 75  PVSSNGDPDFSNKANFTAEEKDRYALALKDKGNQFFRNKKYDDAIKYYNWALELKDDPVF 134
           P  S   P+   +A+   +E    A A K +GN+ ++  K+D+AI++YN A EL +D  +
Sbjct: 231 PKKSETVPEPKEEASTPEDESKIAADAEKAEGNKLYKAHKFDEAIEHYNKAWELHNDITY 290

Query: 135 YSNLSACYVSVGDLKKVVEMSTKAL----ELKPDYSKV 168
            +N SA     GD +  +E   +A+    E++ DY  V
Sbjct: 291 LNNRSAAEFEKGDYQTAIETLHEAVEKGREMRADYKLV 328

 Score = 32.0 bits (71), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 19/85 (22%), Positives = 39/85 (45%), Gaps = 1/85 (1%)

Query: 106 GNQFFRNKKYDDAIKYYNWALEL-KDDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPD 164
           G ++F    + +A+K Y   +     D   YSN +A    +    + +     A+E  P+
Sbjct: 396 GKEYFTKGDWPNAVKAYTEMIARDPSDARGYSNRAAALSKLMSFPEAITDCNTAIEKDPN 455

Query: 165 YSKVLLRRASANEGLGNFADAMFDL 189
           + +  +R+A+A   + +F  A+  L
Sbjct: 456 FIRAYIRKATAQIAIKDFVPAIETL 480

>KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]
           {ON} highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123C
          Length = 513

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 35/103 (33%), Positives = 58/103 (56%), Gaps = 1/103 (0%)

Query: 91  TAEEKDRYALALKDKGNQFFRNKKYDDAIKYYNWALELKD-DPVFYSNLSACYVSVGDLK 149
            +EE  + AL  K++GN F + KKY +A++YY+ A+EL D   +F+SN +   + + +  
Sbjct: 4   VSEEAAQKALEFKNQGNAFIKEKKYPEAVEYYSKAIELDDTQSIFFSNRAFSRLKLDNFL 63

Query: 150 KVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDLSVL 192
             +E   K++EL P   K + RR  +  GL  F+ A  DL  +
Sbjct: 64  TALEDCNKSIELDPKNIKAIHRRGLSYVGLLEFSKARKDLKTI 106

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 29/51 (56%)

Query: 381 EYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENI 431
           E   Y+ KA++LD   S  + +R      L N+  A +D +K+ ELDP+NI
Sbjct: 30  EAVEYYSKAIELDDTQSIFFSNRAFSRLKLDNFLTALEDCNKSIELDPKNI 80

>AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR027W (STI1)
          Length = 580

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 51/85 (60%), Gaps = 2/85 (2%)

Query: 103 KDKGNQFFRNKKYDDAIKYYNWALELKDDP--VFYSNLSACYVSVGDLKKVVEMSTKALE 160
           K +GN  F  K ++ AI+ +  A+E+ + P  V YSN SACY S+   ++ +  + + + 
Sbjct: 8   KKEGNSAFAAKDFEKAIELFGKAIEVSEQPNHVLYSNRSACYASMRKFREALADAQECVR 67

Query: 161 LKPDYSKVLLRRASANEGLGNFADA 185
           +KPD+SK   R  +A+ GLG+  +A
Sbjct: 68  IKPDWSKGHNRLGAAHYGLGDLDEA 92

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 42/181 (23%), Positives = 82/181 (45%), Gaps = 23/181 (12%)

Query: 103 KDKGNQFFRNKKYDDAIKYYNWALELKDDPVFYSNLSACYVSVGDLKKVVEMSTKAL--- 159
           K KGN+ ++ +++D+AI  Y  A +L  D  + +N +A     GD +  ++   KA+   
Sbjct: 258 KAKGNELYKKRQFDEAIANYEKAWDLHKDITYLNNRAAAEYEKGDYESAIKTLEKAVEEG 317

Query: 160 -ELKPDY---SKVLLRRASANEGLGNFADAM--FDLSVL------------SLNGDFNDA 201
            EL+ DY   +K   R  +A+  L +   A+  ++ S+             SL  +    
Sbjct: 318 RELRADYKVIAKSFARLGNAHYKLADLKKAIEYYEKSLTEHRTPEVLNKLRSLEKEQKKR 377

Query: 202 SIEPMLERNLNKQAMSKLKEKFGDIDTATATP--TELSTQAPKELKDKTENLPSITSMAS 259
             E  ++    ++A  + KE F + D   A    TE+  +AP++ +  +    ++  + S
Sbjct: 378 EAEAYIDPEKAEEARLQGKEYFTNADWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMS 437

Query: 260 F 260
           F
Sbjct: 438 F 438

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/86 (22%), Positives = 43/86 (50%), Gaps = 1/86 (1%)

Query: 105 KGNQFFRNKKYDDAIKYYNWALE-LKDDPVFYSNLSACYVSVGDLKKVVEMSTKALELKP 163
           +G ++F N  + +A+K Y   ++   +D   YSN +A    +      ++    A++  P
Sbjct: 394 QGKEYFTNADWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPDAIKDCDMAIQKDP 453

Query: 164 DYSKVLLRRASANEGLGNFADAMFDL 189
           ++ +  +R+A+A   +  +A A+  L
Sbjct: 454 NFVRAYIRKATAQIAVQEYAAAIETL 479

>NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa]
           {ON} Anc_3.481
          Length = 523

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 73/144 (50%), Gaps = 2/144 (1%)

Query: 94  EKDRYALALKDKGNQFFRNKKYDDAIKYYNWALEL-KDDPVFYSNLSACYVSVGDLKKVV 152
           E  + A+ LK++GN++ + KKY  A++YY  A+EL     +F+SN +   + + + +  +
Sbjct: 8   EAAQQAIDLKNEGNKYIKEKKYTKAVEYYTKAIELDSTQSIFFSNRALAQLKLDNFQSCL 67

Query: 153 EMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDLSVLSLNGDFNDASIEPMLERNLN 212
           +    ALEL P   K   RR  +  GL +F  A  DLS++ L    +DA+ +  L+    
Sbjct: 68  DDCNSALELDPKNIKAYHRRGLSQLGLLHFKKAKNDLSIV-LKAKPSDATAKRALDMCEK 126

Query: 213 KQAMSKLKEKFGDIDTATATPTEL 236
                + K+  G  DT    P ++
Sbjct: 127 VIREERFKKAIGGDDTDRVNPCQV 150

 Score = 37.7 bits (86), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 37/74 (50%), Gaps = 5/74 (6%)

Query: 380 TEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPY----- 434
           T+   Y+ KA++LDS  S  + +R      L N+     D + A ELDP+NI  Y     
Sbjct: 30  TKAVEYYTKAIELDSTQSIFFSNRALAQLKLDNFQSCLDDCNSALELDPKNIKAYHRRGL 89

Query: 435 IQLACLAYRENKFD 448
            QL  L +++ K D
Sbjct: 90  SQLGLLHFKKAKND 103

>KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027W STI1 Heat shock protein also induced
           by canavanine and entry into stationary phase
          Length = 581

 Score = 58.2 bits (139), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 51/86 (59%), Gaps = 2/86 (2%)

Query: 102 LKDKGNQFFRNKKYDDAIKYYNWALELKDDP--VFYSNLSACYVSVGDLKKVVEMSTKAL 159
            K +GNQ F +K Y  AI+ +  A+E+ + P  V +SN SACY S  D  K ++ + + +
Sbjct: 6   FKQEGNQAFASKDYAKAIELFTKAIEVSEQPNHVLFSNRSACYASNKDFVKALDDANECV 65

Query: 160 ELKPDYSKVLLRRASANEGLGNFADA 185
           ++ P ++K   R  +A+ GLG+  +A
Sbjct: 66  KINPSWAKGYNRLGAAHYGLGDLDEA 91

 Score = 51.6 bits (122), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 52/95 (54%), Gaps = 7/95 (7%)

Query: 99  ALALKDKGNQFFRNKKYDDAIKYYNWALELKDDPVFYSNLSACYVSVGDLKKVVEMSTKA 158
           A A K +GN+ ++ +K+D+AI+ YN A E  +D  + +N +A     GD +  +E  TKA
Sbjct: 255 AEAAKAEGNKLYKQRKFDEAIEKYNEAWETHNDITYLNNRAAAEYEKGDYEAAIETLTKA 314

Query: 159 L----ELKPDY---SKVLLRRASANEGLGNFADAM 186
           +    EL+ DY   SK   R  ++   LG+   A+
Sbjct: 315 VEQGRELRADYKVISKSFARMGNSYHKLGDLKKAI 349

 Score = 31.6 bits (70), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 18/86 (20%), Positives = 41/86 (47%), Gaps = 1/86 (1%)

Query: 105 KGNQFFRNKKYDDAIKYYNWALELK-DDPVFYSNLSACYVSVGDLKKVVEMSTKALELKP 163
           +G ++F    +  A++ Y   ++   +D   YSN +A    +      +    KA+E  P
Sbjct: 395 QGKEYFTKADWPKAVEAYTEMIKRNPNDARGYSNRAAALSKLMSFADAIRDCDKAIEKDP 454

Query: 164 DYSKVLLRRASANEGLGNFADAMFDL 189
           ++ +  +R+A+    + ++A A+  L
Sbjct: 455 NFVRAYIRKATGQIAIKDYAGAIETL 480

>ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR007C (SGT2)
          Length = 327

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 45/129 (34%), Positives = 65/129 (50%), Gaps = 8/129 (6%)

Query: 71  TPVYPVSSNGDPDFSNKANFTAEEKDRYALALKDKGNQFFRNKKYDDAIKYYNWALE-LK 129
           T +   S  G+P  +      AEE  + A ALK +GN+    K Y+ AI+ Y  A+E L 
Sbjct: 68  TGMAHTSDAGEPKVA------AEELKKEAEALKLEGNRAMAAKDYETAIQKYTAAIEVLP 121

Query: 130 DDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDL 189
            D V+Y+N +A Y S+   +K VE + KA ++   YSK   R   A   LG   +A+   
Sbjct: 122 TDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKYALGRHEEALEAY 181

Query: 190 -SVLSLNGD 197
             VL + GD
Sbjct: 182 KRVLDIEGD 190

>Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON}
           complement(15762..16793) [1032 nt, 344 aa]
          Length = 343

 Score = 56.6 bits (135), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 57/108 (52%), Gaps = 2/108 (1%)

Query: 92  AEEKDRYALALKDKGNQFFRNKKYDDAIKYYNWALEL-KDDPVFYSNLSACYVSVGDLKK 150
           +E+K + A ALK +GN+    K Y  AI  Y+ A+E+   +P +YSN +A Y  + D   
Sbjct: 91  SEDKKKEAEALKLEGNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTN 150

Query: 151 VVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDL-SVLSLNGD 197
            V  +  A++L P YSK   R  +A    GN  DA+     VL L GD
Sbjct: 151 AVLDANTAIKLDPTYSKAYSRLGAAKLAEGNNEDAVHAFKKVLELEGD 198

>Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027W
           (STI1) - Heat shock protein also induced by canavanine
           and entry into stationary phase [contig 159] FULL
          Length = 593

 Score = 57.4 bits (137), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 49/86 (56%), Gaps = 2/86 (2%)

Query: 102 LKDKGNQFFRNKKYDDAIKYYNWALELKDDP--VFYSNLSACYVSVGDLKKVVEMSTKAL 159
            K +GN  F  K ++ A + ++ A+E  + P  V YSN SACY S+   K+ +E + + +
Sbjct: 6   FKKQGNAAFVAKDFEKAAELFSKAIESSETPNHVLYSNRSACYTSLKKFKEALEDAEECV 65

Query: 160 ELKPDYSKVLLRRASANEGLGNFADA 185
           ++ P +SK   R  +A  GLGN  DA
Sbjct: 66  KINPTWSKGYNRVGAAQYGLGNLDDA 91

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 35/121 (28%), Positives = 64/121 (52%), Gaps = 26/121 (21%)

Query: 57  KKTKDGSESTAESNTPVYPVSSNGD--------PDFSNKANFTAEEKDRYALALKDKGNQ 108
           K   +  +STAES+     +S++ D        P+  +KA   AE         K +GN+
Sbjct: 231 KPAPEAKKSTAESD-----LSADADKMEVDEPEPEQDSKAKADAE---------KAEGNK 276

Query: 109 FFRNKKYDDAIKYYNWALELKDDPVFYSNLSACYVSVGDLKKVVEMSTKAL----ELKPD 164
           +++ +K+D+AI++YN A +L  D  + +N SA     GD ++ ++  T+A+    E++ D
Sbjct: 277 YYKARKFDEAIEHYNKAWDLHRDVTYLNNRSAAEYEKGDYEQAIKTLTEAVDQGREMRAD 336

Query: 165 Y 165
           Y
Sbjct: 337 Y 337

 Score = 34.7 bits (78), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 26/106 (24%), Positives = 45/106 (42%), Gaps = 6/106 (5%)

Query: 105 KGNQFFRNKKYDDAIKYYNWALE-LKDDPVFYSNLSACYVSVGDLKKVVEMSTKALELKP 163
           +G +FF    +  A+  Y   ++   +D   YSN +A    +      ++    A+   P
Sbjct: 407 QGKEFFTKGDWPSAVSAYTEMIKRAPEDARGYSNRAAVLAKLMSFPDAIKDCDVAISKDP 466

Query: 164 DYSKVLLRRASANEGLGNFADAMFDLSV-----LSLNGDFNDASIE 204
           ++ +  +R+ASA   +  FA AM  L       L +N   N   IE
Sbjct: 467 NFVRAYIRKASAQIAVREFAPAMETLDAARAKDLEINKGANAREIE 512

>YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90
           cochaperone, interacts with the Ssa group of the
           cytosolic Hsp70 chaperones and activates Ssa1p ATPase
           activity; interacts with Hsp90 chaperones and inhibits
           their ATPase activity; homolog of mammalian Hop
          Length = 589

 Score = 57.0 bits (136), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 48/85 (56%), Gaps = 2/85 (2%)

Query: 103 KDKGNQFFRNKKYDDAIKYYNWALELKDDP--VFYSNLSACYVSVGDLKKVVEMSTKALE 160
           K +GN  F  K YD AI+ +  A+E+ + P  V YSN SACY S+      +  + + ++
Sbjct: 9   KQQGNAAFTAKDYDKAIELFTKAIEVSETPNHVLYSNRSACYTSLKKFSDALNDANECVK 68

Query: 161 LKPDYSKVLLRRASANEGLGNFADA 185
           + P +SK   R  +A+ GLG+  +A
Sbjct: 69  INPSWSKGYNRLGAAHLGLGDLDEA 93

 Score = 44.7 bits (104), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 47/87 (54%), Gaps = 7/87 (8%)

Query: 103 KDKGNQFFRNKKYDDAIKYYNWALELKDDPVFYSNLSACYVSVGDLKKVVEMSTKAL--- 159
           K +GN+F++ +++D+AI++YN A EL  D  + +N +A     G+ +  +     A+   
Sbjct: 266 KAEGNKFYKARQFDEAIEHYNKAWELHKDITYLNNRAAAEYEKGEYETAISTLNDAVEQG 325

Query: 160 -ELKPDY---SKVLLRRASANEGLGNF 182
            E++ DY   SK   R  +A   LG+ 
Sbjct: 326 REMRADYKVISKSFARIGNAYHKLGDL 352

 Score = 36.6 bits (83), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 22/99 (22%), Positives = 49/99 (49%), Gaps = 2/99 (2%)

Query: 106 GNQFFRNKKYDDAIKYYNWALE-LKDDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPD 164
           G ++F    + +A+K Y   ++   +D   YSN +A    +    + +    KA+E  P+
Sbjct: 403 GKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPN 462

Query: 165 YSKVLLRRASANEGLGNFADAMFDL-SVLSLNGDFNDAS 202
           + +  +R+A+A   +  +A A+  L +  + + + N+ S
Sbjct: 463 FVRAYIRKATAQIAVKEYASALETLDAARTKDAEVNNGS 501

>SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 585

 Score = 57.0 bits (136), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 48/85 (56%), Gaps = 2/85 (2%)

Query: 103 KDKGNQFFRNKKYDDAIKYYNWALELKDDP--VFYSNLSACYVSVGDLKKVVEMSTKALE 160
           K +GN  F  K ++ AI+ +  A+E+ + P  V YSN SACY S     K +E + + + 
Sbjct: 7   KQQGNAAFAAKDFEKAIELFTKAIEVSEKPNHVLYSNRSACYTSTKQFNKALEDAKQCVN 66

Query: 161 LKPDYSKVLLRRASANEGLGNFADA 185
           + P +SK   R  +A+ GLG+  +A
Sbjct: 67  INPAWSKGYNRVGAAHFGLGDLDEA 91

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 53/243 (21%), Positives = 108/243 (44%), Gaps = 24/243 (9%)

Query: 42  NTITKDDKKEVKGSQKKTKDGSESTAESNTP-VYPVSSNGDPDFSNKANFTAEEKDRYAL 100
           N+I KD   + + ++ K ++   + + +  P   P  S  +P   ++     E     A 
Sbjct: 201 NSIPKDGPVQPQNTESKAEEEKPNVSSTQIPKAAPSESKPEPMEVDEPEQEEESSKAKAD 260

Query: 101 ALKDKGNQFFRNKKYDDAIKYYNWALELKDDPVFYSNLSACYVSVGDLKKVVEMSTKAL- 159
           A K +GN+F++ +K+D+AI++Y+ A EL  D  + +N +A     G+ +  ++  T+A+ 
Sbjct: 261 AEKAEGNKFYKARKFDEAIEHYSKAWELHKDITYLNNRAAAEYEKGEYETAIKTLTEAVE 320

Query: 160 ---ELKPDY---SKVLLRRASANEGLGNFADAM--------------FDLSVLSLNGDFN 199
              EL+ DY   SK   R  ++   L     A+                  + +   +  
Sbjct: 321 QGRELRADYKVISKSFARIGNSYHKLNELKKAIEFYQKSLTEHRTPEILTKLRNCEKELK 380

Query: 200 DASIEPMLERNLNKQAMSKLKEKF--GDIDTATATPTELSTQAPKELKDKTENLPSITSM 257
               E  ++    ++A  + KE F  GD   A  + TE+  +AP++ +  +    +++ +
Sbjct: 381 KQETEAYIDPEKAEEARLQGKEYFTKGDWPNAVKSYTEMIKRAPEDARGYSNRAAALSKL 440

Query: 258 ASF 260
            SF
Sbjct: 441 MSF 443

>Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W
           (REAL)
          Length = 586

 Score = 57.0 bits (136), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 47/85 (55%), Gaps = 2/85 (2%)

Query: 103 KDKGNQFFRNKKYDDAIKYYNWALELKDDP--VFYSNLSACYVSVGDLKKVVEMSTKALE 160
           K +GN  F  K Y  AI  +  A+E+ + P  V YSN SACY S+      +  +T+ ++
Sbjct: 9   KQQGNAAFTAKDYGKAIDLFTKAIEVSEAPNHVLYSNRSACYTSLKKFTDALNDATECVK 68

Query: 161 LKPDYSKVLLRRASANEGLGNFADA 185
           + P +SK   R  +A+ GLG+  DA
Sbjct: 69  INPSWSKGYNRLGAAHLGLGDLDDA 93

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 48/87 (55%), Gaps = 7/87 (8%)

Query: 103 KDKGNQFFRNKKYDDAIKYYNWALELKDDPVFYSNLSACYVSVGDLKKVVEMSTKAL--- 159
           K +GN+F++ +++++AI++YN A EL  D  + +N +A     GD +  +   T A+   
Sbjct: 263 KAEGNKFYKARQFEEAIEHYNKAWELHRDITYLNNRAAAEYEKGDYETAIATLTDAVEQG 322

Query: 160 -ELKPDY---SKVLLRRASANEGLGNF 182
            E++ DY   SK   R  +A   LG+ 
Sbjct: 323 REMRADYKVISKSFARIGNAYHKLGDL 349

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 21/85 (24%), Positives = 42/85 (49%), Gaps = 1/85 (1%)

Query: 106 GNQFFRNKKYDDAIKYYNWALELK-DDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPD 164
           G ++F    + +A+K Y   ++   +D   YSN +A    +    + +    KA+E  P+
Sbjct: 400 GKEYFTKSDWPNAVKAYTEMIKRSPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPN 459

Query: 165 YSKVLLRRASANEGLGNFADAMFDL 189
           + +  +R+A+A   +  FA A+  L
Sbjct: 460 FVRAYIRKATAQIAVQEFAGALETL 484

>CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027w STI1
          Length = 583

 Score = 57.0 bits (136), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 50/85 (58%), Gaps = 2/85 (2%)

Query: 103 KDKGNQFFRNKKYDDAIKYYNWALELKDDP--VFYSNLSACYVSVGDLKKVVEMSTKALE 160
           K +GN  F  K Y+ AI  ++ A+E+ + P  VFYSN SACY S+    + +  + + ++
Sbjct: 8   KQQGNAAFVAKDYEKAIDLFSKAIEVSETPNHVFYSNRSACYASLKKFPEALNDAEECVK 67

Query: 161 LKPDYSKVLLRRASANEGLGNFADA 185
           + P +SK   R  +A+ GLG+  +A
Sbjct: 68  INPTWSKGYNRLGAAHLGLGDLDEA 92

 Score = 39.7 bits (91), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 43/88 (48%), Gaps = 7/88 (7%)

Query: 106 GNQFFRNKKYDDAIKYYNWALELKDDPVFYSNLSACYVSVGD----LKKVVEMSTKALEL 161
           GN+ ++ +++D+AI +Y+ A  L  D  + +N SA     GD    LK + E   K  E+
Sbjct: 263 GNKAYKARQFDEAIAHYDAAWNLHQDITYLNNRSAAEFEKGDAETALKTLDEAVEKGREM 322

Query: 162 KPDY---SKVLLRRASANEGLGNFADAM 186
           + DY   +K   R  + +    N   A+
Sbjct: 323 RTDYKLIAKSFARMGNVHHKTNNLKKAI 350

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 43/86 (50%), Gaps = 1/86 (1%)

Query: 105 KGNQFFRNKKYDDAIKYYNWALE-LKDDPVFYSNLSACYVSVGDLKKVVEMSTKALELKP 163
           +G  +F    + +A+K Y   ++   +D   YSN +A    +    + +E   KA+E  P
Sbjct: 396 EGKDYFTKGDWPNAVKAYTEMIKRAPEDARGYSNRAAALSKLMSFPEAIEDCNKAIEKDP 455

Query: 164 DYSKVLLRRASANEGLGNFADAMFDL 189
           ++ +  +R+A+A   +  FA A+  L
Sbjct: 456 NFIRAYIRKATAQIAVKEFAAAIETL 481

>Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 37/124 (29%), Positives = 63/124 (50%), Gaps = 3/124 (2%)

Query: 103 KDKGNQFFRNKKYDDAIKYYNWALELKDDP--VFYSNLSACYVSVGDLKKVVEMSTKALE 160
           K +GN  F  K YD AI+ +  A+E+ + P  V +SN SACY S+      +  + + ++
Sbjct: 9   KQQGNAAFTAKNYDGAIELFTKAIEVSETPSHVLFSNRSACYTSLKKFSDALNDANECVK 68

Query: 161 LKPDYSKVLLRRASANEGLGNFADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMSKLK 220
           + P +SK   R  +A+ GLG+  +A  D    +L  D N+ + +  LE+    Q   + +
Sbjct: 69  INPSWSKGYNRLGAAHLGLGDLDEAESDYKK-ALELDANNKAAKDGLEQVHRTQQARQAQ 127

Query: 221 EKFG 224
              G
Sbjct: 128 PDLG 131

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 47/87 (54%), Gaps = 7/87 (8%)

Query: 103 KDKGNQFFRNKKYDDAIKYYNWALELKDDPVFYSNLSACYVSVGDLKKVVEMSTKALE-- 160
           K +GN+F++  ++D+AI++YN A EL  D  + +N +A     GD + V+     A+E  
Sbjct: 266 KAEGNKFYKAHQFDEAIEHYNRAWELHKDITYLNNRAAAEYEKGDYETVIATLNDAVEKG 325

Query: 161 --LKPDY---SKVLLRRASANEGLGNF 182
             ++ DY   SK   R  +A   LG+ 
Sbjct: 326 RDMRADYKVISKSFARIGNAYHKLGDL 352

 Score = 37.0 bits (84), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 43/88 (48%), Gaps = 1/88 (1%)

Query: 105 KGNQFFRNKKYDDAIKYYNWALE-LKDDPVFYSNLSACYVSVGDLKKVVEMSTKALELKP 163
           +G ++F    + +A+K Y   ++   +D   YSN +A    +    + +    KA+E  P
Sbjct: 402 EGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDP 461

Query: 164 DYSKVLLRRASANEGLGNFADAMFDLSV 191
           ++ +  +R A+A   +  FA A+  L V
Sbjct: 462 NFVRAYIRMAAAQIAVKEFAAALETLDV 489

>KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {ON}
           Anc_5.617 YOR027W
          Length = 579

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 48/85 (56%), Gaps = 2/85 (2%)

Query: 103 KDKGNQFFRNKKYDDAIKYYNWALELKDDP--VFYSNLSACYVSVGDLKKVVEMSTKALE 160
           K +GN  F  KKYD+A+  +  A+E+ + P  V YSN SA Y S     + ++ + +  +
Sbjct: 9   KQQGNSAFAAKKYDEAVDLFTKAIEVSETPNHVLYSNRSASYASEQKFNEALKDALECTK 68

Query: 161 LKPDYSKVLLRRASANEGLGNFADA 185
           + P ++K   R  +A+ G+GN  DA
Sbjct: 69  INPSWAKGYTREGAAHFGMGNLDDA 93

 Score = 38.9 bits (89), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 46/91 (50%), Gaps = 7/91 (7%)

Query: 103 KDKGNQFFRNKKYDDAIKYYNWALELKDDPVFYSNLSACYVSVGDLKKVV----EMSTKA 158
           K +GN+ ++ + +D+AI  YN A EL ++  + +N SA     G+    +    E   K 
Sbjct: 255 KVEGNKAYKARNFDEAIACYNKAWELDNNITYLNNRSAAEFEKGEYDTAINTLNEAIEKG 314

Query: 159 LELKPDY---SKVLLRRASANEGLGNFADAM 186
            E++ DY   +K   R  +A   +GN  +A+
Sbjct: 315 REMRADYKIIAKSFARIGNAYVKMGNLKEAI 345

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 24/108 (22%), Positives = 49/108 (45%), Gaps = 6/108 (5%)

Query: 105 KGNQFFRNKKYDDAIKYYNWALE-LKDDPVFYSNLSACYVSVGDLKKVVEMSTKALELKP 163
           +G ++F    +  A+K Y   ++   +D   YSN +A    +      +    KA+E  P
Sbjct: 391 EGKEYFTKGDWPSAVKAYTEMIKRAPEDARGYSNRAAALSKLMSFPDAISDCNKAIEKDP 450

Query: 164 DYSKVLLRRASANEGLGNFADAMFDLSV-----LSLNGDFNDASIEPM 206
           ++ +  +R+A+A   + +F+ A+  L         +NG  N   I+ +
Sbjct: 451 NFVRAYIRKATAQIAVKDFSYAIETLDAARTKDAEVNGGANAREIDQL 498

>Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 55.5 bits (132), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 46/85 (54%), Gaps = 2/85 (2%)

Query: 103 KDKGNQFFRNKKYDDAIKYYNWALELKDDP--VFYSNLSACYVSVGDLKKVVEMSTKALE 160
           K +GN  F  K YD AI+ +  A+E+   P  V YSN SACY S+      +  + + + 
Sbjct: 9   KQQGNSAFTAKDYDKAIELFTKAIEVSKTPNHVLYSNRSACYASLKKFSDALNDAKECIN 68

Query: 161 LKPDYSKVLLRRASANEGLGNFADA 185
           + P +SK   R  +A+ GLG+  +A
Sbjct: 69  INPSWSKGYNRLGAAHLGLGDLDEA 93

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/139 (28%), Positives = 66/139 (47%), Gaps = 16/139 (11%)

Query: 53  KGSQKKTKDGSESTAESNTPVYPVSSNGDPDFSNKANFTAEEKDRYALALKDK--GNQFF 110
           K S+ +    +E    SNTP    +   DP          +E D  A A K+K  GN+F+
Sbjct: 221 KDSESQNNPTTEKEDSSNTPQREENKESDP-------MEVDEDDSKAEADKEKAEGNKFY 273

Query: 111 RNKKYDDAIKYYNWALELKDDPVFYSNLSACYVSVGDLKKVVEMSTKAL----ELKPDY- 165
           + +++D+AI++YN A EL  D  + +N +A     G+ K  +     A+    E++ DY 
Sbjct: 274 KARQFDEAIEHYNKAWELHRDITYLNNRAAAEYEKGEYKTAIATLNDAVEQGREMRADYK 333

Query: 166 --SKVLLRRASANEGLGNF 182
             S+   R  +A   LG+ 
Sbjct: 334 VISRSFARIGNAYHKLGDL 352

 Score = 35.0 bits (79), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 22/99 (22%), Positives = 48/99 (48%), Gaps = 2/99 (2%)

Query: 106 GNQFFRNKKYDDAIKYYNWALE-LKDDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPD 164
           G  +F    + +A+K Y   ++   +D   YSN +A    +    + +    KA+E  P+
Sbjct: 403 GKDYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPN 462

Query: 165 YSKVLLRRASANEGLGNFADAMFDL-SVLSLNGDFNDAS 202
           + +  +R+A+A   +  +A A+  L +  + + D N+ +
Sbjct: 463 FVRAYIRKATAQIAVQEYAAALETLDAARTKDADVNNGA 501

>TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.617
           YOR027W
          Length = 585

 Score = 55.5 bits (132), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 40/131 (30%), Positives = 67/131 (51%), Gaps = 10/131 (7%)

Query: 65  STAESNTPVYPVSSNGDPDFSNKANFTAEEKD---RYALALKDKGNQFFRNKKYDDAIKY 121
           +T E+ T   P S   +P  +N  N   ++ D   + A A KD+GN+ ++  K+D+AI++
Sbjct: 221 ATKETKTETVPESKEKEPVAANPENMEVDDADVQKKLADAEKDEGNKLYKAHKFDEAIEH 280

Query: 122 YNWALELKDDPVFYSNLSACYVSVGD----LKKVVEMSTKALELKPDY---SKVLLRRAS 174
           Y+ A EL +D  + +N +A     GD    +K + +   K  EL+ DY   +K   R  +
Sbjct: 281 YDKAWELHNDITYLNNKAAAQYEKGDYETTIKTLEDAIEKGRELRADYKIIAKAFTRMGN 340

Query: 175 ANEGLGNFADA 185
           A E L +   A
Sbjct: 341 AYEKLNDLKKA 351

 Score = 53.9 bits (128), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 48/85 (56%), Gaps = 2/85 (2%)

Query: 103 KDKGNQFFRNKKYDDAIKYYNWALELKDDP--VFYSNLSACYVSVGDLKKVVEMSTKALE 160
           K +GN  F  K+Y+ A+  ++ A+E+  +P  V YSN SACY S+      +  + +  +
Sbjct: 9   KQQGNTAFSAKEYEKAVDLFSKAIEVSPEPNHVLYSNRSACYTSLKKFTDALNDANECTK 68

Query: 161 LKPDYSKVLLRRASANEGLGNFADA 185
           + P +SK   R  +A+ GLG+  +A
Sbjct: 69  INPTWSKGYNRVGAAHYGLGDLDEA 93

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 49/100 (49%), Gaps = 2/100 (2%)

Query: 105 KGNQFFRNKKYDDAIKYYNWAL-ELKDDPVFYSNLSACYVSVGDLKKVVEMSTKALELKP 163
           +G  FF   ++ DA+K Y   +    DD   YSN +A    +    + +    KALE  P
Sbjct: 398 QGKDFFNKGQWPDAVKAYTEMIARAPDDARAYSNRAAALSKLMSFPEAISDCEKALEKDP 457

Query: 164 DYSKVLLRRASANEGLGNFADAMFDLSVL-SLNGDFNDAS 202
           ++ K  +R+A+A   +  ++ A+  L +  S + + N+ S
Sbjct: 458 NFVKAYIRKATAQIAIKEYSSALETLDIARSKDTELNNGS 497

>Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON}
           similar to Ashbya gossypii ACR005W
          Length = 318

 Score = 52.8 bits (125), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 41/125 (32%), Positives = 62/125 (49%), Gaps = 3/125 (2%)

Query: 75  PVSSNGDPDFSNKANFTAEEKDRYALALKDKGNQFFRNKKYDDAIKYYNWALEL-KDDPV 133
           P  S+ +P  +N      E  +R A  LK +GN+ F  K ++ A+K Y  A+EL  ++ V
Sbjct: 73  PTLSSSEPTGNNTDAHAPEVAER-AENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAV 131

Query: 134 FYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDL-SVL 192
           FY N +A Y S    ++ V  +  A+ + P YS+   R   A   LG   +AM     VL
Sbjct: 132 FYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVL 191

Query: 193 SLNGD 197
            + GD
Sbjct: 192 DIEGD 196

>NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}
          Length = 583

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 48/85 (56%), Gaps = 2/85 (2%)

Query: 103 KDKGNQFFRNKKYDDAIKYYNWALELKDDP--VFYSNLSACYVSVGDLKKVVEMSTKALE 160
           K +GN  F +K ++ AI+ +  A+E+   P  V YSN SA Y S    ++ +  +T+ ++
Sbjct: 9   KQQGNAAFTSKDFNKAIELFTKAIEVSPTPNHVLYSNRSAAYTSAKQFQEALNDATECVK 68

Query: 161 LKPDYSKVLLRRASANEGLGNFADA 185
           + P +SK   R  +A  GLGN  +A
Sbjct: 69  INPTWSKGYNRLGAAEFGLGNLEEA 93

 Score = 39.3 bits (90), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 36/67 (53%), Gaps = 4/67 (5%)

Query: 103 KDKGNQFFRNKKYDDAIKYYNWALELKDDPVFYSNLSACYVSVGDLKKVVEMSTKAL--- 159
           K +GN+ ++  K+D+AI+ YN A  L  D  + +N SA     GD +  +    +A+   
Sbjct: 259 KVEGNKLYKAHKFDEAIEQYNKAWALNKDITYLNNRSAAEFEKGDFETAIATLNEAVDQG 318

Query: 160 -ELKPDY 165
            EL+ DY
Sbjct: 319 RELRADY 325

 Score = 32.7 bits (73), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 17/82 (20%), Positives = 43/82 (52%), Gaps = 1/82 (1%)

Query: 106 GNQFFRNKKYDDAIKYYNWALE-LKDDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPD 164
           G ++F    + +A+K Y+  ++   +D   YSN +A    +    + ++    A++  P+
Sbjct: 396 GKEYFTKGDWPNAVKAYSEMIKRAPEDARGYSNRAAALSKLMSFPEAIKDCDNAIKKDPN 455

Query: 165 YSKVLLRRASANEGLGNFADAM 186
           + +  +R+A+A   +  +A+A+
Sbjct: 456 FVRAYIRKATAQIAIKEYANAL 477

>Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON}
           (197149..198921) [1773 nt, 591 aa]
          Length = 590

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 49/85 (57%), Gaps = 2/85 (2%)

Query: 103 KDKGNQFFRNKKYDDAIKYYNWALELKDDP--VFYSNLSACYVSVGDLKKVVEMSTKALE 160
           K +GN  F  K YD AI  ++ A+++ + P  V YSN SACY S+      ++ + + ++
Sbjct: 9   KQQGNAAFVAKDYDKAIDLFSKAIDVSEQPNHVLYSNRSACYTSLKKFVNALKDAEECVK 68

Query: 161 LKPDYSKVLLRRASANEGLGNFADA 185
           + P +SK   R  +A+ G+G+  +A
Sbjct: 69  INPSWSKGYNRVGAAHFGMGDLDEA 93

 Score = 39.7 bits (91), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 46/88 (52%), Gaps = 8/88 (9%)

Query: 106 GNQFFRNKKYDDAIKYYNWALELKDDPVFYSNLSACYVSVGD----LKKVVEMSTKALEL 161
           GN+ ++ +++D+A+  YN A E  +D  + +N SA     GD    +K + E   K  E+
Sbjct: 270 GNKLYKARQFDEAVAKYNEAWEAHNDITYLNNRSAAEFEKGDYETSIKTLEEAVEKGREM 329

Query: 162 KPDYSKVLLRRASANEGLGNFADAMFDL 189
           + DY KV+   A +   +GN    + DL
Sbjct: 330 RADY-KVI---AKSFARMGNCYTKLNDL 353

 Score = 35.0 bits (79), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 20/85 (23%), Positives = 42/85 (49%), Gaps = 1/85 (1%)

Query: 106 GNQFFRNKKYDDAIKYYNWALE-LKDDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPD 164
           G  +F    + +A+K Y   ++   +D   YSN +A    +    + ++   KA+E  P+
Sbjct: 404 GKDYFTKGDWPNAVKAYTEMIKRAPEDARGYSNRAAVLSKLMSFPEAIDDCNKAIEKDPN 463

Query: 165 YSKVLLRRASANEGLGNFADAMFDL 189
           + +  +R+A+A   +  F+ A+  L
Sbjct: 464 FVRAYIRKATAQIAVREFSSALETL 488

>Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {ON}
           YGR123C (PPT1) - serine/threonine phosphatase [contig
           295] FULL
          Length = 511

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 55/103 (53%), Gaps = 1/103 (0%)

Query: 91  TAEEKDRYALALKDKGNQFFRNKKYDDAIKYYNWALELKD-DPVFYSNLSACYVSVGDLK 149
             +E  + AL  K++GN + + KKY +A++YY+ A+EL D   +++SN +   + + +  
Sbjct: 2   VTQEAAQQALEFKNQGNAYVKEKKYQEAVEYYSKAIELDDTQSIYFSNRAFSRLRLDNFL 61

Query: 150 KVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDLSVL 192
              E   KA+ L P   K + RR  +  GL  F  A  DL V+
Sbjct: 62  TAQEDCDKAIALDPKNIKAIHRRGLSYVGLLEFFKARKDLRVV 104

 Score = 35.0 bits (79), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 28/51 (54%)

Query: 381 EYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENI 431
           E   Y+ KA++LD   S  + +R      L N+  A +D DKA  LDP+NI
Sbjct: 28  EAVEYYSKAIELDDTQSIYFSNRAFSRLRLDNFLTAQEDCDKAIALDPKNI 78

>Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}
           similar to Ashbya gossypii AAR083C
          Length = 510

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/95 (36%), Positives = 51/95 (53%), Gaps = 1/95 (1%)

Query: 99  ALALKDKGNQFFRNKKYDDAIKYYNWALELKD-DPVFYSNLSACYVSVGDLKKVVEMSTK 157
           AL  KD+GN+F  +K Y  AI+ Y  A+EL     +F+SN +   + +   +  +E S+K
Sbjct: 9   ALEYKDQGNKFVASKDYGQAIEAYTKAIELDGCQSIFFSNRALANLKLDRFQSALEDSSK 68

Query: 158 ALELKPDYSKVLLRRASANEGLGNFADAMFDLSVL 192
           A+EL     K   RR  A  GL +F  A  DL V+
Sbjct: 69  AIELDSSNVKGYHRRGMAYAGLQDFISAKRDLEVV 103

>SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 323

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 39/115 (33%), Positives = 63/115 (54%), Gaps = 4/115 (3%)

Query: 87  KANFTAEEKDRYALA--LKDKGNQFFRNKKYDDAIKYYNWALE-LKDDPVFYSNLSACYV 143
           K N  AE+ +  A A  LK +GN+   +K ++ AIK Y  A+E L  + V+Y+N +A Y 
Sbjct: 83  KVNIPAEDANTKAKAEDLKLQGNKAMASKDFETAIKKYTEAIEVLPSNAVYYANRAAAYS 142

Query: 144 SVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDL-SVLSLNGD 197
           S+   ++ V+ +  A+++ P YSK   R   A   LG   +A+    +VL + GD
Sbjct: 143 SLKKYEESVQDAESAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVLDIEGD 197

>TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.617
           YOR027W
          Length = 576

 Score = 51.2 bits (121), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 47/85 (55%), Gaps = 2/85 (2%)

Query: 103 KDKGNQFFRNKKYDDAIKYYNWALELKDDP--VFYSNLSACYVSVGDLKKVVEMSTKALE 160
           K +GN  F  K Y+ A + +  A+++ + P  V YSN SACY S+    + ++ + + ++
Sbjct: 8   KQQGNAAFVAKDYEKAAELFGKAIDVSEQPNHVLYSNRSACYTSLKKFAEGLKDAEECVK 67

Query: 161 LKPDYSKVLLRRASANEGLGNFADA 185
           + P +SK   R  +A  GL N  DA
Sbjct: 68  INPGWSKGYNRVGAAQFGLNNLEDA 92

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 48/87 (55%), Gaps = 7/87 (8%)

Query: 103 KDKGNQFFRNKKYDDAIKYYNWALELKDDPVFYSNLSACYVSVGDLKKVVEMSTKAL--- 159
           K +GN+F++ +K+D+AI++YN A EL  D  + +N +A     GD +  +   T A+   
Sbjct: 252 KAEGNKFYKARKFDEAIEHYNKAWELHKDITYLNNRAAAEYEKGDYETAIATLTNAVDEG 311

Query: 160 -ELKPDY---SKVLLRRASANEGLGNF 182
            E++ DY   +K   R  +A   LG+ 
Sbjct: 312 REMRADYKVIAKSFARIGNAYHKLGDL 338

 Score = 36.2 bits (82), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 23/99 (23%), Positives = 49/99 (49%), Gaps = 2/99 (2%)

Query: 106 GNQFFRNKKYDDAIKYYNWALELK-DDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPD 164
           G ++F    + +A+K Y   ++    D   YSN +A    +    + +    +A+E  P+
Sbjct: 389 GKEYFSKADWPNAVKAYTEMIKRSPQDARGYSNRAAALAKLMSFPEAIADCDRAIEKDPN 448

Query: 165 YSKVLLRRASANEGLGNFADAMFDL-SVLSLNGDFNDAS 202
           + +  +R+ASA   +  FA A+  L +V + + + N+ +
Sbjct: 449 FIRAYIRKASAQIAVKEFAAAVETLDTVRTKDSELNNGA 487

>CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {ON}
           highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123c PPT1 protein ser/thr phosphatase
          Length = 510

 Score = 50.4 bits (119), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 33/95 (34%), Positives = 51/95 (53%), Gaps = 1/95 (1%)

Query: 99  ALALKDKGNQFFRNKKYDDAIKYYNWALELKD-DPVFYSNLSACYVSVGDLKKVVEMSTK 157
           AL  K++GN   + + Y  AI+ Y+ A+EL D   V++SN + C++ + + +   +   K
Sbjct: 9   ALEYKNEGNACVKVQDYAKAIEKYDKAIELDDTQSVYFSNRALCHLKLDNFQCASQDCDK 68

Query: 158 ALELKPDYSKVLLRRASANEGLGNFADAMFDLSVL 192
           AL L P   K   RR  A  GL  F  A  DL+V+
Sbjct: 69  ALALDPKNVKAYHRRGLACVGLLEFKKARADLTVV 103

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 36/63 (57%), Gaps = 2/63 (3%)

Query: 386 FDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQ--LACLAYR 443
           +DKA++LD   S  + +R   +  L N+  A +D DKA  LDP+N+  Y +  LAC+   
Sbjct: 32  YDKAIELDDTQSVYFSNRALCHLKLDNFQCASQDCDKALALDPKNVKAYHRRGLACVGLL 91

Query: 444 ENK 446
           E K
Sbjct: 92  EFK 94

>NCAS0A11200 Chr1 complement(2220419..2223142) [2724 bp, 907 aa]
           {ON} Anc_3.367
          Length = 907

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 61/259 (23%), Positives = 102/259 (39%), Gaps = 41/259 (15%)

Query: 273 YDESNEADKDLMNGLTNLYKRSPESYDKADESFTKAVKLFDEQLXXXXXXXXXXXXLAIS 332
           Y  SN     L +G+  LY R   S D A+E+F K ++L D Q             L I 
Sbjct: 152 YHLSNPNVPKLWHGIGILYDRY-GSLDYAEEAFAKVLEL-DPQFEKANEIYFR---LGII 206

Query: 333 LEHTG-------IFKFLKNDPLGAHEDIKKAIEL---FPRVNSY-----IYMALIMADRN 377
            +H G        F+++ N P    ++     +L      +N +      Y  +++ + N
Sbjct: 207 YKHQGKWTQALECFRYILNQPPAPLQEWDIWFQLGSVLESMNEWQGAREAYEHVLLQNEN 266

Query: 378 --------------------DSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAG 417
                               D  +  NY  K+L++D N+S+ +YH G+++ I  +Y  A 
Sbjct: 267 HAKVLQQLGCLYGMNNVSFYDPQKALNYLLKSLEVDPNDSTTWYHLGRVHMIRNDYTAAY 326

Query: 418 KDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEIL-T 476
             F +A   D  N   +  +  L Y+ +++ D    ++ A R  P   EV      +  T
Sbjct: 327 DAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYET 386

Query: 477 DKNDFEKALKQYDLAIELE 495
             N    AL  Y  A  L+
Sbjct: 387 CNNQLNDALDAYKQAARLD 405

>KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 593

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 54/93 (58%), Gaps = 7/93 (7%)

Query: 101 ALKDKGNQFFRNKKYDDAIKYYNWALELKDDPVFYSNLSACYVSVGDLKKVVEMSTKAL- 159
           A K +GN+F++ +K+D+AI++YN A +L  D  + +N SA     GD ++ ++  T+A+ 
Sbjct: 269 AEKAEGNKFYKARKFDEAIEHYNKAWDLHKDVTYLNNRSAAEYEKGDYEQAIKTLTEAVE 328

Query: 160 ---ELKPDY---SKVLLRRASANEGLGNFADAM 186
              E++ DY   SK   R  +A   L +F  A+
Sbjct: 329 QGREMRADYKLISKSFARIGNAYLKLEDFKKAI 361

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 45/86 (52%), Gaps = 2/86 (2%)

Query: 102 LKDKGNQFFRNKKYDDAIKYYNWALELKDDP--VFYSNLSACYVSVGDLKKVVEMSTKAL 159
            K +GN  F  K Y+ A + +  A+E  + P  V YSN SAC+ S+    + +  + + +
Sbjct: 6   FKKQGNAAFVAKDYEKASELFTKAIEASEAPNHVLYSNRSACFTSLKKFNEALNDANECV 65

Query: 160 ELKPDYSKVLLRRASANEGLGNFADA 185
           ++ P +SK   R  +A  GLG   +A
Sbjct: 66  KINPAWSKGYNRVGAAYFGLGKLDEA 91

 Score = 32.3 bits (72), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 29/119 (24%), Positives = 51/119 (42%), Gaps = 11/119 (9%)

Query: 82  PDFSNK-ANFTAEEKDRYALALKD---------KGNQFFRNKKYDDAIKYYN-WALELKD 130
           PD   K  N   E+K R A A  D         +G ++F    + +A+K Y        +
Sbjct: 374 PDILTKLRNCEKEQKVREAQAYIDPEKAEEARLQGKEYFTKGDWPNAVKAYTEMTKRAPE 433

Query: 131 DPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDL 189
           D   YSN +A    +    + ++    A+   P++ +  +R+A+A   +  FA A+  L
Sbjct: 434 DARGYSNRAAALAKLMSFPEAIKDCDMAISKDPNFIRAYIRKATAQIAVREFASAIETL 492

>TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 54/107 (50%), Gaps = 2/107 (1%)

Query: 93  EEKDRYALALKDKGNQFFRNKKYDDAIKYYNWALE-LKDDPVFYSNLSACYVSVGDLKKV 151
           EE+   A  LK +GN+    K Y+ AIK Y+ A+E L  + V+Y+N +A Y S+      
Sbjct: 87  EEQKATAEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTNAVYYANRAAAYSSLKKYDDA 146

Query: 152 VEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDL-SVLSLNGD 197
           V  +  A+++ P YSK   R   A    G   DA+     VL + GD
Sbjct: 147 VNDAESAIKVNPTYSKGYSRLGFAKFAQGKVEDALDAYKKVLDIEGD 193

>KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa]
           {ON} Anc_3.481 YGR123C
          Length = 512

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 58/111 (52%), Gaps = 2/111 (1%)

Query: 99  ALALKDKGNQFFRNKKYDDAIKYYNWALEL-KDDPVFYSNLSACYVSVGDLKKVVEMSTK 157
           AL  KD+GN + +++ Y  AI+ Y  A+EL     +FYSN +  ++ + + +  +     
Sbjct: 12  ALKFKDEGNVYIKSQDYQKAIELYTKAIELDSTSSIFYSNRALAHLKLDNFQSALHDCND 71

Query: 158 ALELKPDYSKVLLRRASANEGLGNFADAMFDLSVLSLNGDFNDASIEPMLE 208
           A++L  +  K   RR  A  GL  F  A  DL++L L    NDA+ +  LE
Sbjct: 72  AIKLDNNNIKAYHRRGLAYVGLLEFRKAKNDLTIL-LKYKPNDATAKRGLE 121

>KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 335

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 43/68 (63%), Gaps = 1/68 (1%)

Query: 105 KGNQFFRNKKYDDAIKYYNWALELK-DDPVFYSNLSACYVSVGDLKKVVEMSTKALELKP 163
           +GN+    KK+D+AI+ Y  A+E+   + V+YSN +A Y S+   ++ V+ + +A+E+ P
Sbjct: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160

Query: 164 DYSKVLLR 171
            YSK   R
Sbjct: 161 TYSKGFSR 168

 Score = 32.3 bits (72), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 53/112 (47%), Gaps = 12/112 (10%)

Query: 386 FDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYREN 445
           +  A+++  +N+  Y +R      L+ Y+QA KD ++A E+DP     + +L    Y  N
Sbjct: 118 YTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFAKYALN 177

Query: 446 KFDDCETLFSEAKRKFPEAPEVPNFFAEILTD--KNDFEKALKQYDLAIELE 495
           K ++    +           +V +   E  TD  K D+E A K+ + ++ LE
Sbjct: 178 KPEEALDAYK----------KVLDIEGEKATDVMKRDYETAKKKVETSMNLE 219

>KLLA0B09966g Chr2 complement(872760..873872) [1113 bp, 370 aa] {ON}
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155W CNS1 cyclophilin seven suppressor component of
           Hsp90p chaperone machinery
          Length = 370

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 43/153 (28%), Positives = 70/153 (45%), Gaps = 17/153 (11%)

Query: 81  DPDFSN------KANFTAEEKDRYALALKDKGNQFFRNKKYDDAIKYYNWALELKDDPV- 133
           DPD SN      KA     E    A   K++GN  ++ K++ DA   Y  AL++K D + 
Sbjct: 46  DPDESNVELEALKAMAYEGEPHEIATNFKNQGNDLYKGKRFKDARAMYLKALDVKCDVLS 105

Query: 134 ----FYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDL 189
                Y NL+AC + + + +  +    +AL+L     K   R   A   LG F D++  +
Sbjct: 106 INESLYLNLAACELEIKNYRSCINYCREALKLNAKNVKAFFRIGKAYLELGRFEDSLEAV 165

Query: 190 SVLSLNGDFNDASIEPMLERNLNKQAMSKLKEK 222
            V  L  D  + ++     +++  +A  KLK K
Sbjct: 166 QV-GLAVDPENGAL-----KSIQSKATEKLKRK 192

>Kpol_1006.4 s1006 complement(17836..20034) [2199 bp, 732 aa] {ON}
           complement(17836..20034) [2199 nt, 733 aa]
          Length = 732

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 54/113 (47%), Gaps = 1/113 (0%)

Query: 384 NYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYR 443
           NY  ++L++DS +S+ +YH G+++ I  +Y+ A + F +A   D  N   +  +  L Y+
Sbjct: 273 NYLLRSLEVDSEDSTTWYHLGRIHMIRSDYNAAYEAFQQAVNRDARNPIFWCSIGVLYYQ 332

Query: 444 ENKFDDCETLFSEAKRKFPEAPEVPNFFAEIL-TDKNDFEKALKQYDLAIELE 495
             ++ D    ++ A R  P   EV      +  T  N    AL  Y  A  LE
Sbjct: 333 IYQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLTDALDAYKQAARLE 385

>ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 572

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 45/86 (52%), Gaps = 2/86 (2%)

Query: 102 LKDKGNQFFRNKKYDDAIKYYNWALELKDDP--VFYSNLSACYVSVGDLKKVVEMSTKAL 159
            K +GN  F  K Y  AI  +  A+E+ + P  V YSN SACY S    ++ ++ + + +
Sbjct: 6   FKQQGNAAFLAKDYVKAIDLFTKAIEVSETPNHVLYSNRSACYASNKKFEEALKDAEECV 65

Query: 160 ELKPDYSKVLLRRASANEGLGNFADA 185
           ++ P +SK   R  +A  GL    +A
Sbjct: 66  KISPSWSKGYNRVGAAQFGLSQLDEA 91

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 80/185 (43%), Gaps = 23/185 (12%)

Query: 99  ALALKDKGNQFFRNKKYDDAIKYYNWALELKDDPVFYSNLSACYVSVGD----LKKVVEM 154
           A A K +GN+ ++ +++++AI++YN A EL  D  + +N SA     GD    +K + + 
Sbjct: 246 AEAEKAEGNKLYKARQFEEAIEHYNKAWELHKDITYLNNRSAAEFEKGDYDTAIKTLNDA 305

Query: 155 STKALELKPDYSKVL---------------LRRA--SANEGLGNFADAMFDLSVLSLNGD 197
             +  EL+ DY  +                LR+A    N  L     A     + S   +
Sbjct: 306 VEQGRELRADYKTIAKSFARIGNAYYKLKDLRKAIEHYNRSLTEHRTAEVLNKLRSTEKE 365

Query: 198 FNDASIEPMLERNLNKQAMSKLKEKF--GDIDTATATPTELSTQAPKELKDKTENLPSIT 255
              A  E  +     ++A  + KE F  GD   A    TE+  +AP++ +  +    ++ 
Sbjct: 366 LKKAESEAYVNPEKAEEARLQGKEFFTKGDWPNAVKAYTEMVKRAPQDARGFSNRAAALA 425

Query: 256 SMASF 260
            + SF
Sbjct: 426 KLMSF 430

 Score = 38.9 bits (89), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 21/88 (23%), Positives = 45/88 (51%), Gaps = 1/88 (1%)

Query: 105 KGNQFFRNKKYDDAIKYYNWALE-LKDDPVFYSNLSACYVSVGDLKKVVEMSTKALELKP 163
           +G +FF    + +A+K Y   ++    D   +SN +A    +    + +E   KA+ + P
Sbjct: 386 QGKEFFTKGDWPNAVKAYTEMVKRAPQDARGFSNRAAALAKLMSFPEAIEDCNKAVSIDP 445

Query: 164 DYSKVLLRRASANEGLGNFADAMFDLSV 191
           ++ +  +R+A+A   +  FA A+  L++
Sbjct: 446 NFVRAYIRKATAQIAVKEFAAAIETLNI 473

>NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.21
           YOR007C
          Length = 350

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 28/88 (31%), Positives = 43/88 (48%)

Query: 99  ALALKDKGNQFFRNKKYDDAIKYYNWALELKDDPVFYSNLSACYVSVGDLKKVVEMSTKA 158
           A ALK +GN+     +Y++AIK Y  A++   +  +YSN S  Y  +G  +  V  +T A
Sbjct: 82  AEALKKEGNEAMIEGQYEEAIKKYTEAIQFSKNVAYYSNRSLAYSKLGRYEDAVNDATLA 141

Query: 159 LELKPDYSKVLLRRASANEGLGNFADAM 186
           + + P +SK   R   A        D M
Sbjct: 142 INIDPSFSKAYSRLGYAKCCQDKLEDGM 169

>KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON}
           Anc_5.617 YOR027W
          Length = 575

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 46/85 (54%), Gaps = 2/85 (2%)

Query: 103 KDKGNQFFRNKKYDDAIKYYNWALELKDDP--VFYSNLSACYVSVGDLKKVVEMSTKALE 160
           K +GN  F  K Y  AI  +  A+E+ + P  V YSN SA Y S    ++ +  + + ++
Sbjct: 9   KQEGNTAFVAKDYQKAIDAFTKAIEVSETPNHVLYSNRSAAYTSSKQYEQALSDADECIK 68

Query: 161 LKPDYSKVLLRRASANEGLGNFADA 185
           + P ++K   R+ +A +GL  + +A
Sbjct: 69  INPSWAKGYTRKGAALQGLHKYEEA 93

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 40/70 (57%), Gaps = 4/70 (5%)

Query: 103 KDKGNQFFRNKKYDDAIKYYNWALELKDDPVFYSNLSACYVSVGDLKKVVEMSTKAL--- 159
           K +GN+ ++ +++D+AI +YN A E   D  + +N SA     GD +  ++  T+A+   
Sbjct: 255 KAEGNKAYKARQFDEAISHYNQAWETFKDITYLNNRSAAEYEKGDYETCIKTLTEAVENA 314

Query: 160 -ELKPDYSKV 168
            EL+ DY  V
Sbjct: 315 RELRTDYKIV 324

 Score = 36.6 bits (83), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 41/88 (46%), Gaps = 1/88 (1%)

Query: 105 KGNQFFRNKKYDDAIKYYNWALE-LKDDPVFYSNLSACYVSVGDLKKVVEMSTKALELKP 163
           +G ++F    + +A+K Y   ++   DD   YSN +A    +      +    KA+E  P
Sbjct: 391 EGKEYFTKADWPNAVKSYTEMIKRAPDDARGYSNRAAALAKLMSFPDAISDCNKAIEKDP 450

Query: 164 DYSKVLLRRASANEGLGNFADAMFDLSV 191
            + +  LR+A+    +  FA A+  L +
Sbjct: 451 SFIRAYLRKATCQIAVKEFAGAIETLDL 478

>ZYRO0F08624g Chr6 (691992..693131) [1140 bp, 379 aa] {ON} similar
           to uniprot|P33313 Saccharomyces cerevisiae YBR155W CNS1
           cyclophilin seven suppressor component of Hsp90p
           chaperone machinery
          Length = 379

 Score = 47.4 bits (111), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 46/181 (25%), Positives = 84/181 (46%), Gaps = 30/181 (16%)

Query: 94  EKDRYALALKDKGNQFFRNKKYDDAIKYYNWALELK--DDPV---FYSNLSACYVSVGDL 148
           E    A   K++ N  ++ K++ +A + Y   +E+K  DD V    ++NL+AC + + + 
Sbjct: 73  EPHEVAENFKNQANDLYKAKRFKEAREVYKKGIEIKCNDDKVNESLFANLAACELEIKNF 132

Query: 149 KKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADA----MFDLSVLSLNGDFNDASIE 204
           ++ + +  KAL+  P   K   R A A   L    +A     F L++ S N      ++E
Sbjct: 133 RRCINLCQKALQFNPKNMKCYYRIAKAFYQLNKLDEAKESVKFGLTIDSENKSLQ--TLE 190

Query: 205 PMLERN---LNKQAMSKLKEK---------------FGDID-TATATPTELSTQAPKELK 245
            +++R    L++  + +L+EK                 +ID  AT  P+EL  +A   L+
Sbjct: 191 GVIDRKQQELHEAEVKRLEEKQKKENLQFIFNGALRMRNIDNVATEKPSELVQEAGISLE 250

Query: 246 D 246
           D
Sbjct: 251 D 251

>TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa]
           {ON} Anc_6.21 YOR007C
          Length = 373

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 56/103 (54%), Gaps = 2/103 (1%)

Query: 85  SNKANFTAEEKDRYALALKDKGNQFFRNKKYDDAIKYYNWAL-ELKDDPVFYSNLSACYV 143
           ++K NF+ ++K + A   KD+GN+   ++ Y  AI+ Y  A+ +   DP++YSN S  Y+
Sbjct: 124 TSKNNFSDKDK-QIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYL 182

Query: 144 SVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAM 186
            V D +  +  +   + +  ++SK  +R A+       + DA+
Sbjct: 183 KVNDYESAINDANFCISIDANFSKAYIRLANIKVQQHQYIDAL 225

>Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {ON}
           similar to Ashbya gossypii AEL224W
          Length = 584

 Score = 47.4 bits (111), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 48/85 (56%), Gaps = 2/85 (2%)

Query: 103 KDKGNQFFRNKKYDDAIKYYNWALELKDDP--VFYSNLSACYVSVGDLKKVVEMSTKALE 160
           K +GN  F  K +  A++ +  A++  ++P  V YSN S  Y S+    + +  +T+ ++
Sbjct: 8   KKEGNAAFVAKDFKRAVELFTNAIQESEEPNHVLYSNRSGAYASLKKFDEALSDATECVK 67

Query: 161 LKPDYSKVLLRRASANEGLGNFADA 185
           +K D+SK   R  +A+ GLGN  +A
Sbjct: 68  IKADWSKGHNRLGAAHFGLGNLDEA 92

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 55/113 (48%), Gaps = 19/113 (16%)

Query: 63  SESTAESNTPVYPVSSNGDPDFSNKANFTAEEKDRYALALKDKGNQFFRNKKYDDAIKYY 122
           +E+  ++ TP  P+  + D + + KA              K +GNQ ++ +K+D+AI  Y
Sbjct: 236 TEAPGKTQTPPEPMEVDLDRENAEKA--------------KAEGNQLYKQRKFDEAIAKY 281

Query: 123 NWALELKDDPVFYSNLSACYVSVGD----LKKVVEMSTKALELKPDYSKVLLR 171
             A  L+ D  + +N +A     GD    +K + E   +  EL+ DY KV+ +
Sbjct: 282 EEAWNLQKDITYLNNRAAAEYEKGDYNSAIKTLNEAVEQGRELRADY-KVIAK 333

 Score = 36.2 bits (82), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 31/121 (25%), Positives = 52/121 (42%), Gaps = 11/121 (9%)

Query: 82  PDFSNK-ANFTAEEKDRYALALKDK---------GNQFFRNKKYDDAIKYYN-WALELKD 130
           PD  NK  N   E K R A A  D          G ++F    +  A+K Y+   +    
Sbjct: 365 PDVLNKLRNLEREIKKREAEAYIDPEKAEKARLDGKEYFTKGDWPSAVKAYSEMIMRAPH 424

Query: 131 DPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDLS 190
           D   YSN +A    +      ++   KA+E+ P + +  +R+A+A   +  ++ A+  L 
Sbjct: 425 DARGYSNRAAALSKLMSFPDAIKDCDKAIEIDPSFVRAYIRKATAQIAVQEYSAAIETLD 484

Query: 191 V 191
           V
Sbjct: 485 V 485

>TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.21
           YOR007C
          Length = 343

 Score = 47.0 bits (110), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 39/115 (33%), Positives = 61/115 (53%), Gaps = 4/115 (3%)

Query: 87  KANFTAEEKDRYALA--LKDKGNQFFRNKKYDDAIKYYNWALE-LKDDPVFYSNLSACYV 143
           K N  AE+ +  A A  LK +GN+    K +D AIK Y+ A+E L  + V+Y+N +A + 
Sbjct: 83  KVNIPAEDAETKAKAETLKLEGNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHS 142

Query: 144 SVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDL-SVLSLNGD 197
           S+   ++ ++ +  A++  P YSK   R   A   LG   DA+     VL + GD
Sbjct: 143 SMKAYEEAIKDAESAIKTDPTYSKGYSRLGYAKFALGQAEDALEAYKKVLDIEGD 197

>Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}
           complement(91130..92671) [1542 nt, 514 aa]
          Length = 513

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 54/105 (51%), Gaps = 6/105 (5%)

Query: 91  TAEEKDRYALALKDKGNQFFRNKKYDDAIKYYNWALELKDDP---VFYSNLSACYVSVGD 147
           TAE+  + A+  K++GN F + + Y  AI+ Y  A+EL  DP   +FYSN +   + + +
Sbjct: 5   TAEDIAK-AVEFKNEGNVFIKEQNYSKAIELYTKAIEL--DPNQSIFYSNRALAQLKLDN 61

Query: 148 LKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDLSVL 192
            +       +AL L     K   RR  AN GL  F  A  DL+V+
Sbjct: 62  FQSAYNDCNEALTLDSKNVKAYHRRGLANVGLLEFKRARNDLNVV 106

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 39/84 (46%), Gaps = 7/84 (8%)

Query: 351 EDIKKAIELFPRVNSYIYMALIMADRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFIL 410
           EDI KA+E     N +I          + ++    + KA++LD N S  Y +R      L
Sbjct: 7   EDIAKAVEFKNEGNVFI-------KEQNYSKAIELYTKAIELDPNQSIFYSNRALAQLKL 59

Query: 411 QNYDQAGKDFDKAKELDPENIFPY 434
            N+  A  D ++A  LD +N+  Y
Sbjct: 60  DNFQSAYNDCNEALTLDSKNVKAY 83

 Score = 31.2 bits (69), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 35/75 (46%), Gaps = 1/75 (1%)

Query: 355 KAIELFPRVNS-YIYMALIMADRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNY 413
           KAIEL P  +  Y   AL     ++    YN  ++AL LDS N   Y+ RG  N  L  +
Sbjct: 37  KAIELDPNQSIFYSNRALAQLKLDNFQSAYNDCNEALTLDSKNVKAYHRRGLANVGLLEF 96

Query: 414 DQAGKDFDKAKELDP 428
            +A  D +   +  P
Sbjct: 97  KRARNDLNVVLKAKP 111

>Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155W
           (CNS1) - component of Hsp90p chaperone machinery [contig
           27] FULL
          Length = 334

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 61/125 (48%), Gaps = 6/125 (4%)

Query: 102 LKDKGNQFFRNKKYDDAIKYYNWALELKDDP-----VFYSNLSACYVSVGDLKKVVEMST 156
            K++GN+ ++ K+Y DA + YN  +E+K D        +SN +AC + + + ++ V    
Sbjct: 81  FKNQGNELYKVKRYKDAREIYNKGIEIKCDSNKINESLFSNRAACELELKNYRRCVNDCR 140

Query: 157 KALELKPDYSKVLLRRASANEGLGNFADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAM 216
           +AL+  P   K   R A A   L    DA   +    L  D   A+++ +L++ + ++  
Sbjct: 141 QALQFNPTNIKCFYRIARAFFLLDKCEDAKEAIE-FGLKLDSESAALKALLQKVIKREED 199

Query: 217 SKLKE 221
            K  E
Sbjct: 200 KKAHE 204

 Score = 31.2 bits (69), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 33/63 (52%), Gaps = 3/63 (4%)

Query: 378 DSTEYYNYFDKALKLDSN--NSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYI 435
           D+ E YN     +K DSN  N S++ +R      L+NY +   D  +A + +P NI  + 
Sbjct: 96  DAREIYNK-GIEIKCDSNKINESLFSNRAACELELKNYRRCVNDCRQALQFNPTNIKCFY 154

Query: 436 QLA 438
           ++A
Sbjct: 155 RIA 157

>SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/143 (29%), Positives = 65/143 (45%), Gaps = 11/143 (7%)

Query: 99  ALALKDKGNQFFRNKKYDDAIKYYNWALEL-KDDPVFYSNLSACYVSVGDLKKVVEMSTK 157
           AL  K++GN F + K +  A + Y+ A+EL     +++SN +  ++ + + +  +    K
Sbjct: 12  ALEFKNQGNVFIKGKNFSKAAELYSKAIELDGTQSIYFSNRAFAHLKLDNFQTALNDCNK 71

Query: 158 ALELKPDYSKVLLRRASANEGLGNFADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMS 217
           A+EL P   K   RR  +  GL  F  A  DL ++ L    N    EP+  R L+     
Sbjct: 72  AIELDPKNVKAYHRRGLSYIGLLEFNKARKDLKIV-LRAKPN----EPVATRALDVCERV 126

Query: 218 KLKEKF-----GDIDTATATPTE 235
             KEKF     G  D  T    E
Sbjct: 127 IRKEKFEKAISGGSDAVTVNVCE 149

 Score = 35.8 bits (81), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 44/84 (52%), Gaps = 7/84 (8%)

Query: 351 EDIKKAIELFPRVNSYIYMALIMADRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFIL 410
           ED+ KA+E   + N +I       + + + E Y+   KA++LD   S  + +R   +  L
Sbjct: 7   EDVNKALEFKNQGNVFIKGK----NFSKAAELYS---KAIELDGTQSIYFSNRAFAHLKL 59

Query: 411 QNYDQAGKDFDKAKELDPENIFPY 434
            N+  A  D +KA ELDP+N+  Y
Sbjct: 60  DNFQTALNDCNKAIELDPKNVKAY 83

>AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR123C
           (PPT1)
          Length = 538

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/121 (28%), Positives = 59/121 (48%), Gaps = 5/121 (4%)

Query: 73  VYPVSSNGDPDFSNKANFTAEEKDRYALALKDKGNQFFRNKKYDDAIKYYNWALEL-KDD 131
           V  V+ +G P    + + TA      AL  K++GN++ + K Y  A++ Y  A+E     
Sbjct: 16  VRTVAGSGHPSPPRRDSMTAAT----ALDYKNEGNEWVKAKDYARAVEAYTRAIEADGTQ 71

Query: 132 PVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDLSV 191
            +F+SN +   + +   +  +E S +A+EL     K   RR  A+ GL  +  A  DL V
Sbjct: 72  SIFFSNRALANLKLDRFQSALEDSARAIELDAGNVKAYHRRGLAHCGLLEWGPAKRDLEV 131

Query: 192 L 192
           +
Sbjct: 132 V 132

>KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}
           Anc_6.21 YOR007C
          Length = 331

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/107 (32%), Positives = 55/107 (51%), Gaps = 2/107 (1%)

Query: 93  EEKDRYALALKDKGNQFFRNKKYDDAIKYYNWALELK-DDPVFYSNLSACYVSVGDLKKV 151
           EE    A  LK +GN+    K +D AI  Y+ A+ +  ++ ++Y+N +A Y S+ D +K 
Sbjct: 93  EETKVKAEKLKLEGNKAMAMKDFDLAIAKYSEAISISPNNAIYYANRAAAYSSLKDFEKA 152

Query: 152 VEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDL-SVLSLNGD 197
            E +  A+ + P+YSK   R   A   L    +A+     VL L GD
Sbjct: 153 TEDAESAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDLEGD 199

>TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 55/105 (52%), Gaps = 2/105 (1%)

Query: 99  ALALKDKGNQFFRNKKYDDAIKYYNWALELKDD-PVFYSNLSACYVSVGDLKKVVEMSTK 157
           AL  K++GN   + + Y  AI+ Y  A++L D   +++SN +  ++ + + +  +    K
Sbjct: 12  ALEFKNRGNDAIKTQDYPGAIELYTEAIKLDDTVSIYFSNRAMGHLKMDNFQSGINDCDK 71

Query: 158 ALELKPDYSKVLLRRASANEGLGNFADAMFDLSVLSLNGDFNDAS 202
           ALE+ P   K   RR  +  GL  F +A  DL ++ L    NDA+
Sbjct: 72  ALEIDPKNIKAYHRRGMSYIGLLEFKNAQKDLKIV-LASKPNDAT 115

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 39/83 (46%), Gaps = 7/83 (8%)

Query: 352 DIKKAIELFPRVNSYIYMALIMADRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQ 411
           D  KA+E   R N     A+   D   + E Y    +A+KLD   S  + +R   +  + 
Sbjct: 8   DAAKALEFKNRGND----AIKTQDYPGAIELYT---EAIKLDDTVSIYFSNRAMGHLKMD 60

Query: 412 NYDQAGKDFDKAKELDPENIFPY 434
           N+     D DKA E+DP+NI  Y
Sbjct: 61  NFQSGINDCDKALEIDPKNIKAY 83

>Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {ON}
           complement(59590..60618) [1029 nt, 343 aa]
          Length = 342

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 39/115 (33%), Positives = 57/115 (49%), Gaps = 4/115 (3%)

Query: 87  KANFTAE--EKDRYALALKDKGNQFFRNKKYDDAIKYYNWALE-LKDDPVFYSNLSACYV 143
           K N T +  E    A ALK +GN+    K Y+ AIK Y  A+  L  + V+++N +A Y 
Sbjct: 86  KVNVTEDDTEASEAAEALKLEGNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYS 145

Query: 144 SVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDL-SVLSLNGD 197
           S+    + VE +  A+++ P YSK   R   A    G   DA+     VL + GD
Sbjct: 146 SLKKYDEAVEDANSAIKINPTYSKGYSRLGFAKFAQGKAEDALEAYKKVLDIEGD 200

>KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON}
           Anc_3.481 YGR123C
          Length = 511

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 49/97 (50%), Gaps = 5/97 (5%)

Query: 99  ALALKDKGNQFFRNKKYDDAIKYYNWALELKDDP---VFYSNLSACYVSVGDLKKVVEMS 155
           A + KD+GN+F + + +  A + Y  A+E   DP   +FYSN +   + + +    +   
Sbjct: 9   ATSYKDEGNKFLKQQDFQRANELYTKAIET--DPTQSIFYSNRALANLKLDNFMNALNDC 66

Query: 156 TKALELKPDYSKVLLRRASANEGLGNFADAMFDLSVL 192
           T A+EL     K   RR  AN GL NF  A  D +++
Sbjct: 67  TNAIELNSSNLKAYHRRGLANIGLLNFKSARNDFNIV 103

 Score = 36.2 bits (82), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 55/130 (42%), Gaps = 26/130 (20%)

Query: 340 KFLKN-DPLGAHEDIKKAIELFP--------RVNSYIYMALIMADRNDSTEYYNYFDKAL 390
           KFLK  D   A+E   KAIE  P        R  + + +   M   ND T        A+
Sbjct: 18  KFLKQQDFQRANELYTKAIETDPTQSIFYSNRALANLKLDNFMNALNDCT-------NAI 70

Query: 391 KLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDC 450
           +L+S+N   Y+ RG  N  L N+  A  DF+   +  P +I            +N FD C
Sbjct: 71  ELNSSNLKAYHRRGLANIGLLNFKSARNDFNIVLKYKPNDIIA----------KNGFDTC 120

Query: 451 ETLFSEAKRK 460
           E +  E + K
Sbjct: 121 EKVIREERFK 130

>NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 48/161 (29%), Positives = 77/161 (47%), Gaps = 7/161 (4%)

Query: 85  SNKANFTAEEKDRYALA--LKDKGNQFFRNKKYDDAIKYYNWALE-LKDDPVFYSNLSAC 141
           S K N   E+ +  A A   K +GN+    K Y  AI+ Y+ A++ L  + ++Y+N +A 
Sbjct: 83  SVKVNIPVEDAEIKATAESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAA 142

Query: 142 YVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAM-FDLSVLSLNGDFND 200
           Y SV +    ++ + KA+E+ P YSK   R A A   L    +A+ +   VL + GD   
Sbjct: 143 YSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFAKYALNKPEEALEYYKKVLDMEGDKAT 202

Query: 201 ASIEPMLERNLNKQAMSKLKEKFGDIDTATATPTELSTQAP 241
            +++   E   N+   S   EK     T T  P+  + Q P
Sbjct: 203 PAMKRDFEMAKNRVESSMNLEKSS---TTTPEPSRSAGQQP 240

 Score = 31.2 bits (69), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 30/61 (49%)

Query: 386 FDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYREN 445
           + +A+K    N   Y +R      ++ YD A KD +KA E+DP     Y +LA   Y  N
Sbjct: 122 YSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFAKYALN 181

Query: 446 K 446
           K
Sbjct: 182 K 182

>TDEL0E02750 Chr5 (529920..531614) [1695 bp, 564 aa] {ON} Anc_5.352
           YDR320C
          Length = 564

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 37/128 (28%), Positives = 54/128 (42%), Gaps = 34/128 (26%)

Query: 103 KDKGNQFFRNKKYDDAIKYY---------NWALELKDDPVFYSNLSACYVSVGDLKKVVE 153
           KD+G +FF+   Y  A + Y         N AL +    V YSNL+A    VG+ K+ + 
Sbjct: 277 KDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRI----VAYSNLTAALFKVGEYKRCLS 332

Query: 154 MSTKALELKPD---------------------YSKVLLRRASANEGLGNFADAMFDLSVL 192
               ALE+ P                      + K++ RRA A E + N+  A+ D   L
Sbjct: 333 DIESALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENYERALQDYQSL 392

Query: 193 SLNGDFND 200
               +FND
Sbjct: 393 IEKNNFND 400

>NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {ON}
           Anc_6.21 YOR007C
          Length = 349

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 56/101 (55%), Gaps = 2/101 (1%)

Query: 99  ALALKDKGNQFFRNKKYDDAIKYYNWALE-LKDDPVFYSNLSACYVSVGDLKKVVEMSTK 157
           A A K +GN+    K +  A++ Y  A++ L  + ++Y+N +A + S+ + ++ ++ +  
Sbjct: 101 AEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAES 160

Query: 158 ALELKPDYSKVLLRRASANEGLGNFADAMFDL-SVLSLNGD 197
           A+++ P YSK   R A A  GLG   +A+     VL + GD
Sbjct: 161 AIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGD 201

>TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {ON}
           Anc_3.481 YGR123C
          Length = 513

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 49/95 (51%), Gaps = 1/95 (1%)

Query: 99  ALALKDKGNQFFRNKKYDDAIKYYNWALEL-KDDPVFYSNLSACYVSVGDLKKVVEMSTK 157
           AL  K+KGN++ +   YD AI++Y+ A+ L     +++SN +  ++   +    V     
Sbjct: 12  ALDFKNKGNEYIKKSDYDSAIEFYSKAIALDSTQSIYFSNRALAHLKQDNFYSAVVDCDN 71

Query: 158 ALELKPDYSKVLLRRASANEGLGNFADAMFDLSVL 192
           AL+L P   K   RR  +  G+  F  A  DL+V+
Sbjct: 72  ALKLDPKNIKAYHRRGLSYVGILEFRKAKNDLNVV 106

 Score = 36.6 bits (83), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 52/105 (49%), Gaps = 12/105 (11%)

Query: 349 AHEDIKKAIELFPRVNSYIYMALIMADRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNF 408
           + EDI  A++   + N YI  +    D + + E+Y+   KA+ LDS  S  + +R   + 
Sbjct: 5   SQEDIATALDFKNKGNEYIKKS----DYDSAIEFYS---KAIALDSTQSIYFSNRALAHL 57

Query: 409 ILQNYDQAGKDFDKAKELDPENIFPYIQ-----LACLAYRENKFD 448
              N+  A  D D A +LDP+NI  Y +     +  L +R+ K D
Sbjct: 58  KQDNFYSAVVDCDNALKLDPKNIKAYHRRGLSYVGILEFRKAKND 102

>KNAG0H00610 Chr8 (99931..102852) [2922 bp, 973 aa] {ON} Anc_3.367
           YBR112C
          Length = 973

 Score = 45.1 bits (105), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 32/132 (24%), Positives = 59/132 (44%), Gaps = 8/132 (6%)

Query: 378 DSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQL 437
           D  +  NY  K+L++D ++++ +YH G+++ +  +Y  A   F +A   D  N   +  +
Sbjct: 296 DPQKALNYLLKSLEVDPSDATTWYHLGRVHMVRSDYTAAYDAFQQAVNRDSRNPIFWCSI 355

Query: 438 ACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEIL-TDKNDFEKALKQYDLA----- 491
             L Y+ +++ D    ++ A R  P   EV      +  T  N    AL  Y  A     
Sbjct: 356 GVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLTDALDAYKQAARLDP 415

Query: 492 --IELENKLDGI 501
             I +  +LD +
Sbjct: 416 ENIHIRKRLDAL 427

>NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {ON}
           Anc_3.142 YDL047W
          Length = 512

 Score = 44.7 bits (104), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 50/97 (51%), Gaps = 5/97 (5%)

Query: 99  ALALKDKGNQFFRNKKYDDAIKYYNWALELKDDP---VFYSNLSACYVSVGDLKKVVEMS 155
           A+A K++GN + + + Y  AI+ Y+ A+EL  DP   +F+SN +   + + + +  +   
Sbjct: 12  AVAFKNEGNTYIKEQNYMKAIELYSQAIEL--DPTQSIFFSNRALAQLKLDNFQSCMNDC 69

Query: 156 TKALELKPDYSKVLLRRASANEGLGNFADAMFDLSVL 192
             AL L P   K   RR  ++ GL     A  DL V+
Sbjct: 70  DVALRLDPKNIKAYHRRGLSHLGLLQCKKARNDLQVV 106

 Score = 33.5 bits (75), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 50/113 (44%), Gaps = 6/113 (5%)

Query: 129 KDDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFD 188
           K+  V + N    Y+   +  K +E+ ++A+EL P  S     RA A   L NF   M D
Sbjct: 9   KEQAVAFKNEGNTYIKEQNYMKAIELYSQAIELDPTQSIFFSNRALAQLKLDNFQSCMND 68

Query: 189 LSV-LSLNGDFNDASIEPMLERNLNKQAMSKLKEKFGDIDTAT-ATPTELSTQ 239
             V L L    +  +I+    R L+   + + K+   D+     A PT+ + +
Sbjct: 69  CDVALRL----DPKNIKAYHRRGLSHLGLLQCKKARNDLQVVLKAKPTDATAK 117

>KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} similar
           to uniprot|P53043 Saccharomyces cerevisiae YGR123C
          Length = 512

 Score = 44.3 bits (103), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 53/97 (54%), Gaps = 5/97 (5%)

Query: 99  ALALKDKGNQFFRNKKYDDAIKYYNWALELKDDP---VFYSNLSACYVSVGDLKKVVEMS 155
           AL LK++GN+F + K Y  A +YY  A+E   DP   + YSN +   + + + +  ++ +
Sbjct: 13  ALELKNEGNKFVKEKLYAKAAEYYTKAIE--HDPENTILYSNRAFTNLKLDNFQSSLDDA 70

Query: 156 TKALELKPDYSKVLLRRASANEGLGNFADAMFDLSVL 192
            +A+EL  +  K   RRA +  GL  F  A  DL ++
Sbjct: 71  KRAIELDNNNLKAYHRRAMSYIGLLEFRKARKDLIIV 107

>KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {ON}
           Anc_6.21 YOR007C
          Length = 339

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/101 (32%), Positives = 57/101 (56%), Gaps = 2/101 (1%)

Query: 99  ALALKDKGNQFFRNKKYDDAIKYYNWALE-LKDDPVFYSNLSACYVSVGDLKKVVEMSTK 157
           A ALK +GN+   +K YD A++ Y  A++ L  + V+++N +A Y +  +  + V+ + +
Sbjct: 101 AEALKLEGNKAVASKDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEE 160

Query: 158 ALELKPDYSKVLLRRASANEGLGNFADAMFDL-SVLSLNGD 197
           A++L P YSK   R A A     NF +++     VL + GD
Sbjct: 161 AIKLDPAYSKGYSRLAYAKYVQENFEESLEAYKKVLEIEGD 201

 Score = 33.9 bits (76), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 35/64 (54%)

Query: 386 FDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYREN 445
           + +A+K+   N+  + +R       QNYD+A KD ++A +LDP     Y +LA   Y + 
Sbjct: 124 YTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAKYVQE 183

Query: 446 KFDD 449
            F++
Sbjct: 184 NFEE 187

>NDAI0A05100 Chr1 (1157935..1160958) [3024 bp, 1007 aa] {ON}
           Anc_3.367
          Length = 1007

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 52/112 (46%), Gaps = 1/112 (0%)

Query: 385 YFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRE 444
           Y  K+L++DS +++ +YH G+++ I  +Y  A   F +A   D  N   +  +  L Y+ 
Sbjct: 299 YLLKSLEVDSQDATTWYHLGRVHMIRNDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQI 358

Query: 445 NKFDDCETLFSEAKRKFPEAPEVPNFFAEIL-TDKNDFEKALKQYDLAIELE 495
           +++ D    ++ A R  P   EV      +  T  N    AL  Y  A  L+
Sbjct: 359 SQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLNDALDAYKQAARLD 410

>Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)
           [1125 nt, 375 aa]
          Length = 374

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 46/89 (51%), Gaps = 5/89 (5%)

Query: 102 LKDKGNQFFRNKKYDDAIKYYNWALELK--DDPV---FYSNLSACYVSVGDLKKVVEMST 156
            K++GN  ++ K++ DA + YN A+++K  DD +    Y+N +AC + + + ++ +    
Sbjct: 77  FKNQGNDLYKVKRFRDARELYNKAIDVKCDDDKINESLYANRAACELELKNYRRCINDCK 136

Query: 157 KALELKPDYSKVLLRRASANEGLGNFADA 185
            AL L P   K   R A A   +  F D 
Sbjct: 137 MALSLNPKNIKCYFRMAKAFLAIEKFDDC 165

 Score = 38.9 bits (89), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 35/74 (47%), Gaps = 1/74 (1%)

Query: 378 DSTEYYN-YFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQ 436
           D+ E YN   D     D  N S+Y +R      L+NY +   D   A  L+P+NI  Y +
Sbjct: 92  DARELYNKAIDVKCDDDKINESLYANRAACELELKNYRRCINDCKMALSLNPKNIKCYFR 151

Query: 437 LACLAYRENKFDDC 450
           +A       KFDDC
Sbjct: 152 MAKAFLAIEKFDDC 165

>KAFR0H00870 Chr8 (162118..164781) [2664 bp, 887 aa] {ON} Anc_3.367
           YBR112C
          Length = 887

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 46/90 (51%)

Query: 378 DSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQL 437
           D  +  NY  K+L++D ++++ +YH G+++ I  +Y  A   F +A   D  N   +  +
Sbjct: 285 DPQKALNYLLKSLEVDPSDATTWYHLGRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSI 344

Query: 438 ACLAYRENKFDDCETLFSEAKRKFPEAPEV 467
             L Y+ +++ D    ++ A R  P   EV
Sbjct: 345 GVLYYQISQYRDALDAYTRAIRLNPYISEV 374

>Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/101 (32%), Positives = 52/101 (51%), Gaps = 2/101 (1%)

Query: 94  EKDRY-ALALKDKGNQFFRNKKYDDAIKYYNWALEL-KDDPVFYSNLSACYVSVGDLKKV 151
           E DR  AL  K++GN F + K +  AI+ Y  A++L     +++SN +  +  V + +  
Sbjct: 6   EADRANALERKNEGNVFIKEKHFLKAIEKYTQAIDLDSTQSIYFSNRAFAHFKVDNFQSA 65

Query: 152 VEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDLSVL 192
           +    +AL+L P   K   RRA +   L  F  A  DL+VL
Sbjct: 66  LNDCDEALKLDPKNIKAYHRRALSCMALLEFKKAKKDLTVL 106

 Score = 38.1 bits (87), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 37/63 (58%), Gaps = 2/63 (3%)

Query: 386 FDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQ--LACLAYR 443
           + +A+ LDS  S  + +R   +F + N+  A  D D+A +LDP+NI  Y +  L+C+A  
Sbjct: 35  YTQAIDLDSTQSIYFSNRAFAHFKVDNFQSALNDCDEALKLDPKNIKAYHRRALSCMALL 94

Query: 444 ENK 446
           E K
Sbjct: 95  EFK 97

>Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON}
           similar to Ashbya gossypii AAR054C
          Length = 172

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 33/59 (55%), Gaps = 1/59 (1%)

Query: 102 LKDKGNQFFRNKKYDDAIKYYNWALEL-KDDPVFYSNLSACYVSVGDLKKVVEMSTKAL 159
           LK KGN FF+N  Y+ AI YY  A  L   +P+++SN++   + +   ++ V    K L
Sbjct: 44  LKVKGNTFFKNGDYETAILYYEKACALDSSNPIYFSNMATALIKLERWQEAVNACDKGL 102

>CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007c SGT2
          Length = 343

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 48/88 (54%), Gaps = 3/88 (3%)

Query: 87  KANFTAE--EKDRYALALKDKGNQFFRNKKYDDAIKYYNWALE-LKDDPVFYSNLSACYV 143
           K N  AE  E    A ALK +GN+    K ++ AI  Y+ A+E L  + ++Y+N +A + 
Sbjct: 79  KVNIPAEDAETKAKAEALKLEGNKAMAGKDFELAIAKYSEAIEVLPTNAIYYANRAAAHS 138

Query: 144 SVGDLKKVVEMSTKALELKPDYSKVLLR 171
           S+    + V  + KA+E+ P YSK   R
Sbjct: 139 SLKQYDEAVVDAEKAIEIDPAYSKGYSR 166

 Score = 34.7 bits (78), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 58/116 (50%), Gaps = 12/116 (10%)

Query: 386 FDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYREN 445
           + +A+++   N+  Y +R   +  L+ YD+A  D +KA E+DP     Y +L    Y +N
Sbjct: 116 YSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQN 175

Query: 446 KFDDCETLFSEAKRKFPEAPEVPNFFAEILTD--KNDFEKALKQYDLAIELENKLD 499
           K +  E L  EA +K      V +   +  TD  K D+E A K+ + ++ LE   D
Sbjct: 176 KPE--EAL--EAYKK------VMDLEGDKATDIMKRDYETAKKKVEQSLNLEKTPD 221

>Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {ON}
           YOR007C (SGT2) - small glutamine-rich tetratricopeptide
           repeat containing protein [contig 185] FULL
          Length = 322

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 57/108 (52%), Gaps = 3/108 (2%)

Query: 82  PDFSNKANFTAEEKDRYALA--LKDKGNQFFRNKKYDDAIKYYNWALE-LKDDPVFYSNL 138
           P  S K N   E+ +  A A  LK +GN+    K ++ A+  Y+ A++ L  + V+Y+N 
Sbjct: 78  PQESVKVNIPVEDAETKAKAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANR 137

Query: 139 SACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAM 186
           +A + S+   ++ V+ +  A+++ P YSK   R   A   LG   +A+
Sbjct: 138 AAAHSSLKKYEEAVKDAEDAIKVNPSYSKGYSRLGFAQYALGKPEEAL 185

>Kpol_1018.106 s1018 (280224..282485) [2262 bp, 753 aa] {ON}
           (280224..282485) [2262 nt, 754 aa]
          Length = 753

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 38/168 (22%), Positives = 70/168 (41%), Gaps = 9/168 (5%)

Query: 404 GQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPE 463
           G+++F L NYD +   F   ++L P  +      + L +  +       L +E     P 
Sbjct: 474 GKLHFELVNYDVSLHYFTNLRKLQPTRVSDLEIYSTLLWHLHDKVKLSILANELVMNIPN 533

Query: 464 APEVPNFFAEILTDKNDFEKALKQYDLAIELENKLDGIYVGIAPLVGKATLLTRNPTVEN 523
           AP+        L+ + D E A+K ++ A +++      Y     L G       + + ++
Sbjct: 534 APQTWCCMGNFLSLQKDHEDAIKAFEKATQVDPNFAYAYT----LQGH-----EHSSNDS 584

Query: 524 FIEATNLLEEASKLDPRSEQAKIGLAQMKLQQEDIDEAITLFEESADL 571
           F  A N   +A   DP+   A  GL    ++    DEA+  FE++  +
Sbjct: 585 FDTAKNCYRKALACDPQHYNAYYGLGMSCMKLGQYDEALLHFEKARSI 632

 Score = 40.0 bits (92), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 46/97 (47%), Gaps = 8/97 (8%)

Query: 350 HEDIKKAIELFPRVN-SYIYMALIMADRNDSTEYY----NYFDKALKLDSNNSSVYYHRG 404
           HED  KA E   +V+ ++ Y   +    + S + +    N + KAL  D  + + YY  G
Sbjct: 551 HEDAIKAFEKATQVDPNFAYAYTLQGHEHSSNDSFDTAKNCYRKALACDPQHYNAYYGLG 610

Query: 405 QMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLA 441
                L  YD+A   F+KA+ ++P N+   I + C  
Sbjct: 611 MSCMKLGQYDEALLHFEKARSINPINV---ILICCCG 644

 Score = 36.2 bits (82), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 31/131 (23%), Positives = 57/131 (43%)

Query: 365 SYIYMALIMADRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAK 424
           ++  M   ++ + D  +    F+KA ++D N +  Y  +G  +    ++D A   + KA 
Sbjct: 537 TWCCMGNFLSLQKDHEDAIKAFEKATQVDPNFAYAYTLQGHEHSSNDSFDTAKNCYRKAL 596

Query: 425 ELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFEKA 484
             DP++   Y  L     +  ++D+    F +A+   P    +       L      EKA
Sbjct: 597 ACDPQHYNAYYGLGMSCMKLGQYDEALLHFEKARSINPINVILICCCGVALEKLQYQEKA 656

Query: 485 LKQYDLAIELE 495
           L  Y+LA EL+
Sbjct: 657 LSYYELACELQ 667

>YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}
           CNS1TPR-containing co-chaperone; binds both Hsp82p
           (Hsp90) and Ssa1p (Hsp70) and stimulates the ATPase
           activity of SSA1, ts mutants reduce Hsp82p function
           while over expression suppresses the phenotypes of an
           HSP82 ts allele and a cpr7 deletion
          Length = 385

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 44/79 (55%), Gaps = 5/79 (6%)

Query: 102 LKDKGNQFFRNKKYDDAIKYYN--WALELKDDPV---FYSNLSACYVSVGDLKKVVEMST 156
            K +GN+ ++ K++ DA + Y+   A+E +D  +    Y+N +AC + + + ++ +E  +
Sbjct: 86  FKKQGNELYKAKRFKDARELYSKGLAVECEDKSINESLYANRAACELELKNYRRCIEDCS 145

Query: 157 KALELKPDYSKVLLRRASA 175
           KAL + P   K   R + A
Sbjct: 146 KALTINPKNVKCYYRTSKA 164

 Score = 34.7 bits (78), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 54/106 (50%), Gaps = 2/106 (1%)

Query: 394 SNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETL 453
           S N S+Y +R      L+NY +  +D  KA  ++P+N+  Y + +   ++ NK ++ ++ 
Sbjct: 118 SINESLYANRAACELELKNYRRCIEDCSKALTINPKNVKCYYRTSKAFFQLNKLEEAKSA 177

Query: 454 FSEAKRKF-PEAPEVPNFFAEILTDKNDFE-KALKQYDLAIELENK 497
            + A ++  PE   + N  + I   + + + K  KQ   A E ENK
Sbjct: 178 ATFANQRIDPENKSILNMLSVIDRKEQELKAKEEKQQREAQERENK 223

>TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.506
           YBR155W
          Length = 375

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 42/79 (53%), Gaps = 5/79 (6%)

Query: 102 LKDKGNQFFRNKKYDDAIKYYNWALELK--DDPV---FYSNLSACYVSVGDLKKVVEMST 156
            K++GN+F++ K+Y DA + Y   +++K  DD +    Y+N +AC + + + +K +E   
Sbjct: 77  FKNRGNEFYKLKQYRDAREVYTKGIDVKCDDDKINESLYANRAACELELKNFRKCIEDCK 136

Query: 157 KALELKPDYSKVLLRRASA 175
           KAL       K   R   A
Sbjct: 137 KALSFNVKNIKCYYRMGKA 155

>NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON} 
          Length = 620

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 43/86 (50%), Gaps = 2/86 (2%)

Query: 102 LKDKGNQFFRNKKYDDAIKYYNWALEL--KDDPVFYSNLSACYVSVGDLKKVVEMSTKAL 159
           LK+ GN+ ++ K Y+ A+ Y+  AL     +  + YSN +A ++ +    + +E     +
Sbjct: 11  LKELGNKTYKEKGYEQAVHYFTSALSQPSTNKHILYSNRAAAHIGLKHYAEALEDGKNCV 70

Query: 160 ELKPDYSKVLLRRASANEGLGNFADA 185
           EL P++ K   R   A  GL    +A
Sbjct: 71  ELAPNWDKGYSRVGVAYLGLQKLDEA 96

 Score = 35.4 bits (80), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 36/71 (50%), Gaps = 1/71 (1%)

Query: 106 GNQFFRNKKYDDAIKYYNWALELK-DDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPD 164
           G Q F N++Y  A+K Y   ++     PV + N +A +  +    +V++   KA+ + P 
Sbjct: 436 GKQHFLNREYFKAMKCYTEMIKTNPTSPVGWCNRAAVFEKLLTCPQVIDDCDKAISVDPS 495

Query: 165 YSKVLLRRASA 175
           Y K  +R+  A
Sbjct: 496 YIKAYVRKGFA 506

>KNAG0B02240 Chr2 complement(434466..436685) [2220 bp, 739 aa] {ON}
           Anc_7.412 YBL084C
          Length = 739

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 49/184 (26%), Positives = 74/184 (40%), Gaps = 13/184 (7%)

Query: 368 YMALIMADRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELD 427
           Y +LI     D  E    F+KA  LD   +  Y  +G  +   + YD A   + KA   D
Sbjct: 530 YFSLI----KDHGEAIKAFEKATSLDRKFAYAYTLQGHEHAANETYDTAKIMYRKAIACD 585

Query: 428 PENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFEKALKQ 487
           P++   Y  L   A R  K+D     F +A+   P    +       L   N  ++AL  
Sbjct: 586 PQHYNAYYGLGDCASRLGKYDKALLYFEKARVINPVNAILICCCGHSLEKLNLPDQALTY 645

Query: 488 YDLAIELENKLDGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEEASKLDPRSEQAKIG 547
           Y+LA +L+ ++        P   KA LL    ++  F  A  + E  +KL P        
Sbjct: 646 YELAEKLQPEM------TIPKYKKAQLLF---SLGKFSSAMYIFESLTKLSPEEVTVHFM 696

Query: 548 LAQM 551
           L Q+
Sbjct: 697 LGQI 700

 Score = 35.0 bits (79), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 49/111 (44%)

Query: 385 YFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRE 444
           YF+KA  ++  N+ +    G     L   DQA   ++ A++L PE   P  + A L +  
Sbjct: 611 YFEKARVINPVNAILICCCGHSLEKLNLPDQALTYYELAEKLQPEMTIPKYKKAQLLFSL 670

Query: 445 NKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFEKALKQYDLAIELE 495
            KF     +F    +  PE   V     +I       + A+K+Y +A+ L+
Sbjct: 671 GKFSSAMYIFESLTKLSPEEVTVHFMLGQIYQTMGRKKDAIKEYTIALNLD 721

>SAKL0B07986g Chr2 complement(675999..678641) [2643 bp, 880 aa] {ON}
           highly similar to uniprot|P14922 Saccharomyces
           cerevisiae YBR112C CYC8 General transcriptional co-
           repressor acts together with Tup1p also acts as part of
           a transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 880

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 31/131 (23%), Positives = 58/131 (44%), Gaps = 8/131 (6%)

Query: 384 NYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYR 443
           N   K+L++DS +++ +YH G+++ +  +Y  A   F +A   D  N   +  +  L Y+
Sbjct: 295 NLLLKSLEVDSTDATTWYHLGRIHMVRNDYTAAYDAFQQAVNRDSRNPTFWCSIGVLYYQ 354

Query: 444 ENKFDDCETLFSEAKRKFPEAPEVPNFFAEIL-TDKNDFEKALKQYDLA-------IELE 495
            +++ D    ++ A R  P   EV      +  T  N    AL  Y  A       + + 
Sbjct: 355 ISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLTDALDAYKQAARLDPNNVHIR 414

Query: 496 NKLDGIYVGIA 506
            +LD +   +A
Sbjct: 415 ERLDALTAQLA 425

>KAFR0C01850 Chr3 (369596..371536) [1941 bp, 646 aa] {ON} Anc_5.352
           YDR320C
          Length = 646

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 46/163 (28%), Positives = 75/163 (46%), Gaps = 30/163 (18%)

Query: 105 KGNQFFRNKKYDDAIKYYNWALEL--KDDP---VFYSNLSACYVSVGDLKKVVEMSTKAL 159
           +G+ FF+N  Y  A++ Y  +L    +  P   + YSN++A  + +G+   +V+ + KAL
Sbjct: 363 RGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSNLVKKADKAL 422

Query: 160 ELKPD---------------------YSKVLLRRASANEGLGNFADAMFDLSVLSLNGDF 198
           +L P                      +SK++LR+A A E L NF  A      L  N  F
Sbjct: 423 KLFPKENLKWNLIIQDSEPHKSYKDIWSKLVLRKAEALEHLENFELAYKQYHSLIENNVF 482

Query: 199 NDASIEP--MLERNLNKQAMSKLKEKFGDIDTATATPTELSTQ 239
           +D  ++     ++ LN +   K ++K      A A PT  STQ
Sbjct: 483 SDKIMDGKRRCQKVLNPEIAKKTQQKPSSSKPA-AVPTP-STQ 523

>NDAI0E04040 Chr5 (900685..903036) [2352 bp, 783 aa] {ON} Anc_7.412
           YBL084C
          Length = 783

 Score = 41.6 bits (96), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 58/231 (25%), Positives = 93/231 (40%), Gaps = 60/231 (25%)

Query: 338 IFKFLKNDP-----LG----AHEDIKKAIELFPRVN----SYIYMALIMADRNDSTEYY- 383
           + K  KN+P     LG      +D K+AI+ F +V     ++ Y   + A    S + + 
Sbjct: 557 LLKEFKNEPQTWCCLGNLFSLQKDHKEAIKAFEKVTKLDPTFTYGYTLQAHEYLSDDSFD 616

Query: 384 ---NYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACL 440
              NYF KA+  DS + + YY  G  +  L  ++ A   F+KA+ ++P N+   I + C 
Sbjct: 617 LAKNYFRKAVSTDSQHYNAYYGIGMCSMKLGEFEHALLYFEKARSINPSNV---ILICC- 672

Query: 441 AYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFEKALKQYDLAIELENKLDG 500
                    C   F   K  +P                   EKAL  Y+LA +++     
Sbjct: 673 ---------CGVAFE--KLSYP-------------------EKALSYYELACQVQPS--- 699

Query: 501 IYVGIAPLVGKATLLTRNPTVENFIEATNLLEEASKLDPRSEQAKIGLAQM 551
               +A    +A LL    ++ N+  A    EE +KL P        L Q+
Sbjct: 700 --SSLAKF-KRAHLLY---SMANYPLALECFEELTKLAPEEATVHFILGQL 744

 Score = 33.5 bits (75), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 34/168 (20%), Positives = 71/168 (42%), Gaps = 9/168 (5%)

Query: 404 GQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPE 463
           G ++F + NY+ + K F+K ++L P  +      + L +  +       L +E  ++F  
Sbjct: 504 GMLHFEIVNYEMSLKYFEKLRKLQPTRLKDLETYSTLLWHLHDKIKLTVLSNELLKEFKN 563

Query: 464 APEVPNFFAEILTDKNDFEKALKQYDLAIELENKLDGIYVGIAPLVGKATLLTRNPTVEN 523
            P+       + + + D ++A+K    A E   KLD  +     L     L     + ++
Sbjct: 564 EPQTWCCLGNLFSLQKDHKEAIK----AFEKVTKLDPTFTYGYTLQAHEYL-----SDDS 614

Query: 524 FIEATNLLEEASKLDPRSEQAKIGLAQMKLQQEDIDEAITLFEESADL 571
           F  A N   +A   D +   A  G+    ++  + + A+  FE++  +
Sbjct: 615 FDLAKNYFRKAVSTDSQHYNAYYGIGMCSMKLGEFEHALLYFEKARSI 662

>Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 61/126 (48%), Gaps = 12/126 (9%)

Query: 102 LKDKGNQFFRNKKYDDAIKYY--NWALELKDDPV---FYSNLSACYVSVGDLKKVVEMST 156
            K +GN+ ++ K++ DA + Y    A+E +D  +    ++N +AC + + + ++ +E  +
Sbjct: 86  FKKQGNELYKAKRFKDARELYTKGIAVECEDKSINESLFANRAACELELKNYRRCIEDCS 145

Query: 157 KALELKPDYSKVLLRRASANEGLGNFADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAM 216
           KAL + P   K   R + A   L    +A            F + SIEP  +  LN  ++
Sbjct: 146 KALTINPKNIKCYYRTSKAFFSLSKLEEA-------KSAAIFANQSIEPENKSILNMLSV 198

Query: 217 SKLKEK 222
            + KE+
Sbjct: 199 IERKEQ 204

>KLTH0F10428g Chr6 (902697..905084) [2388 bp, 795 aa] {ON} highly
           similar to uniprot|P14922 Saccharomyces cerevisiae
           YBR112C CYC8 General transcriptional co- repressor acts
           together with Tup1p also acts as part of a
           transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 795

 Score = 41.6 bits (96), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 53/119 (44%), Gaps = 1/119 (0%)

Query: 378 DSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQL 437
           D+    N   K+L++DS +++ +YH G+++ +  +Y  A   F  A   D  N   +  +
Sbjct: 293 DTQTALNLLLKSLEVDSTDATTWYHLGRIHMVRNDYTAAYDAFQHAVNRDSRNPTFWCSI 352

Query: 438 ACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEIL-TDKNDFEKALKQYDLAIELE 495
             L Y+ +++ D    ++ A R  P   EV      +  T  N    AL  Y  A  L+
Sbjct: 353 GVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLTDALDAYKQAARLD 411

>TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 56/122 (45%), Gaps = 6/122 (4%)

Query: 102 LKDKGNQFFRNKKYDDAIKYYNWALELKDDPV-----FYSNLSACYVSVGDLKKVVEMST 156
            K++GN  ++ K++ DA + YN  +E+K D        Y+N +AC + + + ++ +    
Sbjct: 81  FKNQGNDLYKAKRFKDARELYNKGIEIKCDDTSINESLYANRAACELEIKNYRRCLNDCK 140

Query: 157 KALELKPDYSKVLLRRASANEGLGNFADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAM 216
            AL+  P   K   R   A   L    +A   +    L  D ++  ++ +L+  L KQ  
Sbjct: 141 TALQYNPKNLKCYYRMGKAFLALELLEEAQKSVE-FGLQVDSSNKPLQSLLDIVLKKQEA 199

Query: 217 SK 218
            K
Sbjct: 200 KK 201

>Smik_4.579 Chr4 complement(1032558..1034561) [2004 bp, 667 aa] {ON}
           YDR320C (REAL)
          Length = 667

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 46/162 (28%), Positives = 74/162 (45%), Gaps = 30/162 (18%)

Query: 102 LKDKGNQFFRNKKYDDAIKYYNWALEL--KDDP---VFYSNLSACYVSVGDLKKVVEMST 156
            K KG+ FF+N  Y ++++ Y  +L     + P   +  SN+ A  + VG+  K +E S+
Sbjct: 377 FKAKGSNFFKNGDYVNSLQEYEKSLNSLPSNHPLRIIALSNIIASQLKVGEYSKSIENSS 436

Query: 157 KALELKPD---------------------YSKVLLRRASANEGLGNFADAMFDLSVLSLN 195
            AL L P                      + K+++RRA + E L +F++A+     L +N
Sbjct: 437 MALALFPPTKANWSNMISDSDPQRSFNDIWPKIMIRRAESFEHLESFSNALETYQEL-IN 495

Query: 196 GDFNDASIEPMLERNLNKQAMSKLKEKFGDIDTATAT--PTE 235
            +F D  I     R  N      +K KF  +  AT+T  PTE
Sbjct: 496 KNFFDEKIMQGKRRCQNFINPPPVK-KFSPVKKATSTQSPTE 536

>SAKL0H10934g Chr8 complement(945834..946976) [1143 bp, 380 aa] {ON}
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155W CNS1 cyclophilin seven suppressor component of
           Hsp90p chaperone machinery
          Length = 380

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 29/117 (24%), Positives = 56/117 (47%), Gaps = 6/117 (5%)

Query: 102 LKDKGNQFFRNKKYDDAIKYYNWALELK--DDPV---FYSNLSACYVSVGDLKKVVEMST 156
            K++GN  +R ++Y DA + YN  +E+   DD +    + N +AC + + + ++ +    
Sbjct: 83  FKNQGNDLYRARRYKDARELYNKGVEVHCDDDAINESLFLNRAACELELKNHRRCINDCK 142

Query: 157 KALELKPDYSKVLLRRASANEGLGNFADAMFDLSVLSLNGDFNDASIEPMLERNLNK 213
           +AL   P   K   R   A   L    +A   +    L  D N+A++  +L++ + K
Sbjct: 143 EALRYNPKNVKCFYRMGRAFFSLNKLEEAKEAIE-FGLRFDSNNAALGALLDKIVKK 198

>KLLA0B09262g Chr2 (814303..817128) [2826 bp, 941 aa] {ON} highly
           similar to uniprot|P14922 Saccharomyces cerevisiae
           YBR112C CYC8 General transcriptional co- repressor acts
           together with Tup1p also acts as part of a
           transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 941

 Score = 41.2 bits (95), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 44/90 (48%)

Query: 378 DSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQL 437
           D  +  N   K+L++DS +++ +YH G+++ I  +Y  A   F +A   D  N   +  +
Sbjct: 339 DPQKALNLLLKSLEIDSTDATSWYHLGRIHMIRNDYTSAYDAFQQAVNRDSRNPTFWCSI 398

Query: 438 ACLAYRENKFDDCETLFSEAKRKFPEAPEV 467
             L Y+  ++ D    ++ A R  P   EV
Sbjct: 399 GVLYYQIAQYRDALDAYTRAIRLNPYISEV 428

>Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {ON}
           YOR007C (REAL)
          Length = 346

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 52/98 (53%), Gaps = 2/98 (2%)

Query: 102 LKDKGNQFFRNKKYDDAIKYYNWALE-LKDDPVFYSNLSACYVSVGDLKKVVEMSTKALE 160
           LK +GN+   NK+Y+ AIK Y  A++ L  + ++Y+N +A + S+ +  + ++ +  A+ 
Sbjct: 105 LKIQGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAIS 164

Query: 161 LKPDYSKVLLRRASANEGLGNFADAMFDL-SVLSLNGD 197
           + P Y +   R   A    G   +A+     VL + GD
Sbjct: 165 VDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGD 202

>Ecym_3459 Chr3 (864878..868225) [3348 bp, 1115 aa] {ON} similar to
           Ashbya gossypii ADL344W
          Length = 1115

 Score = 41.2 bits (95), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 52/113 (46%), Gaps = 1/113 (0%)

Query: 384 NYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYR 443
           N   K+L++DS +++ +YH G+++ +  +Y  A   F +A   D  N   +  +  L Y+
Sbjct: 365 NLLLKSLEVDSTDATTWYHLGRIHMVRNDYTAAYDAFQQAVNRDSRNPTFWCSIGVLYYQ 424

Query: 444 ENKFDDCETLFSEAKRKFPEAPEVPNFFAEIL-TDKNDFEKALKQYDLAIELE 495
            +++ D    ++ A R  P   EV      +  T  N    AL  Y  A  L+
Sbjct: 425 ISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLNDALDAYKQAARLD 477

>YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}
           PPT1Protein serine/threonine phosphatase, regulates
           Hsp90 chaperone by affecting its ATPase and cochaperone
           binding activities; has similarity to human phosphatase
           PP5; present in both the nucleus and cytoplasm;
           expressed during logarithmic growth
          Length = 513

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 49/95 (51%), Gaps = 1/95 (1%)

Query: 99  ALALKDKGNQFFRNKKYDDAIKYYNWALEL-KDDPVFYSNLSACYVSVGDLKKVVEMSTK 157
           AL  K++GN F + K +  AI+ Y  A++L     +++SN +  +  V + +  +    +
Sbjct: 12  ALERKNEGNVFVKEKHFLKAIEKYTEAIDLDSTQSIYFSNRAFAHFKVDNFQSALNDCDE 71

Query: 158 ALELKPDYSKVLLRRASANEGLGNFADAMFDLSVL 192
           A++L P   K   RRA +   L  F  A  DL+VL
Sbjct: 72  AIKLDPKNIKAYHRRALSCMALLEFKKARKDLNVL 106

 Score = 37.7 bits (86), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 37/63 (58%), Gaps = 2/63 (3%)

Query: 386 FDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQ--LACLAYR 443
           + +A+ LDS  S  + +R   +F + N+  A  D D+A +LDP+NI  Y +  L+C+A  
Sbjct: 35  YTEAIDLDSTQSIYFSNRAFAHFKVDNFQSALNDCDEAIKLDPKNIKAYHRRALSCMALL 94

Query: 444 ENK 446
           E K
Sbjct: 95  EFK 97

>ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 46/95 (48%), Gaps = 1/95 (1%)

Query: 99  ALALKDKGNQFFRNKKYDDAIKYYNWALELKDD-PVFYSNLSACYVSVGDLKKVVEMSTK 157
           AL  KD+GN F + + +  A + Y  A+EL D   +F+SN +  ++   + +  +    K
Sbjct: 12  ALEYKDQGNDFVKKQDFIKAAELYTKAIELDDTKSIFFSNRALAHLKQDNFQLSLNDCDK 71

Query: 158 ALELKPDYSKVLLRRASANEGLGNFADAMFDLSVL 192
           ALEL     K   RR  +  GL  F  A  DL  +
Sbjct: 72  ALELDSKNIKAYHRRGLSYVGLLEFKKARTDLKTV 106

>KLTH0E11748g Chr5 (1043203..1044339) [1137 bp, 378 aa] {ON} similar
           to uniprot|P33313 Saccharomyces cerevisiae YBR155W CNS1
           cyclophilin seven suppressor component of Hsp90p
           chaperone machinery
          Length = 378

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 43/89 (48%), Gaps = 5/89 (5%)

Query: 102 LKDKGNQFFRNKKYDDAIKYYNWALELKDD-----PVFYSNLSACYVSVGDLKKVVEMST 156
            K++GN  +R K+Y DA + YN  +++K D        +SN +AC + + + ++ V    
Sbjct: 81  FKNQGNDLYRAKRYKDAREIYNRGIDIKCDDSKVNESLFSNRAACELELKNYRRCVNDCK 140

Query: 157 KALELKPDYSKVLLRRASANEGLGNFADA 185
           +AL+      K   R A A   L    DA
Sbjct: 141 RALQYNVKNIKCYYRIAKAFLLLNKLEDA 169

>TBLA0D00460 Chr4 complement(113831..116338) [2508 bp, 835 aa] {ON}
           Anc_7.412 YBL084C
          Length = 835

 Score = 40.4 bits (93), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 52/116 (44%), Gaps = 10/116 (8%)

Query: 330 AISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRVNSYIYMALIMADRNDSTEYY----NY 385
           +IS    G +  L ND   A + +KKA  + PR   + Y   +      S + +    N 
Sbjct: 618 SISWCFIGNYFSLINDHDKAIKYLKKATTINPR---FTYAYTLEGHEQASIDAFDTAKNC 674

Query: 386 FDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLA 441
           + KA+  D N+ + YY  G     L  YDQA   F+KAK ++P N    I L C  
Sbjct: 675 YRKAIACDPNHYNAYYGLGTCCMRLGQYDQALLYFEKAKMINPSNA---ILLCCCG 727

>Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 40.0 bits (92), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 45/87 (51%), Gaps = 5/87 (5%)

Query: 94  EKDRYALALKDKGNQFFRNKKYDDAIKYYNWALELKDDPVF-----YSNLSACYVSVGDL 148
           E    A   K +GN+ ++ K++ DA + Y   L ++ +  F     ++N +AC + + + 
Sbjct: 78  EPHEIAGGFKKQGNELYKAKRFKDARELYIKGLNVECEDKFINESLFANKAACELELKNY 137

Query: 149 KKVVEMSTKALELKPDYSKVLLRRASA 175
           ++ +E  +KAL + P  +K   R + A
Sbjct: 138 RRCIEDCSKALSINPKNTKCYYRTSKA 164

>Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 40.0 bits (92), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 49/95 (51%), Gaps = 1/95 (1%)

Query: 99  ALALKDKGNQFFRNKKYDDAIKYYNWALEL-KDDPVFYSNLSACYVSVGDLKKVVEMSTK 157
           AL  K++GN F + K +  AI+ Y  A++L     +++SN +  +  V + +  +    +
Sbjct: 12  ALERKNEGNVFVKEKHFLKAIEKYTEAIDLDATQSIYFSNRAFAHFKVDNFQSALNDCDE 71

Query: 158 ALELKPDYSKVLLRRASANEGLGNFADAMFDLSVL 192
           A++L P   K   RRA +   L  F  A  DL+VL
Sbjct: 72  AIKLDPKNIKAYHRRALSCMALLEFKKAKKDLNVL 106

 Score = 36.6 bits (83), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 37/63 (58%), Gaps = 2/63 (3%)

Query: 386 FDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQ--LACLAYR 443
           + +A+ LD+  S  + +R   +F + N+  A  D D+A +LDP+NI  Y +  L+C+A  
Sbjct: 35  YTEAIDLDATQSIYFSNRAFAHFKVDNFQSALNDCDEAIKLDPKNIKAYHRRALSCMALL 94

Query: 444 ENK 446
           E K
Sbjct: 95  EFK 97

>TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.328
           YCR060W
          Length = 120

 Score = 37.7 bits (86), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 103 KDKGNQFFRNKKYDDAIKYYNWALELK-DDPVFYSNLSACYVSVGDLKKVVEMSTKALEL 161
           K++GN+ F+   Y  A + Y   ++++ ++P+ YSN +   + +G   +VVE+  K L  
Sbjct: 7   KEEGNRNFKEGSYKVAAELYQKCVDIEPENPIGYSNKAMALIKLGRYTEVVELCRKGLTF 66

Query: 162 KPDYSKVLLRR 172
            P+ +  + ++
Sbjct: 67  TPNTTDTVYKK 77

>CAGL0C01903g Chr3 complement(199487..201796) [2310 bp, 769 aa] {ON}
           similar to uniprot|P38042 Saccharomyces cerevisiae
           YBL084c CDC27 subunit of anaphase-promoting complex
          Length = 769

 Score = 40.4 bits (93), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 37/168 (22%), Positives = 68/168 (40%), Gaps = 9/168 (5%)

Query: 404 GQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPE 463
           G++++ + NY+ A   F +  EL P  I      + L +    +    +L       +P 
Sbjct: 490 GKLHYEIVNYEMASIYFMQLFELQPYRISDTEIFSTLLWHLQDYKRLASLVDYLLTYYPN 549

Query: 464 APEVPNFFAEILTDKNDFEKALKQYDLAIELENKLDGIYVGIAPLVGKATLLTRNPTVEN 523
            PE        L+ K D E A++ ++ A +++ K    Y     L G         + ++
Sbjct: 550 KPETWCCVGNYLSLKKDHEDAIEAFEKATKIDPKFAYAYT----LQGHEC-----SSNDS 600

Query: 524 FIEATNLLEEASKLDPRSEQAKIGLAQMKLQQEDIDEAITLFEESADL 571
           F  A     +A   DPR   A  G+    ++    DEA+  FE++  +
Sbjct: 601 FDAAKKCFRKAIACDPRHYNAYYGMGIYSMKLGHYDEALLYFEKARQI 648

 Score = 37.7 bits (86), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 46/187 (24%), Positives = 80/187 (42%), Gaps = 11/187 (5%)

Query: 386 FDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYREN 445
           F+KA K+D   +  Y  +G       ++D A K F KA   DP +   Y  +   + +  
Sbjct: 574 FEKATKIDPKFAYAYTLQGHECSSNDSFDAAKKCFRKAIACDPRHYNAYYGMGIYSMKLG 633

Query: 446 KFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFE-KALKQYDLAIELENKLDGIYVG 504
            +D+    F +A++ +P    V      +  +K +++ KAL+ Y+LA  L+   +     
Sbjct: 634 HYDEALLYFEKARQIYP-INAVLICCCGVALEKLEYQDKALEYYELACTLQPNSNLARFK 692

Query: 505 IAPLVGKATLLTRNPTVENFIEATNLLEEASKLDPRSEQAKIGLAQMKLQQEDIDEAITL 564
            A L+    +   N  +++F       EE SKL P        L Q+       +EAI  
Sbjct: 693 RANLL--YAMGRYNLALQSF-------EELSKLTPEEPTVHFVLGQLYQIMGRKNEAIRE 743

Query: 565 FEESADL 571
           F  + +L
Sbjct: 744 FTVAMNL 750

 Score = 35.8 bits (81), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 43/200 (21%), Positives = 78/200 (39%), Gaps = 41/200 (20%)

Query: 336 TGIFKFLKNDPLGAHEDIKKAIELFPRVNSYIYMALIMADRNDSTEYYN----YFDKALK 391
            G +  LK D   A E  +KA ++ P+   + Y   +      S + ++     F KA+ 
Sbjct: 557 VGNYLSLKKDHEDAIEAFEKATKIDPK---FAYAYTLQGHECSSNDSFDAAKKCFRKAIA 613

Query: 392 LDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENI-------------------F 432
            D  + + YY  G  +  L +YD+A   F+KA+++ P N                     
Sbjct: 614 CDPRHYNAYYGMGIYSMKLGHYDEALLYFEKARQIYPINAVLICCCGVALEKLEYQDKAL 673

Query: 433 PYIQLAC---------------LAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTD 477
            Y +LAC               L Y   +++     F E  +  PE P V     ++   
Sbjct: 674 EYYELACTLQPNSNLARFKRANLLYAMGRYNLALQSFEELSKLTPEEPTVHFVLGQLYQI 733

Query: 478 KNDFEKALKQYDLAIELENK 497
                +A++++ +A+ L+ K
Sbjct: 734 MGRKNEAIREFTVAMNLDPK 753

>Kwal_23.3670 s23 (387536..389944) [2409 bp, 802 aa] {ON} YBR112C
           (CYC8) - 1:1 [contig 253] FULL
          Length = 802

 Score = 40.0 bits (92), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 51/113 (45%), Gaps = 1/113 (0%)

Query: 384 NYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYR 443
           N   K+L++DS +++ +YH G+++ +  +Y  A   F  A   D  N   +  +  L Y+
Sbjct: 303 NLLLKSLEVDSTDATTWYHLGRIHMVRNDYTAAYDAFQHAVNRDSRNPTFWCSIGVLYYQ 362

Query: 444 ENKFDDCETLFSEAKRKFPEAPEVPNFFAEIL-TDKNDFEKALKQYDLAIELE 495
            +++ D    ++ A R  P   EV      +  T  N    AL  Y  A  L+
Sbjct: 363 ISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLTDALDAYKQAARLD 415

>KNAG0F04010 Chr6 (757749..762005) [4257 bp, 1418 aa] {ON} Anc_7.546
           YPR189W
          Length = 1418

 Score = 40.0 bits (92), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 31/125 (24%), Positives = 58/125 (46%), Gaps = 4/125 (3%)

Query: 355 KAIELFPRVNSYIYMALIMA--DRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQN 412
           +AI++  R  ++ Y  + +A  +R   +E   +F  AL++D N+   +   GQ  F    
Sbjct: 675 EAIKMELRSTNWPYRVIGIAYLERQQESESVEWFHSALRVDPNDVESWVALGQAYFACGR 734

Query: 413 YDQAGKDFDKAKELDPENIFP-YIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFF 471
            + + K F+KA E+DP +++  Y     LA     F++C  +     +  PE       +
Sbjct: 735 VEASTKVFEKAIEIDPLHLYAQYFNSLSLA-EMGCFEECIEILKNITQLNPEELAFQVSY 793

Query: 472 AEILT 476
           + IL 
Sbjct: 794 SSILV 798

>KNAG0I02520 Chr9 complement(487699..488052) [354 bp, 117 aa] {ON}
           Anc_6.328 YCR060W
          Length = 117

 Score = 37.0 bits (84), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 43/90 (47%), Gaps = 8/90 (8%)

Query: 101 ALKDKGNQFFRNKKYDDAIKYYNWALELK-DDPVFYSNLSACYVSVGDLKKVVEMSTKAL 159
            +K++GN  FRN  +  A +YY   + L+ ++P+ YSN +   + +    + ++   + L
Sbjct: 6   TVKEQGNVAFRNSNFSSAAEYYGKCICLEPENPIGYSNRAMALIKLQKFSETIDTCQRGL 65

Query: 160 -------ELKPDYSKVLLRRASANEGLGNF 182
                  + +P   K+L R   A E L  F
Sbjct: 66  GKLEDNEKDEPIRKKLLYRLHLAQESLNKF 95

>TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {ON}
           Anc_6.21 YOR007C
          Length = 350

 Score = 38.9 bits (89), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 49/84 (58%), Gaps = 5/84 (5%)

Query: 93  EEKDR----YALALKDKGNQFFRNKKYDDAIKYYNWALEL-KDDPVFYSNLSACYVSVGD 147
           EE+D+     A ALK +GN+    K Y+ A++ YN A++L     V+Y+N +A Y S   
Sbjct: 93  EEEDKELAAKAEALKLEGNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEK 152

Query: 148 LKKVVEMSTKALELKPDYSKVLLR 171
             + ++ +  A++++P++SK   R
Sbjct: 153 YDEAIKDAESAIKVEPNWSKGYSR 176

>KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.506
           YBR155W
          Length = 380

 Score = 38.9 bits (89), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 39/89 (43%), Gaps = 5/89 (5%)

Query: 102 LKDKGNQFFRNKKYDDAIKYYNWALELKDDPV-----FYSNLSACYVSVGDLKKVVEMST 156
            K++GN  ++ K++ DA + Y   +E+K D        Y+N +AC + + + +  +    
Sbjct: 81  FKNQGNDLYKVKRFRDAREIYTKGIEMKCDVAKINESLYANRAACQLELKNFRSCISDCK 140

Query: 157 KALELKPDYSKVLLRRASANEGLGNFADA 185
            AL   P   K   R   A   +  F  A
Sbjct: 141 TALTYNPKNIKCYFRMGKAFTAINKFESA 169

>KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar to
           uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 327

 Score = 38.5 bits (88), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 48/89 (53%), Gaps = 1/89 (1%)

Query: 99  ALALKDKGNQFFRNKKYDDAIKYYNWALE-LKDDPVFYSNLSACYVSVGDLKKVVEMSTK 157
           A ALK +GN+    K ++ AI  Y+ A+  L  + V+++N +A Y S+    + VE +  
Sbjct: 98  AEALKLEGNKAMATKDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEA 157

Query: 158 ALELKPDYSKVLLRRASANEGLGNFADAM 186
           A+++ P YSK   R   A   LG   +A+
Sbjct: 158 AIKVNPSYSKGYSRLGFAQYALGRPEEAL 186

>KLTH0E10934g Chr5 (981831..983537) [1707 bp, 568 aa] {ON} similar
           to uniprot|P35056 Saccharomyces cerevisiae YDR244W PEX5
           Essential for import of proteins with SKL- like import
           signal into peroxisomal matrix 69-kDa protein containing
           tetratricopeptide repeat (TPR)
          Length = 568

 Score = 38.9 bits (89), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 47/92 (51%), Gaps = 2/92 (2%)

Query: 106 GNQFFRNKKYDDAIKYYNWALELK-DDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPD 164
           G  F+ N  YD  +  +  AL +K DD + ++ L A   +    ++ ++   KAL+LKP 
Sbjct: 426 GILFYSNDDYDKTVDCFRAALAVKPDDELMWNRLGASLANSNRSEEAIQAYRKALQLKPT 485

Query: 165 YSKVLLRRASANEGLGNFADAM-FDLSVLSLN 195
           + +     A +   +G F +A  + L+ LS++
Sbjct: 486 FVRARCNLAVSCMNMGCFKEAAEYLLTALSMH 517

>TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.328
           YCR060W
          Length = 116

 Score = 36.6 bits (83), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 31/61 (50%), Gaps = 1/61 (1%)

Query: 102 LKDKGNQFFRNKKYDDAIKYYNWALEL-KDDPVFYSNLSACYVSVGDLKKVVEMSTKALE 160
           LK KGN  F+N  Y +AI +YN  + +   +P+ YSN +   +      + +    K L+
Sbjct: 6   LKAKGNISFKNGSYSEAISWYNRCISIDPSNPIGYSNKAMALLKADRFDEAITTCEKGLQ 65

Query: 161 L 161
           L
Sbjct: 66  L 66

>CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155w CNS1
          Length = 380

 Score = 38.5 bits (88), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 22/90 (24%), Positives = 45/90 (50%), Gaps = 5/90 (5%)

Query: 102 LKDKGNQFFRNKKYDDAIKYYNWALELKD-----DPVFYSNLSACYVSVGDLKKVVEMST 156
            K +GN  ++ K++ DA + Y+  +++K      +   Y+N +AC + + + ++ +    
Sbjct: 84  FKKQGNDLYKVKRFRDARELYSKGIDVKCQVNTINESLYANRAACELEIKNYRRCINDCK 143

Query: 157 KALELKPDYSKVLLRRASANEGLGNFADAM 186
           +AL+L P   K   R A A   L    +A+
Sbjct: 144 QALQLNPKNIKCYYRIAKAFTALERLDEAL 173

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 35/62 (56%), Gaps = 1/62 (1%)

Query: 378 DSTEYYNY-FDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQ 436
           D+ E Y+   D   ++++ N S+Y +R      ++NY +   D  +A +L+P+NI  Y +
Sbjct: 99  DARELYSKGIDVKCQVNTINESLYANRAACELEIKNYRRCINDCKQALQLNPKNIKCYYR 158

Query: 437 LA 438
           +A
Sbjct: 159 IA 160

>Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {ON}
           YOR007C (REAL)
          Length = 348

 Score = 38.5 bits (88), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 37/65 (56%), Gaps = 1/65 (1%)

Query: 102 LKDKGNQFFRNKKYDDAIKYYNWALE-LKDDPVFYSNLSACYVSVGDLKKVVEMSTKALE 160
           LK +GN+   NK Y+ AI  Y  A++ L  + ++Y+N +A + S+    + VE +  A+ 
Sbjct: 105 LKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAIS 164

Query: 161 LKPDY 165
           + P Y
Sbjct: 165 IDPTY 169

 Score = 32.0 bits (71), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 32/63 (50%)

Query: 384 NYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYR 443
           N + +A+K+   N+  Y +R   +  L+ YD+A +D + A  +DP     Y +L    Y 
Sbjct: 123 NKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPTYFRGYSRLGFAKYA 182

Query: 444 ENK 446
           + K
Sbjct: 183 QGK 185

>NCAS0D02670 Chr4 complement(512529..513584) [1056 bp, 351 aa] {ON}
           Anc_6.21 YOR007C
          Length = 351

 Score = 38.1 bits (87), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 42/143 (29%), Positives = 63/143 (44%), Gaps = 12/143 (8%)

Query: 99  ALALKDKGNQFFRNKKYDDAIKYYNWALELKD------DPVFYSNLSACYVSVGDLKKVV 152
           A+ LK +GN+    + Y DAI  Y  A++L        D  + SN S      G  ++  
Sbjct: 84  AIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEAC 143

Query: 153 EMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDL-SVLSLNGDFNDASIEPMLERNL 211
           + +   +++ P +SK   R A A  G   + DAM     VL L G  N A+     +  +
Sbjct: 144 DDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNAYKQVLDLEG--NKATDTMKRDFEI 201

Query: 212 NKQAMSKLKEKFG-DIDTATATP 233
            KQ    L   F   ID+ +ATP
Sbjct: 202 TKQKFETL--NFSTHIDSGSATP 222

>TPHA0E01110 Chr5 (228116..230197) [2082 bp, 693 aa] {ON} Anc_5.352
           YDR320C
          Length = 693

 Score = 38.5 bits (88), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 54/125 (43%), Gaps = 26/125 (20%)

Query: 102 LKDKGNQFFRNKKYDDAIKYYNWALEL--KDDP---VFYSNLSACYVSVGDLKKVVEMST 156
            KD+G ++F+   Y  A + Y  +L    K  P   +  SNL A  +  GD   ++ +ST
Sbjct: 400 FKDRGTEYFKKGDYVSATEQYEKSLNSLSKLHPLRIIASSNLLASLLKTGDYTSMITIST 459

Query: 157 KALELKPD---------------------YSKVLLRRASANEGLGNFADAMFDLSVLSLN 195
            AL+L P                      +SK++ RRA A E + N+  A     +L  N
Sbjct: 460 SALDLFPKESKLWDNVIQNSEPSKTYKEIWSKLVARRAEAFEFIENYQQAYDSYQLLIEN 519

Query: 196 GDFND 200
             FN+
Sbjct: 520 NIFNE 524

>SAKL0H11946g Chr8 complement(1020512..1022233) [1722 bp, 573 aa]
           {ON} similar to uniprot|P35056 Saccharomyces cerevisiae
           YDR244W PEX5 Essential for import of proteins with SKL-
           like import signal into peroxisomal matrix 69-kDa
           protein containing tetratricopeptide repeat (TPR)
          Length = 573

 Score = 38.5 bits (88), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 49/92 (53%), Gaps = 2/92 (2%)

Query: 106 GNQFFRNKKYDDAIKYYNWALELK-DDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPD 164
           G  F+ N+ YD  I  +  AL +K DD + ++ L A   +    ++ ++   +AL+LKP 
Sbjct: 429 GILFYANEDYDKTIDCFKAALTVKPDDELMWNRLGASLANSNRSEEAIQAYHRALQLKPS 488

Query: 165 YSKVLLRRASANEGLGNFADAM-FDLSVLSLN 195
           + +     A ++  +G + +A  + L+ LS++
Sbjct: 489 FVRARYNLAVSSMNIGCYKEAAEYLLTALSMH 520

>Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 38.1 bits (87), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 40/75 (53%), Gaps = 5/75 (6%)

Query: 102 LKDKGNQFFRNKKYDDAIKYY--NWALELKDDPV---FYSNLSACYVSVGDLKKVVEMST 156
            K +GN+ ++ K++ DA + Y    A+E +D  +    ++N +AC + + + +K VE   
Sbjct: 86  FKKQGNELYKAKRFKDARELYTKGVAVECEDKSINESLFANRAACELELKNYRKCVEDCG 145

Query: 157 KALELKPDYSKVLLR 171
           KAL + P   K   R
Sbjct: 146 KALTINPKNIKCYYR 160

>YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON}
           SGT2Glutamine-rich cytoplasmic protein that serves as a
           scaffold for binding Get4/5p and other proteins required
           to mediate posttranslational insertion of tail-anchored
           proteins into the ER membrane; has similarity to human
           cochaperone SGT
          Length = 346

 Score = 38.1 bits (87), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 50/98 (51%), Gaps = 2/98 (2%)

Query: 102 LKDKGNQFFRNKKYDDAIKYYNWALE-LKDDPVFYSNLSACYVSVGDLKKVVEMSTKALE 160
           LK +GN+   NK Y+ AI  Y  A++ L  + ++Y+N +A + S+ +  + V+ +  A+ 
Sbjct: 105 LKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAIS 164

Query: 161 LKPDYSKVLLRRASANEGLGNFADAMFDL-SVLSLNGD 197
           + P Y +   R   A    G   +A+     VL + GD
Sbjct: 165 IDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGD 202

 Score = 35.0 bits (79), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 32/63 (50%)

Query: 384 NYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYR 443
           N + +A+K+   N+  Y +R   +  L+ YDQA KD + A  +DP     Y +L    Y 
Sbjct: 123 NKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAKYA 182

Query: 444 ENK 446
           + K
Sbjct: 183 QGK 185

>TBLA0H01520 Chr8 (344716..346785) [2070 bp, 689 aa] {ON} Anc_3.367
           YBR112C
          Length = 689

 Score = 38.1 bits (87), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 35/169 (20%), Positives = 70/169 (41%), Gaps = 27/169 (15%)

Query: 378 DSTEYYN------YFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENI 431
           ++ E+YN      +  K+L+LD  +S+ +Y+ G+++   +++  A +   +A   D  N 
Sbjct: 389 ENVEFYNLDIAMGHLVKSLELDPTDSTTWYYLGRIHMAKKDFTAAYESLQQAVNRDSRNP 448

Query: 432 FPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKND-FEKALKQYDL 490
             +  +  L Y+  +  D    ++ A R  P   EV      +    ND    AL  Y+ 
Sbjct: 449 IFWCSIGVLYYQIGQNHDALDAYTRAIRLNPYISEVWYNLGTLYETCNDQITDALDSYER 508

Query: 491 AIELENKLDGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEEASKLDP 539
           A+ L+                      NP ++  + A  + ++ S+ DP
Sbjct: 509 ALSLD--------------------PENPVIQGRLNALKIQDKKSEYDP 537

>AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR155W
           (CNS1)
          Length = 379

 Score = 37.7 bits (86), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 39/79 (49%), Gaps = 5/79 (6%)

Query: 102 LKDKGNQFFRNKKYDDAIKYYNWALELKDDPVFYSNL-----SACYVSVGDLKKVVEMST 156
            K++GN  ++ K++ DA   YN  +E+K D    S L     +AC + + + ++ +    
Sbjct: 80  FKNQGNDLYKVKRFRDARVMYNKGIEVKCDDAGISELLLLNRAACELELKNYRRCINDCR 139

Query: 157 KALELKPDYSKVLLRRASA 175
           +AL+L P   K   R   A
Sbjct: 140 EALKLNPKNPKAFFRIGKA 158

>NCAS0F02870 Chr6 complement(573068..575170) [2103 bp, 700 aa] {ON}
           Anc_5.352 YDR320C
          Length = 700

 Score = 37.7 bits (86), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 56/125 (44%), Gaps = 26/125 (20%)

Query: 102 LKDKGNQFFRNKKYDDAIKYYNWALEL--KDDP---VFYSNLSACYVSVGDLKKVVEMST 156
            +++G Q+F+N  Y  + + Y  +L     + P   + YSN+ A  + +G+  K ++ S+
Sbjct: 406 FRNRGTQYFKNGDYVSSFQEYEKSLNTLPVNHPLRIIAYSNIIASELKIGEYSKSLKNSS 465

Query: 157 KALELKPD---------------------YSKVLLRRASANEGLGNFADAMFDLSVLSLN 195
            ALE+ PD                     + KV LR+A A E + +F  A+     L   
Sbjct: 466 SALEMFPDDTAQWTAVIQDSDPQRTYKDIWPKVKLRQAEALEHIESFKAALSSYQELIEK 525

Query: 196 GDFND 200
           G  ND
Sbjct: 526 GFAND 530

>KAFR0L01870 Chr12 (345757..347895) [2139 bp, 712 aa] {ON} Anc_7.412
           YBL084C
          Length = 712

 Score = 37.7 bits (86), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 35/165 (21%), Positives = 68/165 (41%), Gaps = 9/165 (5%)

Query: 404 GQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPE 463
           G++++ +QNY  A   F++ + + P  +      + L +  +       L +E    FPE
Sbjct: 433 GKLHYEIQNYKMALSHFERLRIIQPTRLNDLEIFSTLLWHLHDKVKLSNLANELIDNFPE 492

Query: 464 APEVPNFFAEILTDKNDFEKALKQYDLAIELENKLDGIYVGIAPLVGKATLLTRNPTVEN 523
           A +         + + D ++A+K ++ A EL+ +    Y     L G         + E+
Sbjct: 493 AAQTWCVLGNHFSLQKDHDEAIKAFNKATELDPRFAYAYT----LQGHEY-----ASNES 543

Query: 524 FIEATNLLEEASKLDPRSEQAKIGLAQMKLQQEDIDEAITLFEES 568
           F  A     +A   D +   A  GL     Q  + D ++  FE++
Sbjct: 544 FDTARTFYRKALACDSQHYNAYYGLGTCDSQNGNHDRSLLFFEKA 588

 Score = 37.0 bits (84), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 53/204 (25%), Positives = 87/204 (42%), Gaps = 32/204 (15%)

Query: 355 KAIELFPRVNSYIYMALIMADRNDSTEYYN----YFDKALKLDSNNSSVYYHRGQMNFIL 410
           KA EL PR   + Y   +      S E ++    ++ KAL  DS + + YY  G  +   
Sbjct: 519 KATELDPR---FAYAYTLQGHEYASNESFDTARTFYRKALACDSQHYNAYYGLGTCDSQN 575

Query: 411 QNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCET---LFSEAKRKFPEAPEV 467
            N+D++   F+KA+ ++P NI   + + C      K  + E     +  A +  P +   
Sbjct: 576 GNHDRSLLFFEKARMINPVNI---VLICCCGVELEKVRNYELALKYYDFASKLQPNSALA 632

Query: 468 PNFFAEILTDKNDFEKALKQYDLAIELEN---KLDGIYVGIAPLVGKA--TLLTRNPTVE 522
               AE+L        +L +Y LA+EL     KLD     +  ++GK   T+  +   V+
Sbjct: 633 KYRKAELLF-------SLGRYSLAVELFEDLIKLDSENPNLHYMLGKIYQTMGRKKDAVK 685

Query: 523 NFIEATNLLEEASKLDPRSEQAKI 546
            +  A N       LDP+  Q  I
Sbjct: 686 EYTVAMN-------LDPKGNQYII 702

>NDAI0I00440 Chr9 complement(89650..90036) [387 bp, 128 aa] {ON}
           Anc_6.328 YCR060W
          Length = 128

 Score = 35.4 bits (80), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 32/60 (53%), Gaps = 1/60 (1%)

Query: 102 LKDKGNQFFRNKKYDDAIKYYNWALELK-DDPVFYSNLSACYVSVGDLKKVVEMSTKALE 160
           LK +GN FF+   Y  A  YY+  ++L+  +P+ YSN +   +  G+    VE   + L+
Sbjct: 6   LKQEGNTFFQKGDYAQANGYYDQCIKLEPTNPIGYSNKAMSLIKQGNHGLAVETCQEGLK 65

>TPHA0E00740 Chr5 complement(142456..144696) [2241 bp, 746 aa] {ON}
           Anc_7.412 YBL084C
          Length = 746

 Score = 37.7 bits (86), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 32/146 (21%), Positives = 57/146 (39%), Gaps = 34/146 (23%)

Query: 386 FDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENI-------------- 431
           + KA+  D  + + YY  G ++  L  Y++A   F+KA+ ++P N+              
Sbjct: 585 YRKAIACDPGHYNAYYGLGMVSMKLGQYEEALLFFEKARSINPINVVLVCCGGVALEKLS 644

Query: 432 -----FPYIQLAC---------------LAYRENKFDDCETLFSEAKRKFPEAPEVPNFF 471
                  Y +LAC               L Y   ++      F E K   P+   V    
Sbjct: 645 YQEKALQYYELACELQPSSSLATFKRAHLLYSMGRYTLALKFFEELKHVAPDEATVHFLL 704

Query: 472 AEILTDKNDFEKALKQYDLAIELENK 497
            +I +     + A+K+Y +A+ L+ K
Sbjct: 705 GQIYSILGRKKDAIKEYTIALNLDPK 730

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 36/168 (21%), Positives = 68/168 (40%), Gaps = 9/168 (5%)

Query: 404 GQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPE 463
           G++++ L NY+ + + F   K L P  +      + L +  N       L SE     P 
Sbjct: 467 GKLHYELVNYEVSLQYFLNLKTLQPSRVKDLEIYSTLLWHLNDKSKLSILSSELITSNPR 526

Query: 464 APEVPNFFAEILTDKNDFEKALKQYDLAIELENKLDGIYVGIAPLVGKATLLTRNPTVEN 523
            PE        L+ + +  +A+K ++ A +++ K    Y     L G         + ++
Sbjct: 527 IPETWCCLGNFLSLQKNHHEAIKAFEKATQVDPKFAYAYT----LQGH-----EYTSSDS 577

Query: 524 FIEATNLLEEASKLDPRSEQAKIGLAQMKLQQEDIDEAITLFEESADL 571
           F  A     +A   DP    A  GL  + ++    +EA+  FE++  +
Sbjct: 578 FDVAKRCYRKAIACDPGHYNAYYGLGMVSMKLGQYEEALLFFEKARSI 625

>YBR112C Chr2 complement(462870..465770) [2901 bp, 966 aa] {ON}
           CYC8General transcriptional co-repressor, acts together
           with Tup1p; also acts as part of a transcriptional
           co-activator complex that recruits the SWI/SNF and SAGA
           complexes to promoters; can form the prion [OCT+]
          Length = 966

 Score = 37.7 bits (86), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 27/118 (22%), Positives = 48/118 (40%), Gaps = 6/118 (5%)

Query: 131 DPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDLS 190
           +P+F+ ++   Y  +   +  ++  T+A+ L P  S+V     +  E   N      D  
Sbjct: 329 NPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLSDALDAY 388

Query: 191 VLSLNGDFNDASIEPMLERNLNKQAMSKLKEKFGDIDTATATPTELSTQAPKELKDKT 248
             +   D N+  I   LE      A++K  E  G+I+ +   PT  S   P  +   T
Sbjct: 389 KQAARLDVNNVHIRERLE------ALTKQLENPGNINKSNGAPTNASPAPPPVILQPT 440

>NCAS0C04350 Chr3 (891570..894833) [3264 bp, 1087 aa] {ON} Anc_3.5
           YOL145C
          Length = 1087

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 47/186 (25%), Positives = 80/186 (43%), Gaps = 33/186 (17%)

Query: 404 GQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACL---------------AYREN--- 445
           G   + L++Y  A K +++A +LD  +      + CL                ++EN   
Sbjct: 229 GACFWHLKDYKMAIKSWERATQLDANS---SASILCLLGKFHNSLTESENDTQFKENYTA 285

Query: 446 KFDDCETLFSEAKRKFPEAPEVP---NFFAEILTDKNDFEKALKQYDLAIELENKL--DG 500
              D  TL+++     PE  E P            KNDFE  LK YD  I+  + L  D 
Sbjct: 286 SLMDLNTLYNDTNH--PENKENPVLLTLLQSYFYYKNDFENVLKIYDEKIKPISTLVADS 343

Query: 501 IYVGIAPLVGKATLLTRNPTVENFIEATNLLEEASKLDPRSEQAKIGLAQMKLQQEDIDE 560
           I        G+A        ++++ +A  + +E+ K +  +  AK+GL Q +L+   ++E
Sbjct: 344 ILSESTLWCGRAYY-----ALDDYRKAFAMFQESLKTNEENLLAKLGLGQAQLKTNLLEE 398

Query: 561 AITLFE 566
           +I  FE
Sbjct: 399 SILTFE 404

>Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 50/101 (49%), Gaps = 2/101 (1%)

Query: 94  EKDRY-ALALKDKGNQFFRNKKYDDAIKYYNWALEL-KDDPVFYSNLSACYVSVGDLKKV 151
           E DR  A   K++GN   + K +  AI+ Y  A++L     +++SN +  +  V + +  
Sbjct: 6   EADRVKAHERKNEGNVLVKEKHFLKAIEKYTEAIDLDSTQTIYFSNRALSHFKVDNFQSA 65

Query: 152 VEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDLSVL 192
           +    +A++L P   K   RRA +   L  F  A  DL+VL
Sbjct: 66  LNDCDEAIKLDPKNIKAYHRRALSCMALLEFKKAKRDLNVL 106

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 37/63 (58%), Gaps = 2/63 (3%)

Query: 386 FDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQ--LACLAYR 443
           + +A+ LDS  +  + +R   +F + N+  A  D D+A +LDP+NI  Y +  L+C+A  
Sbjct: 35  YTEAIDLDSTQTIYFSNRALSHFKVDNFQSALNDCDEAIKLDPKNIKAYHRRALSCMALL 94

Query: 444 ENK 446
           E K
Sbjct: 95  EFK 97

>ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} similar
           to uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 334

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 59/115 (51%), Gaps = 4/115 (3%)

Query: 87  KANFTAEEKD--RYALALKDKGNQFFRNKKYDDAIKYYNWALEL-KDDPVFYSNLSACYV 143
           K N  AE+ +    A +LK +GN+    K Y+ AIK Y+ A+ +   + V+Y+N +A + 
Sbjct: 79  KVNIPAEDAELKSKAESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHS 138

Query: 144 SVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDL-SVLSLNGD 197
           S+ +  + ++ +  A+++   YSK   R   A    G   +A+     VL + GD
Sbjct: 139 SLKNYDEAIKDAESAVKVDSSYSKGYSRLGYAKFAQGKSEEALEAYKKVLDIEGD 193

 Score = 32.3 bits (72), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 58/116 (50%), Gaps = 13/116 (11%)

Query: 386 FDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYREN 445
           + +A+ +   N+  Y +R   +  L+NYD+A KD + A ++D      Y +L    + + 
Sbjct: 116 YSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYSRLGYAKFAQG 175

Query: 446 KFDDCETLFSEAKRKFPEAPEVPNFFAEILTD--KNDFEKALKQYDLAIELENKLD 499
           K +  E L  EA +K      V +   +  TD  K D+E A ++ + A+EL NK D
Sbjct: 176 KSE--EAL--EAYKK------VLDIEGDSATDVMKRDYETAKRKVEQALEL-NKTD 220

>Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {ON}
           YOR007C (REAL)
          Length = 345

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 38/65 (58%), Gaps = 1/65 (1%)

Query: 102 LKDKGNQFFRNKKYDDAIKYYNWALE-LKDDPVFYSNLSACYVSVGDLKKVVEMSTKALE 160
           LK +GN+   NK Y+ AI  Y  A++ L  + ++Y+N +A + S+ +  + V+ +  ++ 
Sbjct: 105 LKMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSIS 164

Query: 161 LKPDY 165
           + P Y
Sbjct: 165 IDPSY 169

 Score = 31.2 bits (69), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 32/63 (50%)

Query: 384 NYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYR 443
           N + +A+++   N+  Y +R   +  L+ YD+A KD + +  +DP     Y +L    Y 
Sbjct: 123 NKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPSYFRGYSRLGFAKYA 182

Query: 444 ENK 446
           + K
Sbjct: 183 QGK 185

>NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 44/97 (45%), Gaps = 5/97 (5%)

Query: 94  EKDRYALALKDKGNQFFRNKKYDDAIKYYNWALELK--DDPV---FYSNLSACYVSVGDL 148
           E    A   K++GN  F  K++ +A   YN  +E+K  +D +    ++N +AC + + + 
Sbjct: 75  EPHEVAENFKNQGNDLFTVKRFREARDIYNKGIEIKCENDKINEALFANRAACQLELKNY 134

Query: 149 KKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADA 185
           +  +     AL L P   K   R   A   L N  +A
Sbjct: 135 RSCINDCKHALTLNPKNIKCYYRMGKAFYLLNNIEEA 171

>Kwal_27.10740 s27 complement(476617..478503) [1887 bp, 628 aa] {ON}
           YBL084C (CDC27) - component of the anaphase-promoting
           complex [contig 33] FULL
          Length = 628

 Score = 37.0 bits (84), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 54/122 (44%), Gaps = 11/122 (9%)

Query: 386 FDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYREN 445
           + KAL  +S + + YY  G  +  L  Y++    F+KA+ ++P N+   I + C      
Sbjct: 467 YRKALASNSQHYNAYYGLGMCSLKLGQYEECLLHFEKARSINPVNV---ILICCCGVALE 523

Query: 446 KFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFEKALKQYDLAIELENKLDGIYVGI 505
           K    E     A + +  A E+    +  L  +     A+ +Y+ A+E   KL    V I
Sbjct: 524 KLSHQE----RALQNYDLACELQPMSSLALFKRAQLLLAMGKYNYALESFEKL----VKI 575

Query: 506 AP 507
           AP
Sbjct: 576 AP 577

>Kwal_27.11737 s27 (926622..928349) [1728 bp, 575 aa] {ON} YDR244W
           (PEX5) - 1:1 [contig 27] FULL
          Length = 575

 Score = 36.6 bits (83), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 23/92 (25%), Positives = 47/92 (51%), Gaps = 2/92 (2%)

Query: 106 GNQFFRNKKYDDAIKYYNWALELK-DDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPD 164
           G  F+ N  YD  +  +  AL ++ DD + ++ L A   +    ++ ++   KAL+LKP 
Sbjct: 433 GILFYSNDDYDKTVDCFRAALAVRPDDELMWNRLGASLANSNRSEEAIQAYRKALQLKPT 492

Query: 165 YSKVLLRRASANEGLGNFADAM-FDLSVLSLN 195
           + +     A +   +G + +A  + L+ LS++
Sbjct: 493 FVRARCNLAVSCMNMGCYKEAAEYLLTALSMH 524

>YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Component
           of the conserved R2TP complex (Rvb1-Rvb2-Tah1-Pih1);
           contains a single TPR domain with at least two TPR
           motifs; R2TP complex interacts with Hsp90 (Hsp82p and
           Hsc82p) to mediate assembly large protein complexes such
           as box C/D snoRNPs and RNA polymerase II
          Length = 111

 Score = 34.3 bits (77), Expect = 0.19,   Method: Composition-based stats.
 Identities = 17/70 (24%), Positives = 35/70 (50%), Gaps = 1/70 (1%)

Query: 103 KDKGNQFFRNKKYDDAIKYYNWALELK-DDPVFYSNLSACYVSVGDLKKVVEMSTKALEL 161
           K++GN  F+   Y +A+  Y+  +  +  +PV YSN +   + +G+  + ++M  + L  
Sbjct: 8   KEQGNSLFKQGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQMCQQGLRY 67

Query: 162 KPDYSKVLLR 171
                 V +R
Sbjct: 68  TSTAEHVAIR 77

>SAKL0F16236g Chr6 (1313573..1317799) [4227 bp, 1408 aa] {ON}
           similar to uniprot|P17883 Saccharomyces cerevisiae
           YPR189W SKI3 dsRNA virus protection family member
           contains 8 copies of the tetratricopeptide (TPR) domain
          Length = 1408

 Score = 36.6 bits (83), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 24/94 (25%), Positives = 43/94 (45%), Gaps = 2/94 (2%)

Query: 385 YFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFP-YIQLACLAYR 443
           +F  AL++D+N+   +   GQ  +     + + K F+KA EL P+++F  Y +   LA  
Sbjct: 700 WFQSALRVDANDVESWVGLGQAYYACGRLEASIKVFEKATELAPDHLFAGYFKAISLA-G 758

Query: 444 ENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTD 477
             +++ C  + +    K P           IL D
Sbjct: 759 IGEYEQCIEIIAALLEKLPNEESFQVSMVNILID 792

>Smik_2.254 Chr2 complement(447517..450579) [3063 bp, 1020 aa] {ON}
           YBR112C (REAL)
          Length = 1020

 Score = 36.6 bits (83), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 26/118 (22%), Positives = 48/118 (40%), Gaps = 6/118 (5%)

Query: 131 DPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDLS 190
           +P+F+ ++   Y  +   +  ++  T+A+ L P  S+V     +  E   N      D  
Sbjct: 331 NPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLSDALDAY 390

Query: 191 VLSLNGDFNDASIEPMLERNLNKQAMSKLKEKFGDIDTATATPTELSTQAPKELKDKT 248
             +   D N+  I   LE      A++K  E  G+++ +   PT  S   P  +   T
Sbjct: 391 KQAARLDVNNVHIRERLE------ALTKQLENPGNMNKSNGAPTNASPAPPPVILQPT 442

>YDR320C Chr4 complement(1106095..1108101) [2007 bp, 668 aa] {ON}
           SWA2Auxilin-like protein involved in vesicular
           transport; clathrin-binding protein required for
           uncoating of clathrin-coated vesicles
          Length = 668

 Score = 36.6 bits (83), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 50/111 (45%), Gaps = 26/111 (23%)

Query: 102 LKDKGNQFFRNKKYDDAIKYYNWALELK--DDP---VFYSNLSACYVSVGDLKKVVEMST 156
            K KG   F+N  Y ++++ Y  +L     + P   +  SN+ A  + +G+  K +E S+
Sbjct: 377 FKAKGTSLFKNGDYINSLQEYEKSLNTLPLNHPLRIIALSNIIASQLKIGEYSKSIENSS 436

Query: 157 KALELKPD---------------------YSKVLLRRASANEGLGNFADAM 186
            ALEL P                      + K+++RRA + E L +F  A+
Sbjct: 437 MALELFPSSKAKWKNKISNSDPERSFNDIWPKIMIRRAESFEHLESFKKAL 487

>TDEL0C02720 Chr3 (477529..479631) [2103 bp, 700 aa] {ON} Anc_7.412
           YBL084C
          Length = 700

 Score = 36.6 bits (83), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 32/140 (22%), Positives = 61/140 (43%), Gaps = 1/140 (0%)

Query: 357 IELFP-RVNSYIYMALIMADRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQ 415
           +E  P +  ++  +  + + + D  +   YF+KA K+D N +  Y  +G  +    + D 
Sbjct: 475 VETLPNKPQTWCCLGNLYSLQRDHEDAIKYFEKATKIDYNFAYAYTLQGHEHSSNDSIDT 534

Query: 416 AGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEIL 475
           A   + +A   DP++   Y  L     +  ++D     F +A+   P    +       L
Sbjct: 535 AKNCYRRALACDPQHYNAYYGLGMCYMKLGQYDKALLFFEKARNINPVNVILICCCGVAL 594

Query: 476 TDKNDFEKALKQYDLAIELE 495
              +  EKAL+ Y+ A EL+
Sbjct: 595 EKLSYQEKALQYYEQACELQ 614

 Score = 34.7 bits (78), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 31/168 (18%), Positives = 70/168 (41%), Gaps = 9/168 (5%)

Query: 404 GQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPE 463
           G++++ + NY+++   F++ + + P         + L +  +       L +E     P 
Sbjct: 421 GKLHYEILNYEESLNHFNQLRRMQPTRTQDIEIFSTLLWHLHDSTRLSHLSNELVETLPN 480

Query: 464 APEVPNFFAEILTDKNDFEKALKQYDLAIELENKLDGIYVGIAPLVGKATLLTRNPTVEN 523
            P+       + + + D E A+K ++ A +++      Y     L G     + N +++ 
Sbjct: 481 KPQTWCCLGNLYSLQRDHEDAIKYFEKATKIDYNFAYAYT----LQGHEH--SSNDSIDT 534

Query: 524 FIEATNLLEEASKLDPRSEQAKIGLAQMKLQQEDIDEAITLFEESADL 571
              A N    A   DP+   A  GL    ++    D+A+  FE++ ++
Sbjct: 535 ---AKNCYRRALACDPQHYNAYYGLGMCYMKLGQYDKALLFFEKARNI 579

>KNAG0C05500 Chr3 (1069670..1071427) [1758 bp, 585 aa] {ON}
           Anc_5.352 YDR320C
          Length = 585

 Score = 36.2 bits (82), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 54/125 (43%), Gaps = 26/125 (20%)

Query: 102 LKDKGNQFFRNKKYDDAIKYYNWALEL--KDDP---VFYSNLSACYVSVGDLKKVVEMST 156
            + KG + F+   Y  A+  Y  +L    +  P   +  SN+   Y+ +G+  K ++++ 
Sbjct: 293 FRAKGTELFKKGDYSAAVLEYEKSLNTLPEKHPLRIIAMSNMMLPYLKIGEYTKCLKLAP 352

Query: 157 KALELKPD---------------------YSKVLLRRASANEGLGNFADAMFDLSVLSLN 195
            ALEL P+                     +SK+++R A A E   N+  A  +  +L  N
Sbjct: 353 LALELIPEDRSTWRSVIQQSEPKRTYRDIWSKLVMRLAEAQEHAENYTGAFDNYQLLVAN 412

Query: 196 GDFND 200
           G  N+
Sbjct: 413 GITNE 417

>Ecym_2559 Chr2 (1089202..1090314) [1113 bp, 370 aa] {ON} similar to
           Ashbya gossypii AGL268C
          Length = 370

 Score = 36.2 bits (82), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 39/87 (44%), Gaps = 5/87 (5%)

Query: 94  EKDRYALALKDKGNQFFRNKKYDDAIKYYNWALELK--DDPV---FYSNLSACYVSVGDL 148
           E    A   K++GN  ++ K+Y DA   Y+  +E+K  DD +    Y N +AC + + + 
Sbjct: 74  EPHEVAANFKNQGNDLYKVKRYKDARTMYSKGIEVKCEDDSINGSLYLNRAACELELRNF 133

Query: 149 KKVVEMSTKALELKPDYSKVLLRRASA 175
           +  +    KAL       K   R   A
Sbjct: 134 RSCINDCKKALNFNAKCVKAFYRMGQA 160

>YLR072W Chr12 (278862..280943) [2082 bp, 693 aa] {ON} Protein of
           unknown function; green fluorescent protein (GFP)-fusion
           protein localizes to the cytoplasm in a punctate
           pattern; YLR072W is not an esssential gene
          Length = 693

 Score = 36.2 bits (82), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 45/93 (48%), Gaps = 5/93 (5%)

Query: 192 LSLNGDFNDAS-IEPMLERNLNKQAMSKLKEKFGDIDTATATPTELSTQAPKELKDKTEN 250
           +S   D+N +S I+PM+E N     +S  K+    ++       ELS    KE  D  + 
Sbjct: 533 ISFWVDWNASSWIKPMVESNCKNGQISATKDLVKLVEEFVEKYVELS----KEKADTLKP 588

Query: 251 LPSITSMASFFGIFKPELTFANYDESNEADKDL 283
           LPS+TS  S   +  PELT    +   EA+ ++
Sbjct: 589 LPSVTSFGSPRKVAAPELTMVQPESKPEAEAEI 621

>KNAG0A03950 Chr1 complement(529620..530780) [1161 bp, 386 aa] {ON}
           Anc_8.506 YBR155W
          Length = 386

 Score = 35.8 bits (81), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 44/89 (49%), Gaps = 5/89 (5%)

Query: 102 LKDKGNQFFRNKKYDDAIKYYNWALEL--KDDPV---FYSNLSACYVSVGDLKKVVEMST 156
            K++ N  ++ K++ DA + Y   +++  +D  +    ++N +AC + + + +  V    
Sbjct: 88  FKNQANDLYKVKRFRDARELYTKGIKVFCEDKSINESLFANRAACELELKNYRSCVADCQ 147

Query: 157 KALELKPDYSKVLLRRASANEGLGNFADA 185
           KA+E+ P   K   R   A   LG F +A
Sbjct: 148 KAMEINPMNLKCFYRMGKAFLALGKFKEA 176

>YBL084C Chr2 complement(67169..69445) [2277 bp, 758 aa] {ON}
           CDC27Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C), which is a ubiquitin-protein ligase required
           for degradation of anaphase inhibitors, including
           mitotic cyclins, during the metaphase/anaphase
           transition
          Length = 758

 Score = 36.2 bits (82), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 35/168 (20%), Positives = 70/168 (41%), Gaps = 9/168 (5%)

Query: 404 GQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPE 463
           G+++F + NYD + K F++ K+L P  +      + L +  +       L +      P 
Sbjct: 479 GKLHFEIINYDMSLKYFNRLKDLQPARVKDMEIFSTLLWHLHDKVKSSNLANGLMDTMPN 538

Query: 464 APEVPNFFAEILTDKNDFEKALKQYDLAIELENKLDGIYVGIAPLVGKATLLTRNPTVEN 523
            PE       +L+ + D + A+K ++ A +L+      Y     L G       + + ++
Sbjct: 539 KPETWCCIGNLLSLQKDHDAAIKAFEKATQLDPNFAYAYT----LQGH-----EHSSNDS 589

Query: 524 FIEATNLLEEASKLDPRSEQAKIGLAQMKLQQEDIDEAITLFEESADL 571
              A     +A   DP+   A  GL    ++    +EA+  FE++  +
Sbjct: 590 SDSAKTCYRKALACDPQHYNAYYGLGTSAMKLGQYEEALLYFEKARSI 637

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 49/110 (44%)

Query: 386 FDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYREN 445
           F+KA +LD N +  Y  +G  +    + D A   + KA   DP++   Y  L   A +  
Sbjct: 563 FEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYRKALACDPQHYNAYYGLGTSAMKLG 622

Query: 446 KFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFEKALKQYDLAIELE 495
           ++++    F +A+   P    +       L      EKAL+ Y+LA  L+
Sbjct: 623 QYEEALLYFEKARSINPVNVVLICCCGGSLEKLGYKEKALQYYELACHLQ 672

>Smik_2.36 Chr2 complement(61159..63414) [2256 bp, 751 aa] {ON}
           YBL084C (REAL)
          Length = 751

 Score = 35.8 bits (81), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 35/168 (20%), Positives = 70/168 (41%), Gaps = 9/168 (5%)

Query: 404 GQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPE 463
           G+++F + NYD + K F++ K+L P  +      + L +  +       L +      P 
Sbjct: 472 GKLHFEIINYDMSLKYFNRLKDLQPARVKDMEIFSTLLWHLHDKVKSSNLANGLMDTMPN 531

Query: 464 APEVPNFFAEILTDKNDFEKALKQYDLAIELENKLDGIYVGIAPLVGKATLLTRNPTVEN 523
            PE       +L+ + D + A+K ++ A +L+      Y     L G       + + ++
Sbjct: 532 KPETWCCVGNLLSLQKDHDAAIKAFEKATQLDPNFAYAYT----LQGH-----EHSSNDS 582

Query: 524 FIEATNLLEEASKLDPRSEQAKIGLAQMKLQQEDIDEAITLFEESADL 571
              A     +A   DP+   A  GL    ++    +EA+  FE++  +
Sbjct: 583 SDSAKTCYRKALACDPQHYNAYYGLGTSSMKLGQYEEALLYFEKARSI 630

 Score = 32.7 bits (73), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 49/110 (44%)

Query: 386 FDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYREN 445
           F+KA +LD N +  Y  +G  +    + D A   + KA   DP++   Y  L   + +  
Sbjct: 556 FEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYRKALACDPQHYNAYYGLGTSSMKLG 615

Query: 446 KFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFEKALKQYDLAIELE 495
           ++++    F +A+   P    +       L      EKAL+ Y+LA  L+
Sbjct: 616 QYEEALLYFEKARSINPVNVVLICCCGGSLEKLGYKEKALQYYELACHLQ 665

 Score = 32.7 bits (73), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 34/67 (50%), Gaps = 5/67 (7%)

Query: 375 DRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPY 434
           D +DS +    + KAL  D  + + YY  G  +  L  Y++A   F+KA+ ++P N+   
Sbjct: 581 DSSDSAK--TCYRKALACDPQHYNAYYGLGTSSMKLGQYEEALLYFEKARSINPVNV--- 635

Query: 435 IQLACLA 441
           + + C  
Sbjct: 636 VLICCCG 642

>Suva_2.34 Chr2 complement(63832..65304,65365..66183) [2292 bp, 763
           aa] {ON} YBL084C (REAL)
          Length = 763

 Score = 35.8 bits (81), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 35/168 (20%), Positives = 70/168 (41%), Gaps = 9/168 (5%)

Query: 404 GQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPE 463
           G+++F + NYD + K F++ K+L P  +      + L +  +       L +      P 
Sbjct: 484 GKLHFEIINYDMSLKYFNRLKDLQPARVKDMEIYSTLLWHLHDKVKSSNLANGLMDTMPN 543

Query: 464 APEVPNFFAEILTDKNDFEKALKQYDLAIELENKLDGIYVGIAPLVGKATLLTRNPTVEN 523
            PE       +L+ + D + A+K ++ A +L+      Y     L G       + + ++
Sbjct: 544 KPETWCCIGNLLSLQKDHDAAIKAFEKATQLDPNFAYAYT----LQGH-----EHSSNDS 594

Query: 524 FIEATNLLEEASKLDPRSEQAKIGLAQMKLQQEDIDEAITLFEESADL 571
              A     +A   DP+   A  GL    ++    +EA+  FE++  +
Sbjct: 595 SDSAKTCYRKALACDPQHYNAYYGLGTSSMKLGQYEEALLYFEKARSI 642

 Score = 32.7 bits (73), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 33/66 (50%), Gaps = 10/66 (15%)

Query: 386 FDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLAC------ 439
           + KAL  D  + + YY  G  +  L  Y++A   F+KA+ ++P N+   + + C      
Sbjct: 602 YRKALACDPQHYNAYYGLGTSSMKLGQYEEALLYFEKARSINPVNV---VLICCCGGSLE 658

Query: 440 -LAYRE 444
            L Y+E
Sbjct: 659 KLGYKE 664

 Score = 32.0 bits (71), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 27/110 (24%), Positives = 49/110 (44%)

Query: 386 FDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYREN 445
           F+KA +LD N +  Y  +G  +    + D A   + KA   DP++   Y  L   + +  
Sbjct: 568 FEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYRKALACDPQHYNAYYGLGTSSMKLG 627

Query: 446 KFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFEKALKQYDLAIELE 495
           ++++    F +A+   P    +       L      EK L+ Y+LA +L+
Sbjct: 628 QYEEALLYFEKARSINPVNVVLICCCGGSLEKLGYKEKVLQYYELACQLQ 677

>KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.328
           YCR060W
          Length = 121

 Score = 33.5 bits (75), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 23/37 (62%), Gaps = 1/37 (2%)

Query: 102 LKDKGNQFFRNKKYDDAIKYYNWALELK-DDPVFYSN 137
            K +GNQ+F+   Y  AIK Y   +E+  ++P+ YSN
Sbjct: 6   FKTEGNQYFKEGNYASAIKSYEKCIEINPENPIGYSN 42

>TBLA0B04990 Chr2 (1171599..1175831) [4233 bp, 1410 aa] {ON}
           Anc_7.546 YPR189W
          Length = 1410

 Score = 35.8 bits (81), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 32/131 (24%), Positives = 61/131 (46%), Gaps = 4/131 (3%)

Query: 106 GNQFFRNKKYDDAIKYYNWALELKDDPV-FYSNLSACYVSVGDLKKVVEMSTKALELKPD 164
           G  +   ++  D+I+++  A+ + D  V  +  L   Y S G ++  +++  K LEL P 
Sbjct: 682 GISYLEKQQAADSIEWFQSAIRVDDSDVESWVGLGQSYYSCGRIEASIKVFEKPLELSPH 741

Query: 165 YSKVLLRRASANEGLGNFADAMFDLSVLS-LNGDFNDASIEPMLERNLNKQAMSKLKEKF 223
           +   L  +A     +G F +++  L  ++ LN   N+ + +  L + L K A     + F
Sbjct: 742 HPHALYFKALGLSDVGQFVESIEILEYITDLNP--NNEAFKICLAKILVKYATDLFTQGF 799

Query: 224 GDIDTATATPT 234
                ATAT +
Sbjct: 800 LMKAIATATKS 810

>KLLA0E20857g Chr5 (1860517..1862649) [2133 bp, 710 aa] {ON} similar
           to uniprot|Q751K0 Ashbya gossypii AGL294W AGL294Wp and
           some similarites with YBL084C uniprot|P38042
           Saccharomyces cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 710

 Score = 35.4 bits (80), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 60/254 (23%), Positives = 95/254 (37%), Gaps = 20/254 (7%)

Query: 372 IMADRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENI 431
           ++    D T       + L LD  N   +   G ++ + +++D+A   F KA +LDP   
Sbjct: 467 VLWHLQDKTHLSALCAELLTLDKYNPIAWCSMGNLHSLNKDHDEAITAFGKAIQLDPFFA 526

Query: 432 FPYIQLACLAYREN-KFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFEKALKQYDL 490
           + Y  L    Y  N  FD+ ++ F +A                       FE+AL    L
Sbjct: 527 YAYT-LQGHEYSNNDAFDNAKSCFRKALTIEKTHYNALYGLGMCCVKLGKFEEAL----L 581

Query: 491 AIELENKLDGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEEASKLDPRSEQAKIGLAQ 550
             E    L+ + V +    G A    + P       A N  E A++L P S  A    +Q
Sbjct: 582 FFEKARALNPVNVILNCCCGVALERLQQPE-----RALNFYELATELQPNSSLALFKKSQ 636

Query: 551 MKLQQEDIDEAITLFE-------ESADLARTMEEKLQAITFAEAAKVQKRIRS--DPILA 601
           + L       A+  FE       + A +   +    Q +   + A  Q  I    DP  +
Sbjct: 637 LLLNMGQYSSALHNFERLESLTPDEAHVHFLLGNLYQIVGKKQDAMNQYTIAMNLDPKGS 696

Query: 602 AKIQETLAKLREQG 615
             I+E + K  EQG
Sbjct: 697 QLIKEAMEKCHEQG 710

>Suva_3.95 Chr3 (137419..137754) [336 bp, 111 aa] {ON} YCR060W
           (REAL)
          Length = 111

 Score = 33.5 bits (75), Expect = 0.44,   Method: Composition-based stats.
 Identities = 18/70 (25%), Positives = 36/70 (51%), Gaps = 1/70 (1%)

Query: 103 KDKGNQFFRNKKYDDAIKYYNWALELK-DDPVFYSNLSACYVSVGDLKKVVEMSTKALEL 161
           K++GN+ ++   Y DAI  Y+  +  +  +PV +SN +   + +G+  + +E   + L+L
Sbjct: 8   KEEGNELYKQGLYRDAIGCYDRLIAAQPQNPVGHSNKAMALIKLGEHAQAIEACQQGLQL 67

Query: 162 KPDYSKVLLR 171
                   LR
Sbjct: 68  AASPQHAALR 77

>Suva_8.129 Chr8 (231888..234113) [2226 bp, 741 aa] {ON} YOR080W
           (REAL)
          Length = 741

 Score = 35.4 bits (80), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 23/35 (65%)

Query: 137 NLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLR 171
           N+ ACY  + DLK  + +S K+L+L PD +K  +R
Sbjct: 83  NICACYEKLDDLKSCLSISQKSLKLDPDNAKCYIR 117

>KAFR0D02340 Chr4 complement(473431..475524) [2094 bp, 697 aa] {ON}
           Anc_5.689 YOR080W
          Length = 697

 Score = 35.4 bits (80), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 26/44 (59%)

Query: 137 NLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLG 180
           NL+AC+  + DLK+ +  S K ++L+P   K  +RR    + LG
Sbjct: 72  NLAACWEKLNDLKRALNYSDKMVQLEPYNLKCYIRRGKVLQKLG 115

>TDEL0D05500 Chr4 complement(991567..993105) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 34.7 bits (78), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 33/63 (52%)

Query: 372 IMADRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENI 431
           I   + D T+  + + KA+ LDS  S  + +R   +  L N+  +  D D+A +LDP+N 
Sbjct: 21  IFIKKQDFTKAIDLYTKAIGLDSTQSIYFSNRALAHLKLDNFQSSLNDCDEALKLDPKNA 80

Query: 432 FPY 434
             Y
Sbjct: 81  KAY 83

>Skud_2.24 Chr2 complement(50790..53099) [2310 bp, 769 aa] {ON}
           YBL084C (REAL)
          Length = 769

 Score = 34.7 bits (78), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 12/77 (15%)

Query: 375 DRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPY 434
           D +DS +    + KAL  DS + + YY  G  +  L  Y++A   F+KA+ ++P N+   
Sbjct: 599 DSSDSAK--TCYRKALACDSQHYNAYYGLGTSSMKLGQYEEALLYFEKARSINPVNV--- 653

Query: 435 IQLAC-------LAYRE 444
           + + C       L Y+E
Sbjct: 654 VLICCCGGSLEKLGYKE 670

 Score = 32.0 bits (71), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 21/92 (22%), Positives = 43/92 (46%)

Query: 404 GQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPE 463
           G+++F + NYD + K F++ K+L P  +      + L +  +       L +      P 
Sbjct: 490 GKLHFEIINYDMSLKYFNRLKDLQPARVKDMEIFSTLLWHLHDKVKSSNLANGLMDIMPN 549

Query: 464 APEVPNFFAEILTDKNDFEKALKQYDLAIELE 495
            PE       +L+ + D + A+K ++ A +L+
Sbjct: 550 KPETWCCIGNLLSLQKDHDAAIKAFEKATQLD 581

>NDAI0C04320 Chr3 complement(983914..986034) [2121 bp, 706 aa] {ON}
           Anc_5.352 YDR320C
          Length = 706

 Score = 34.7 bits (78), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 41/175 (23%), Positives = 70/175 (40%), Gaps = 44/175 (25%)

Query: 100 LALKDKGNQFFRNKKYDDAIKYYNWALEL--KDDP---VFYSNLSACYVSVGDLKKVVEM 154
           +  K +G++ F+N  Y  A++ Y  +L    +  P   + YSN+ A  + +G+  K +E 
Sbjct: 415 IEFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIED 474

Query: 155 STKALELKPD-----------------------YSKVLLRRASANEGLGNFADAMFDLSV 191
              AL L P                        +SK+++R+A + E L N+  A+     
Sbjct: 475 CKIALSLFPKGKVTSAWNQIIPDSTPQRSFKDIWSKLIMRQAESYEHLENYKLALDSYQK 534

Query: 192 LSLNGDFNDASI---------------EPMLERNLNKQAMSKLKEKFGDIDTATA 231
           L  NG F ++ I                P   ++     +S LK K  D  TA+ 
Sbjct: 535 LIENG-FTNSKIMDGKRRCQKILNPPPPPQTSKSPTPTPVSILKHKEKDTTTASV 588

>KAFR0B00250 Chr2 complement(58608..62870) [4263 bp, 1420 aa] {ON}
           Anc_7.546 YPR189W
          Length = 1420

 Score = 34.7 bits (78), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 30/117 (25%), Positives = 49/117 (41%), Gaps = 5/117 (4%)

Query: 366 YIYMALIMADRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKE 425
           Y  M +   +  + T+   +F  AL++D N+   +   GQ  F     + + K F+KA E
Sbjct: 687 YRVMGISFLEDQNETDSIEWFQSALRVDPNDIESWVGLGQAYFACGRVEASIKVFEKAVE 746

Query: 426 LDPE-NIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDF 481
           L P+ N   Y     LA    + D+ E      +    + PE   F  E+ T   D+
Sbjct: 747 LSPDHNYAKYFNSVALA----QMDEFERAIDILRHVLKDEPEKEVFKMELATQIVDY 799

>SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {ON}
           similar to uniprot|P25638 Saccharomyces cerevisiae
           YCR060W TAH1 HSP90
          Length = 128

 Score = 32.7 bits (73), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 32/62 (51%), Gaps = 1/62 (1%)

Query: 101 ALKDKGNQFFRNKKYDDAIKYYNWALEL-KDDPVFYSNLSACYVSVGDLKKVVEMSTKAL 159
            LK KGN FF+   Y+ A+ YY  A+     +P+ YSN +   + +    + V+   K L
Sbjct: 6   TLKAKGNVFFKKCDYETAVLYYQKAITADPSNPIGYSNNAMGLIKLEKWSEAVDACNKGL 65

Query: 160 EL 161
           ++
Sbjct: 66  KM 67

>Smik_12.132 Chr12 (258696..260786) [2091 bp, 696 aa] {ON} YLR072W
           (REAL)
          Length = 696

 Score = 34.7 bits (78), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 46/93 (49%), Gaps = 5/93 (5%)

Query: 192 LSLNGDFNDAS-IEPMLERNLNKQAMSKLKEKFGDIDTATATPTELSTQAPKELKDKTEN 250
           +S   D+N +S I+PM+E N     +S  K+    ++       ELS    KE  D  + 
Sbjct: 536 ISFWVDWNASSWIKPMVESNCKNGQISATKDLVKLVEEFVEKYVELS----KEKADALKT 591

Query: 251 LPSITSMASFFGIFKPELTFANYDESNEADKDL 283
           LPS+TS  S   +  P+LT A  +   EA+ ++
Sbjct: 592 LPSVTSFGSPRKVAVPQLTSAQPESKPEAEIEI 624

>ZYRO0B03828g Chr2 (318153..320336) [2184 bp, 727 aa] {ON} similar
           to uniprot|P38042 Saccharomyces cerevisiae YBL084C CDC27
           Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C) which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors including mitotic
           cyclins during the metaphase/anaphase transition
          Length = 727

 Score = 34.7 bits (78), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 54/120 (45%)

Query: 376 RNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYI 435
           + D  E   YF+KA ++D + +  Y  +G  +    + D A   + KA   DP++   Y 
Sbjct: 522 QRDHDEAIRYFEKATEVDPHFAYGYTLQGHEHSSNDSIDMAKTCYRKAIASDPQHYNAYY 581

Query: 436 QLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFEKALKQYDLAIELE 495
            L     +  ++++    F +A+   P    +       L   +  EKAL+ Y+LA EL+
Sbjct: 582 GLGMCCMKLGQYEEALLYFEKARSINPVNVILICCCGVALEKMSYQEKALQYYELASELQ 641

>Ecym_7142 Chr7 complement(287110..289137) [2028 bp, 675 aa] {ON}
           similar to Ashbya gossypii AGL294W
          Length = 675

 Score = 34.3 bits (77), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 33/69 (47%), Gaps = 8/69 (11%)

Query: 386 FDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLAC------ 439
           + KAL ++ N+ + +Y  G     L  YD+A   F+KA+ ++P N+   +   C      
Sbjct: 514 YRKALAINPNHYNAHYGLGMSCIKLGQYDEALLHFEKARSINPVNVI--LNCCCGVALER 571

Query: 440 LAYRENKFD 448
           L  RE   D
Sbjct: 572 LGRREKALD 580

>NDAI0G03710 Chr7 complement(894337..897702) [3366 bp, 1121 aa] {ON}
           Anc_3.5 YOL145C
          Length = 1121

 Score = 34.7 bits (78), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 42/98 (42%), Gaps = 18/98 (18%)

Query: 109 FFRNKKYDDAIKYYNWALE----LKDDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPD 164
            FR K +  ++K +   L     LK DP     + AC+  + D K  +    ++LEL P 
Sbjct: 207 LFRKKNFMASLKLFQELLVNNPVLKPDPRI--GIGACFWQLKDYKMAINAWERSLELDPT 264

Query: 165 ------------YSKVLLRRASANEGLGNFADAMFDLS 190
                       + K L+   + +E   NF DAM DLS
Sbjct: 265 NKNSKVLCLLGKFHKTLIDSGNDDEFKDNFKDAMIDLS 302

>AGL294W Chr7 (154711..156681) [1971 bp, 656 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBL084C (CDC27)
          Length = 656

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 33/69 (47%), Gaps = 8/69 (11%)

Query: 386 FDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLAC------ 439
           + KAL ++ N+ + +Y  G     L  YD+A   F+KA+ ++P N+   +   C      
Sbjct: 495 YRKALAINPNHYNAHYGLGMSCIKLGQYDEALLHFEKARSINPVNVI--LNCCCGVALER 552

Query: 440 LAYRENKFD 448
           L  RE   D
Sbjct: 553 LGRREKALD 561

>ZYRO0G07700g Chr7 complement(609766..611880) [2115 bp, 704 aa] {ON}
           similar to uniprot|P32190 Saccharomyces cerevisiae
           YHL032C GUT1 Glycerol kinase converts glycerol to
           glycerol- 3-phosphate glucose repression of expression
           is mediated by Adr1p and Ino2p-Ino4p derepression of
           expression on non- fermentable carbon sources is
           mediated by Opi1p and Rsf1p
          Length = 704

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 30/46 (65%), Gaps = 5/46 (10%)

Query: 246 DKTE-NLPSITSMASFFGIFK-PELTFANYDESNEADKDLMNGLTN 289
           DKT+ NLP ITS A +FG FK PE+T +  D S   D D++  L+N
Sbjct: 287 DKTKINLPRITSSAEYFGDFKVPEVTKSWMDPS---DWDILEKLSN 329

>Kpol_1050.112 s1050 (249717..252797,252855..252863,252906..253898)
           [4083 bp, 1360 aa] {ON}
           (249717..252797,252855..252863,252906..253898) [4083 nt,
           1361 aa]
          Length = 1360

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 15/58 (25%), Positives = 31/58 (53%)

Query: 375 DRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIF 432
           +R   ++   +F  AL+++ NN   +   GQ        + + + F+KA ELDP++++
Sbjct: 680 ERQQESDAIEWFQSALRIEPNNVESWVGLGQSYLSCGRIEASIRVFEKATELDPDHLY 737

 Score = 32.3 bits (72), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 23/98 (23%), Positives = 42/98 (42%), Gaps = 16/98 (16%)

Query: 84  FSNKANFTAEEKDRYALALKDKGNQFFRNKKY---------------DDAIKYYNWALEL 128
           + N  N++A E     L   D   ++ R   +                DAI+++  AL +
Sbjct: 638 YCNSGNWSAAESISKILVKTDGAKKYLRYTCWPFRVIGIANLERQQESDAIEWFQSALRI 697

Query: 129 KDDPV-FYSNLSACYVSVGDLKKVVEMSTKALELKPDY 165
           + + V  +  L   Y+S G ++  + +  KA EL PD+
Sbjct: 698 EPNNVESWVGLGQSYLSCGRIEASIRVFEKATELDPDH 735

>NCAS0E02490 Chr5 complement(493779..496208) [2430 bp, 809 aa] {ON}
           Anc_7.412 YBL084C
          Length = 809

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 33/147 (22%), Positives = 56/147 (38%), Gaps = 34/147 (23%)

Query: 385 YFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENI------------- 431
           ++ KA+  D ++ + YY  G  +  L  Y+QA   F+KA+ ++P N              
Sbjct: 646 FYRKAISNDLHHYNAYYGMGMCSMKLGEYEQALVYFEKARSINPSNAILICCCGVTMEKL 705

Query: 432 ------FPYIQLAC---------------LAYRENKFDDCETLFSEAKRKFPEAPEVPNF 470
                   Y +LAC               L Y   K+      F E  +  PE   V   
Sbjct: 706 GNQEKALNYYELACQIQPTSSLAKFKRAHLLYSMAKYTQALDAFEELIKIAPEEATVQFI 765

Query: 471 FAEILTDKNDFEKALKQYDLAIELENK 497
             ++       + A+K+Y +A+ L+ K
Sbjct: 766 LGQLYQIMGRKKDAIKRYTIAMNLDPK 792

>AAR054C Chr1 complement(440706..441107) [402 bp, 133 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCR060W
          Length = 133

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 32/61 (52%), Gaps = 1/61 (1%)

Query: 102 LKDKGNQFFRNKKYDDAIKYY-NWALELKDDPVFYSNLSACYVSVGDLKKVVEMSTKALE 160
           L+ KGN  +   +Y+ A+ YY N +L    +PV  +N+S   + +   +  +    +ALE
Sbjct: 11  LRSKGNDLYSKGEYETAVLYYKNASLAEPSNPVHLANMSMALLKLERWEDALSACDRALE 70

Query: 161 L 161
           +
Sbjct: 71  I 71

>Skud_15.245 Chr15 (431002..433254) [2253 bp, 750 aa] {ON} YOR080W
           (REAL)
          Length = 750

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 23/35 (65%)

Query: 137 NLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLR 171
           N+ ACY  + DLK  +++S ++L+L PD  K  +R
Sbjct: 92  NICACYEKLDDLKSCLKISRRSLKLDPDNVKCYIR 126

>TBLA0H01970 Chr8 (464239..466761) [2523 bp, 840 aa] {ON} Anc_5.352
           YDR320C
          Length = 840

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 32/121 (26%), Positives = 50/121 (41%), Gaps = 26/121 (21%)

Query: 106 GNQFFRNKKYDDAIKYYNWALEL--KDDP---VFYSNLSACYVSVGDLKKVVEMSTKALE 160
           G +FF+   YD A+  Y  +L    +  P   + YSN+ A  + VG+  + V+    ALE
Sbjct: 553 GTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDCDVALE 612

Query: 161 LKPD---------------------YSKVLLRRASANEGLGNFADAMFDLSVLSLNGDFN 199
           L P                      + K++LR+A A E +  +  A     +L     FN
Sbjct: 613 LFPKNDKQWTQFIQDSDPQKTYKEIWPKIVLRKAEACEHMEKYQIAYDSYQLLLHKNVFN 672

Query: 200 D 200
           D
Sbjct: 673 D 673

>KLLA0C15455g Chr3 (1341570..1343270) [1701 bp, 566 aa] {ON} similar
           to uniprot|P35056 Saccharomyces cerevisiae YDR244W PEX5
           Essential for import of proteins with SKL- like import
           signal into peroxisomal matrix 69-kDa protein containing
           tetratricopeptide repeat (TPR)
          Length = 566

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 23/92 (25%), Positives = 47/92 (51%), Gaps = 2/92 (2%)

Query: 106 GNQFFRNKKYDDAIKYYNWALELK-DDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPD 164
           G  F+ N+++   I  +  ALE+  +D + ++ L A   +    ++ ++   KAL LKP 
Sbjct: 423 GTLFYANEEFGKTIDCFRTALEVNPNDELMWNRLGASLANSNRSEEAIQAYHKALALKPS 482

Query: 165 YSKVLLRRASANEGLGNFADAMFD-LSVLSLN 195
           + +     A ++  +G + +A    LS LS++
Sbjct: 483 FVRARYNLAISSMNIGCYKEAAESLLSALSMH 514

>NDAI0C05290 Chr3 (1224979..1226118) [1140 bp, 379 aa] {ON}
           Anc_8.506 YBR155W
          Length = 379

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 19/90 (21%), Positives = 42/90 (46%), Gaps = 6/90 (6%)

Query: 102 LKDKGNQFFRNKKYDDAIKYYNWALELKDDP------VFYSNLSACYVSVGDLKKVVEMS 155
            K++GN  ++ K++ DA   Y   ++++++         ++N +AC + + + ++ +   
Sbjct: 79  FKNQGNDLYKAKRFKDARDVYLKGIQIENNKDVKIKESLFANKAACELELKNFRRCINDC 138

Query: 156 TKALELKPDYSKVLLRRASANEGLGNFADA 185
             AL+L P   K   R   A   L    +A
Sbjct: 139 KNALQLNPKNVKCYFRMTRAFFALDKLEEA 168

>Kpol_1031.64 s1031 (161135..162958) [1824 bp, 607 aa] {ON}
           (161135..162958) [1824 nt, 608 aa]
          Length = 607

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 21/89 (23%), Positives = 47/89 (52%), Gaps = 2/89 (2%)

Query: 109 FFRNKKYDDAIKYYNWALELK-DDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSK 167
           F+ N ++D  I  +  AL++  +D + ++ L A   +    ++ ++   KAL LKP + +
Sbjct: 460 FYSNNEFDKTIDCFKAALKVSPNDELLWNRLGASLANSNRSEEAIQAYHKALNLKPSFVR 519

Query: 168 VLLRRASANEGLGNFAD-AMFDLSVLSLN 195
                A ++  +G + + A + L+ LS++
Sbjct: 520 ARYNLAVSSINIGCYKEAAQYLLTALSMH 548

>CAGL0B01375g Chr2 complement(123330..126662) [3333 bp, 1110 aa]
           {ON} similar to uniprot|P89105 Saccharomyces cerevisiae
           YOL145c CTR9 required for G1 cyclin expression
          Length = 1110

 Score = 33.5 bits (75), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 40/182 (21%), Positives = 79/182 (43%), Gaps = 29/182 (15%)

Query: 404 GQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCE------------ 451
           G   + L++Y  A + +++A +LDP N    I L  L    N   + E            
Sbjct: 224 GMCFWQLKDYKLAIQAWERALQLDPNNKQASI-LVLLGKFHNSLTEAENDEDFKEKYAAA 282

Query: 452 -----TLFSEAKRKFPEAPEVPNFFAEILTDKNDFEKALKQYDLAIELENKL--DGIYVG 504
                T+++ +K    E+P +          K D+EK +  +D  I   + L  + +Y  
Sbjct: 283 LADLNTVYTNSK----ESPVLLVLLQTFFFFKGDYEKVITIHDQKISKLSFLAPESVYSE 338

Query: 505 IAPLVGKATLLTRNPTVENFIEATNLLEEASKLDPRSEQAKIGLAQMKLQQEDIDEAITL 564
                G+A+       + ++ +A  + +E+ K D  +  A++GL Q +++   ++E+I  
Sbjct: 339 SLFWCGRASY-----AMGDYRKAFTMFQESLKRDENNLLARLGLGQTQIKNSLVEESILT 393

Query: 565 FE 566
           FE
Sbjct: 394 FE 395

>ACR168W Chr3 (650615..652738) [2124 bp, 707 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL022C (CDC16)
          Length = 707

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 34/144 (23%), Positives = 53/144 (36%), Gaps = 1/144 (0%)

Query: 354 KKAIELFPRVN-SYIYMALIMADRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQN 412
            K  E FP+ + ++  +       N+ TE   YF KA  LD N    +        +   
Sbjct: 412 HKLAESFPKSSVTWFAVGTYYFSINNITEARKYFSKASVLDPNFGYAWLGFAHTYAVEGE 471

Query: 413 YDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFA 472
           ++QA   +  A    P    P++ L     R +     E  F  A    P  P + N   
Sbjct: 472 HEQALSAYSTAARFFPGTHLPHLYLGMQYSRMDTLTLAEEYFMMAYDICPTDPLLLNELG 531

Query: 473 EILTDKNDFEKALKQYDLAIELEN 496
            +   K D+ +A K +  A E  N
Sbjct: 532 VVYFKKMDYPRAKKFFKRACEAIN 555

>AFR453W Chr6 (1251460..1253169) [1710 bp, 569 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR244W (PEX5)
          Length = 569

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 21/92 (22%), Positives = 47/92 (51%), Gaps = 2/92 (2%)

Query: 106 GNQFFRNKKYDDAIKYYNWALELK-DDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPD 164
           G  F+ N+ +D  I  +  AL ++ DD   ++ L A   +    ++ ++   +A++LKP 
Sbjct: 424 GILFYANEDFDKTIDCFRAALAVRPDDECMWNRLGASLANSNRSEEAIQAYHRAIQLKPT 483

Query: 165 YSKVLLRRASANEGLGNFADAM-FDLSVLSLN 195
           + +     A ++  +G + +A    L+ LS++
Sbjct: 484 FVRARYNLAVSSMNIGCYREAAEHLLTALSMH 515

>Ecym_5637 Chr5 (1288532..1290685) [2154 bp, 717 aa] {ON} similar to
           Ashbya gossypii ACR168W
          Length = 717

 Score = 32.7 bits (73), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 35/76 (46%), Gaps = 1/76 (1%)

Query: 396 NSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFS 455
           +S  ++  G   F + N  +A K F KA  LDP   + ++  A     E + +   + +S
Sbjct: 431 SSVTWFAVGTYYFSINNIPEARKYFSKASVLDPNFGYAWLGFAHTYAVEGEHEQALSAYS 490

Query: 456 EAKRKFPEAPEVPNFF 471
            A R FP    +P+ +
Sbjct: 491 TAARFFP-GTHLPHLY 505

>Suva_2.489 Chr2 complement(863483..865462) [1980 bp, 659 aa] {ON}
           YDR320C (REAL)
          Length = 659

 Score = 32.7 bits (73), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 50/112 (44%), Gaps = 28/112 (25%)

Query: 102 LKDKGNQFFRNKKYDDAIKYYNWALE---LKDDP---VFYSNLSACYVSVGDLKKVVEMS 155
            K KG   F+N  Y ++++ Y  +L    LK  P   +  SN+ A  + +G+  K +E S
Sbjct: 373 FKAKGTSLFKNGDYVNSLQEYEKSLNSLPLKH-PLRIIALSNIIASQLKIGEYSKSIENS 431

Query: 156 TKALELKPD---------------------YSKVLLRRASANEGLGNFADAM 186
             AL L P                      + K+++RRA + E L +F +A+
Sbjct: 432 DTALALFPANKSSWNDKISKSDPQRSYNDIWPKIMIRRAESFEHLESFKNAL 483

>Ecym_2820 Chr2 (1590180..1594376) [4197 bp, 1398 aa] {ON} similar
           to Ashbya gossypii AEL281C
          Length = 1398

 Score = 32.7 bits (73), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 43/205 (20%), Positives = 87/205 (42%), Gaps = 24/205 (11%)

Query: 366 YIYMALIMADRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKE 425
           Y  + +   ++    E   +F  A++LDS ++  +   GQ   +      +   ++KA E
Sbjct: 671 YRVLGIFYLEKQQEAEAIQWFQSAVRLDSLDTEAWIGLGQAYSVCGRIAASVNVYEKALE 730

Query: 426 LDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPE----APEVPNFFAEILTDKND- 480
           L+P++ F    LA    +  +F+    L S    ++P       ++  F  +  TD ++ 
Sbjct: 731 LNPKHKFARYLLAASLCQMGEFEKGIELLSVLNEEYPLEEIFLVQLSGFLVDYSTDLHNQ 790

Query: 481 ------FEKALKQYDL----AIELENKLDGIYVGIAPLVGKATLLTRNP-------TVEN 523
                    ALK   L      +L  K+  ++V ++ ++    +LT++        ++ N
Sbjct: 791 GYLIKSIGTALKAVRLIEVVVTKLNKKVSSVFVTLSKVLS-LFMLTQSQFEKFPLESLLN 849

Query: 524 FIEATNLLEEASKLDPRSEQAKIGL 548
            +EA   L+  SK+D   E +  GL
Sbjct: 850 ILEACE-LKNTSKIDAIDETSLDGL 873

>TPHA0G00240 Chr7 complement(37417..41709) [4293 bp, 1430 aa] {ON}
           Anc_7.546 YPR189W
          Length = 1430

 Score = 32.7 bits (73), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 28/131 (21%), Positives = 62/131 (47%), Gaps = 20/131 (15%)

Query: 84  FSNKANFTAEEKDRYALALKDKGNQFFRNKKY---------------DDAIKYYNWALEL 128
           ++N  N++A      AL   D   ++ ++  +                ++I+++  AL +
Sbjct: 668 YTNAENWSAAHAIAEALVQSDGAKKYLKSLSWPYRVVGISHLERQQEAESIEWFQSALRI 727

Query: 129 -KDDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPD--YSKVLLRRASANEGLGNFADA 185
            K+D   +  L   YV  G ++  +++  KA+EL  +  Y+K+ L  + +N  +G + D+
Sbjct: 728 DKEDIESWVGLGQAYVGCGRIEASIKVFEKAIELDSNHLYAKLFLAESLSN--IGEYEDS 785

Query: 186 MFDLSVLSLNG 196
           +  L  L+L+ 
Sbjct: 786 ILLLKELTLSS 796

>Ecym_5130 Chr5 (275836..278505) [2670 bp, 889 aa] {ON} similar to
           Ashbya gossypii ABL100W
          Length = 889

 Score = 32.7 bits (73), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 38/76 (50%), Gaps = 3/76 (3%)

Query: 96  DRYALALKDKGNQFFRNKKYDDAIKYYNWALELKDDPVFYSNLSACYVSVGDLKKVVEMS 155
           D + L L + G  FF   KYD A++++  A+E  D P    +    Y+++  L K  +  
Sbjct: 788 DNHGLVLAEIGRSFFCESKYDKALRWFQRAVE--DQPKIGDSWVWYYLTLKMLGKNTDFI 845

Query: 156 TKAL-ELKPDYSKVLL 170
             +L E +P Y ++ +
Sbjct: 846 FTSLEEHEPKYGELWI 861

>KLTH0C06204g Chr3 complement(538533..540416) [1884 bp, 627 aa] {ON}
           some similarities with uniprot|P38042 Saccharomyces
           cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 627

 Score = 32.3 bits (72), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 37/168 (22%), Positives = 65/168 (38%), Gaps = 9/168 (5%)

Query: 404 GQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPE 463
           G+++F L NY+ + K F   +EL P  I      + L +  N       L  E       
Sbjct: 348 GKLHFELVNYEMSKKYFAALRELQPFRIPDMEIFSTLLWHLNDTTGLSHLCHELLEVNRL 407

Query: 464 APEVPNFFAEILTDKNDFEKALKQYDLAIELENKLDGIYVGIAPLVGKATLLTRNPTVEN 523
           APE       + + K D E+++K +  + +L+      Y     L G         + + 
Sbjct: 408 APETWCCIGNLFSLKKDHEESIKAFQRSTQLDPSFTYAYT----LQGH-----EYSSNDA 458

Query: 524 FIEATNLLEEASKLDPRSEQAKIGLAQMKLQQEDIDEAITLFEESADL 571
           F  A     +A   +P+   A  GL    L+    +E +  FE++  +
Sbjct: 459 FDTAMTCYRKALGSNPQHYNAHYGLGMCCLKLGQYEECLLHFEKARSI 506

 Score = 32.0 bits (71), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 53/122 (43%), Gaps = 11/122 (9%)

Query: 386 FDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYREN 445
           + KAL  +  + + +Y  G     L  Y++    F+KA+ ++P N+   I + C      
Sbjct: 466 YRKALGSNPQHYNAHYGLGMCCLKLGQYEECLLHFEKARSINPVNV---ILICCCGVALE 522

Query: 446 KFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFEKALKQYDLAIELENKLDGIYVGI 505
           K    E    +A + +  A E+    +  L  +     A+ +Y+ A+E   KL    V I
Sbjct: 523 KLSHQE----KALQYYDLACELQPVSSLALFKRAQLLLAMGKYNFALENFEKL----VTI 574

Query: 506 AP 507
           AP
Sbjct: 575 AP 576

>Kpol_339.13 s339 complement(21257..23317) [2061 bp, 686 aa] {ON}
           complement(21257..23317) [2061 nt, 687 aa]
          Length = 686

 Score = 32.3 bits (72), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 27/113 (23%), Positives = 50/113 (44%), Gaps = 30/113 (26%)

Query: 102 LKDKGNQFFRNKKYDDAIKYYNWALELKDDPVFY-------SNLSACYVSVGDLKKVVEM 154
            K++G + F+   Y  A++ Y  +L     P+ +       SN+ A     G+ +K +E+
Sbjct: 397 FKERGTENFKTGDYVTALEAYQKSLNTL--PIKHPLRIIASSNILASMSKTGEYRKSIEI 454

Query: 155 STKALELKPD---------------------YSKVLLRRASANEGLGNFADAM 186
           ST ALE  P                      + K++L+RA A E + ++ +A+
Sbjct: 455 STSALEQFPGDQKQWNEFIQDSEPQRTYKDIWPKIVLKRAEAFEHIESYENAL 507

>TBLA0A09170 Chr1 complement(2276263..2278443) [2181 bp, 726 aa]
           {ON} Anc_5.689 YOR080W
          Length = 726

 Score = 32.3 bits (72), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 42/99 (42%), Gaps = 31/99 (31%)

Query: 106 GNQFFRNKKYDDAIKYYNWALEL------------------------KDDPVFYS----- 136
           G  FF+N+ Y DA K +  A++L                         D  +++      
Sbjct: 19  GTNFFKNENYQDARKLFEKAVKLVRSYEQPRIIQLRIAANLPITPLNSDGKLYHPRYIKL 78

Query: 137 --NLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRA 173
             NL+AC+  VG++ K + +S K +E +P   K  +R A
Sbjct: 79  LDNLAACWEKVGEVSKAIRVSKKMIESEPYNMKGYIRSA 117

>Skud_2.240 Chr2 complement(431507..434461) [2955 bp, 984 aa] {ON}
           YBR112C (REAL)
          Length = 984

 Score = 32.3 bits (72), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 22/97 (22%), Positives = 41/97 (42%), Gaps = 6/97 (6%)

Query: 131 DPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDLS 190
           +P+F+ ++   Y  +   +  ++  T+A+ L P  S+V     +  E   N      D  
Sbjct: 323 NPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLSDALDAY 382

Query: 191 VLSLNGDFNDASIEPMLERNLNKQAMSKLKEKFGDID 227
             +   D N+  I   LE      A++K  E  G+I+
Sbjct: 383 KQAARLDVNNVHIRERLE------ALTKQLENPGNIN 413

>CAGL0K09240g Chr11 complement(914042..914470) [429 bp, 142 aa] {ON}
           weakly similar to uniprot|P25638 Saccharomyces
           cerevisiae YCR060w
          Length = 142

 Score = 30.8 bits (68), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 26/43 (60%), Gaps = 1/43 (2%)

Query: 102 LKDKGNQFFRNKKYDDAIKYYNWALELK-DDPVFYSNLSACYV 143
            KD GN+ F+  +YD AI+ Y   + L+  + V YSNL+  Y+
Sbjct: 38  FKDIGNEHFKKGEYDLAIEQYRKCISLEPTNAVGYSNLAMAYL 80

>TPHA0L01420 Chr12 (293980..295104) [1125 bp, 374 aa] {ON} Anc_8.506
           YBR155W
          Length = 374

 Score = 32.0 bits (71), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 39/174 (22%), Positives = 76/174 (43%), Gaps = 15/174 (8%)

Query: 55  SQKKTKDGSESTAESNTPVYPVSSNGDPDFSNKANFT-------AEEKDRYALA--LKDK 105
           S+ K K   E   E N   + ++   D D +  +N T       A E + + +A   K +
Sbjct: 21  SEFKDKTTDEVLEELNRMPFFMTKLDDSDGNGGSNVTLDALKALAYEGEPHEIAENFKKQ 80

Query: 106 GNQFFRNKKYDDAIKYYNWALEL-----KDDPVFYSNLSACYVSVGDLKKVVEMSTKALE 160
           GN+ ++ K+Y +A   Y   +E+     K + + + N +AC + + + +  +    KAL 
Sbjct: 81  GNEAYKLKQYRNARVLYERGIEVNCNNDKINELLFVNKAACELEMKNYRSCINDCKKALS 140

Query: 161 LKPDYSKVLLRRASANEGLGNFADAMFDLSVLSLNGDFNDASIEPMLERNLNKQ 214
             P   K   R A A   +  + ++   +    L  D  ++S+  +L+  + KQ
Sbjct: 141 FNPLNVKCYFRMAKAFSAIEKYDESRESIE-FGLKVDSRNSSLLNLLKTIIKKQ 193

>CAGL0G10087g Chr7 (962823..967058) [4236 bp, 1411 aa] {ON} similar to
            uniprot|P17883 Saccharomyces cerevisiae YPR189w SKI3
            antiviral protein
          Length = 1411

 Score = 32.0 bits (71), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 23/95 (24%), Positives = 45/95 (47%), Gaps = 1/95 (1%)

Query: 363  VNSYIYMALIMADRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDK 422
            V S+  +A+   D N     +  F KA+ L   + ++ +    ++    + D A +  +K
Sbjct: 963  VESWFGLAVSTMDFNYRVSQHC-FIKAMSLSPRDPTIIFAYAMLSLRCNDIDLATQLINK 1021

Query: 423  AKELDPENIFPYIQLACLAYRENKFDDCETLFSEA 457
            A+ + P    P++ LA L  ++N   +  +LFS A
Sbjct: 1022 AQTISPAESSPWLGLALLNEKKNGSSNSVSLFSHA 1056

>Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {ON}
           complement(123535..123888) [354 nt, 118 aa]
          Length = 117

 Score = 30.4 bits (67), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 16/63 (25%), Positives = 33/63 (52%), Gaps = 1/63 (1%)

Query: 103 KDKGNQFFRNKKYDDAIKYYNWALELK-DDPVFYSNLSACYVSVGDLKKVVEMSTKALEL 161
           K  GN +F++  Y  A++YY   +E++ ++P+ YSN +   + +    + +E     L+ 
Sbjct: 7   KTTGNTYFKDGNYLKAVEYYKKCIEVEPENPIGYSNSAMSLIKLTKYTEALESCGTGLKY 66

Query: 162 KPD 164
             D
Sbjct: 67  VND 69

>TPHA0L01210 Chr12 (252106..253872) [1767 bp, 588 aa] {ON} Anc_8.470
           YDR244W
          Length = 588

 Score = 32.0 bits (71), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 18/78 (23%), Positives = 40/78 (51%), Gaps = 1/78 (1%)

Query: 109 FFRNKKYDDAIKYYNWALELK-DDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSK 167
           F+ N ++D  I  +  AL +  +D + ++ L A   +    ++ ++   KAL+LKP + +
Sbjct: 441 FYSNNEFDKTIDCFKTALVIHPEDELMWNRLGASLANSSRPEEAIQAYHKALQLKPSFVR 500

Query: 168 VLLRRASANEGLGNFADA 185
                A ++  +G + +A
Sbjct: 501 ARYNLAVSSINIGCYKEA 518

>TDEL0D05570 Chr4 complement(1005376..1007325) [1950 bp, 649 aa]
           {ON} Anc_3.489 YGR128C
          Length = 649

 Score = 31.6 bits (70), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 28/126 (22%), Positives = 55/126 (43%), Gaps = 21/126 (16%)

Query: 511 KATLLTRNPTVENFIEATNLLEEASKLDPRSEQAKIGLAQMKLQQEDIDEAITL------ 564
           K  +L R  ++ NF   TN L+ A  ++P S +  IG+++  + Q  ++    L      
Sbjct: 9   KLAVLPRVASLSNFAFQTNFLQVADDIEPTSNRITIGISESAISQYVLNPTPKLVLSIPI 68

Query: 565 ----FEESADLARTMEEKL--------QAITFAEAAKV---QKRIRSDPILAAKIQETLA 609
                  + D+AR+ E+++        +  T   A+KV   +  + SD +L  K+ +   
Sbjct: 69  PSTNIVTACDVARSDEQEIWCYALQAGKVCTLNVASKVSHAENGVNSDDVLKVKVDDQAV 128

Query: 610 KLREQG 615
            +   G
Sbjct: 129 GVHVNG 134

>TDEL0B01660 Chr2 complement(295823..297472) [1650 bp, 549 aa] {ON}
           Anc_8.470 YDR244W
          Length = 549

 Score = 31.6 bits (70), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 23/104 (22%), Positives = 49/104 (47%), Gaps = 10/104 (9%)

Query: 109 FFRNKKYDDAIKYYNWALELK-DDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSK 167
           F+ + ++D  I  +  AL +  +D + ++ L A   +    ++ ++   KAL+LKP + +
Sbjct: 406 FYADSEFDKTIDCFKAALSVNPNDELMWNRLGASLANSNRSEEAIQAYYKALQLKPSFVR 465

Query: 168 VLLRRASANEGLGNFADA---------MFDLSVLSLNGDFNDAS 202
                A ++  +G + +A         M ++  +S NG  N  S
Sbjct: 466 ARYNLAVSSINIGCYKEAAEYLLSALKMHEVEGVSQNGTANPVS 509

>YOR080W Chr15 (474594..476792) [2199 bp, 732 aa] {ON}
           DIA2Origin-binding F-box protein; forms an SCF ubiquitin
           ligase complex with Skp1p and Cdc53p; plays a role in
           DNA replication; plays a role in transcription; required
           for correct assembly of RSC complex, correct
           RSC-mediated transcription regulation, and correct
           nucleosome positioning; involved in invasive and
           pseudohyphal growth
          Length = 732

 Score = 31.6 bits (70), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 22/35 (62%)

Query: 137 NLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLR 171
           N+ ACY  + DLK  +++S + L+L+P   K  +R
Sbjct: 83  NICACYEKLNDLKSCLDVSQRLLKLEPGNIKCYIR 117

>KNAG0K02630 Chr11 (523259..526489) [3231 bp, 1076 aa] {ON} Anc_3.5
           YOL145C
          Length = 1076

 Score = 32.0 bits (71), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 43/179 (24%), Positives = 74/179 (41%), Gaps = 23/179 (12%)

Query: 404 GQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDC--ETLFSEAKRKF 461
           G   + L++Y  A   +++A ELDPEN    I L  L    N   D   +T F+E+  K 
Sbjct: 234 GLCFWQLKDYQMAISAWERALELDPENKTASI-LCLLGKFHNSITDSKNDTQFTESFTKV 292

Query: 462 -----------PEAPEVPNFFAEILTDKNDFEKALKQYDLAIELENKLDGIYVGIAP-LV 509
                       E P +            D+ + +K Y+  I     L      I P L+
Sbjct: 293 LTELNDIYTNNKENPVLLILLQSYYYFTGDYSRVIKIYEAKISPNASL------ITPTLM 346

Query: 510 GKATLLTRNP--TVENFIEATNLLEEASKLDPRSEQAKIGLAQMKLQQEDIDEAITLFE 566
             +T         + N+ EA  + +E+ K +  +  A+ G+ Q +++   ++E+I  FE
Sbjct: 347 SDSTFWCGRAQYALNNYREAFVMFQESLKTNEDNLLARFGVGQSQIKTNLVEESILTFE 405

>Suva_16.521 Chr16 (895057..899331) [4275 bp, 1424 aa] {ON} YPR189W
           (REAL)
          Length = 1424

 Score = 31.6 bits (70), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 18/73 (24%), Positives = 37/73 (50%), Gaps = 2/73 (2%)

Query: 362 RVNSYIYMALIMA--DRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKD 419
           R N++ +  + +A  ++ + ++   +F  AL++D N+   +   GQ        + + K 
Sbjct: 692 RSNNWPFRVVGIAHLEKQEESDSIEWFQSALRVDPNDVESWVGLGQAYHACGRIEASIKV 751

Query: 420 FDKAKELDPENIF 432
           FDKA EL P + +
Sbjct: 752 FDKAIELQPSHTY 764

>AEL281C Chr5 complement(111535..115707) [4173 bp, 1390 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR189W
           (SKI3)
          Length = 1390

 Score = 31.6 bits (70), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 19/79 (24%), Positives = 39/79 (49%)

Query: 385 YFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRE 444
           +F  AL++DS++   +   GQ        + + K F++A EL PE+ +  + LA    + 
Sbjct: 682 WFQSALRIDSSDVEAWIGLGQAYAACGRIEASIKVFERALELSPEHKYAGLFLAISLCQL 741

Query: 445 NKFDDCETLFSEAKRKFPE 463
           ++F+       +   K+P+
Sbjct: 742 SEFEKSLEALRKLVNKYPQ 760

>YLR445W Chr12 (1024189..1024572,1024655..1024837) [567 bp, 188 aa]
           {ON}  GMC2Protein involved in meiotic progression;
           mutants are delayed in meiotic nuclear division and are
           defective in synaptonemal complex assembly;
           transcription is regulated by Ume6p and induced in
           response to alpha factor
          Length = 188

 Score = 30.4 bits (67), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 29/49 (59%), Gaps = 1/49 (2%)

Query: 246 DKTENLPSITSMASFFGIFKPELTFANYDESNEADKDLMNGLTNLYKRS 294
           D T N+PS+  +A+ + I  P+ TF N+   N+  K + N +T+L + S
Sbjct: 30  DVTNNIPSLFKLAAEWQINNPQETFQNHILENDVLKKI-NEITHLIRES 77

>NDAI0G04870 Chr7 complement(1173964..1175148) [1185 bp, 394 aa]
           {ON} Anc_1.456
          Length = 394

 Score = 31.2 bits (69), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 38/69 (55%), Gaps = 4/69 (5%)

Query: 366 YIYMALIMADR---NDSTEYYNYFDKALKLDS-NNSSVYYHRGQMNFILQNYDQAGKDFD 421
           Y+ ++L++ +    +D+  Y NY      + S + +  YY RG  NF  ++Y+ + KD+ 
Sbjct: 296 YLNLSLVLFNLKKLDDAILYCNYLLDMENVPSLDKAKAYYRRGNCNFSKKHYEVSLKDYK 355

Query: 422 KAKELDPEN 430
             KE +P++
Sbjct: 356 TCKEYNPDD 364

>Kwal_34.16092 s34 complement(198730..199917) [1188 bp, 395 aa] {ON}
           YJR032W (CPR7) - peptidyl-prolyl cis/trans isomerase
           [contig 270] FULL
          Length = 395

 Score = 30.8 bits (68), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 39/81 (48%), Gaps = 6/81 (7%)

Query: 354 KKAIELFPRVNSYIYMALIMADRNDSTEYYNYFDKALKLDSNNS----SVYYHRGQMNFI 409
           KK IEL  +   Y+ ++L+M +     E   Y    L++   +S      YY  G  +F 
Sbjct: 287 KKFIEL--KAKLYLNLSLVMFNLKRYEEAITYTTYLLEIPEASSIDKAKAYYRSGNCHFA 344

Query: 410 LQNYDQAGKDFDKAKELDPEN 430
            + YD+A  DF   KE +P++
Sbjct: 345 KKRYDKALSDFKCCKENNPDD 365

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.131    0.359 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 64,254,592
Number of extensions: 3032289
Number of successful extensions: 11950
Number of sequences better than 10.0: 298
Number of HSP's gapped: 12048
Number of HSP's successfully gapped: 438
Length of query: 617
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 501
Effective length of database: 40,180,143
Effective search space: 20130251643
Effective search space used: 20130251643
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 69 (31.2 bits)