Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_14.2062.151ON1131135896e-80
Suva_14.2182.151ON112984552e-59
YNL122C2.151ON1151034473e-58
Skud_14.2102.151ON1031024453e-58
NCAS0G024702.151ON88712673e-31
KNAG0I021302.151ON92982673e-31
NDAI0F028202.151ON128692565e-29
KLLA0F24068g2.151ON95982466e-28
KAFR0J020902.151ON92662431e-27
CAGL0L04070g2.151ON95662423e-27
ZYRO0G06490g2.151ON92932388e-27
Ecym_82022.151ON98982398e-27
ABR133W2.151ON96982343e-26
TDEL0B051302.151ON93972344e-26
SAKL0E10978g2.151ON95952311e-25
Kwal_33.147622.151ON91642265e-25
KLTH0B05214g2.151ON91662127e-23
TPHA0F018802.151ON99652085e-22
Kpol_505.212.151ON85772065e-22
TBLA0B012302.151ON97671745e-17
KLLA0A01826g5.524ON146456710.24
CAGL0M06919g2.288ON95646642.0
Skud_15.3035.476ON74877615.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_14.206
         (113 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_14.206 Chr14 complement(377692..377997,378001..378009,37801...   231   6e-80
Suva_14.218 Chr14 complement(394669..394965,394969..394983,39499...   179   2e-59
YNL122C Chr14 complement(398023..398370) [348 bp, 115 aa] {ON} P...   176   3e-58
Skud_14.210 Chr14 complement(388110..388406,388410..388421) [309...   176   3e-58
NCAS0G02470 Chr7 complement(439576..439842) [267 bp, 88 aa] {ON}...   107   3e-31
KNAG0I02130 Chr9 (416674..416952) [279 bp, 92 aa] {ON} Anc_2.151...   107   3e-31
NDAI0F02820 Chr6 (693148..693534) [387 bp, 128 aa] {ON} Anc_2.15...   103   5e-29
KLLA0F24068g Chr6 (2242939..2243226) [288 bp, 95 aa] {ON} simila...    99   6e-28
KAFR0J02090 Chr10 (400769..401047) [279 bp, 92 aa] {ON} Anc_2.15...    98   1e-27
CAGL0L04070g Chr12 (478686..478973) [288 bp, 95 aa] {ON} highly ...    98   3e-27
ZYRO0G06490g Chr7 complement(515132..515410) [279 bp, 92 aa] {ON...    96   8e-27
Ecym_8202 Chr8 complement(418239..418535) [297 bp, 98 aa] {ON} s...    97   8e-27
ABR133W Chr2 (644796..645086) [291 bp, 96 aa] {ON} Syntenic homo...    95   3e-26
TDEL0B05130 Chr2 complement(904074..904355) [282 bp, 93 aa] {ON}...    95   4e-26
SAKL0E10978g Chr5 (919541..919828) [288 bp, 95 aa] {ON} some sim...    94   1e-25
Kwal_33.14762 s33 complement(808878..809153) [276 bp, 91 aa] {ON...    92   5e-25
KLTH0B05214g Chr2 (430231..430506) [276 bp, 91 aa] {ON} some sim...    86   7e-23
TPHA0F01880 Chr6 (428432..428731) [300 bp, 99 aa] {ON} Anc_2.151...    85   5e-22
Kpol_505.21 s505 (56756..57013) [258 bp, 85 aa] {ON} (56756..570...    84   5e-22
TBLA0B01230 Chr2 complement(262437..262730) [294 bp, 97 aa] {ON}...    72   5e-17
KLLA0A01826g Chr1 complement(163010..167404) [4395 bp, 1464 aa] ...    32   0.24 
CAGL0M06919g Chr13 complement(703702..706572) [2871 bp, 956 aa] ...    29   2.0  
Skud_15.303 Chr15 (541019..543265) [2247 bp, 748 aa] {ON} YOR140...    28   5.6  

>Smik_14.206 Chr14
           complement(377692..377997,378001..378009,378013..378036)
           [339 bp, 113 aa] {ON} YNL122C (REAL)
          Length = 113

 Score =  231 bits (589), Expect = 6e-80,   Method: Compositional matrix adjust.
 Identities = 113/113 (100%), Positives = 113/113 (100%)

Query: 1   LETGVDEKEREQIQIMSMFSIFNPLLKGSNNFKARFHGFLFNNVSTVTIRTLMKTHKGTA 60
           LETGVDEKEREQIQIMSMFSIFNPLLKGSNNFKARFHGFLFNNVSTVTIRTLMKTHKGTA
Sbjct: 1   LETGVDEKEREQIQIMSMFSIFNPLLKGSNNFKARFHGFLFNNVSTVTIRTLMKTHKGTA 60

Query: 61  KRWRRTGNTFKRGIAGRKHGNIGWSHRSLKALTGRKTANSAYLKHLKRLLPYH 113
           KRWRRTGNTFKRGIAGRKHGNIGWSHRSLKALTGRKTANSAYLKHLKRLLPYH
Sbjct: 61  KRWRRTGNTFKRGIAGRKHGNIGWSHRSLKALTGRKTANSAYLKHLKRLLPYH 113

>Suva_14.218 Chr14
           complement(394669..394965,394969..394983,394990..395013)
           [336 bp, 112 aa] {ON} YNL122C (REAL)
          Length = 112

 Score =  179 bits (455), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 86/98 (87%), Positives = 93/98 (94%)

Query: 16  MSMFSIFNPLLKGSNNFKARFHGFLFNNVSTVTIRTLMKTHKGTAKRWRRTGNTFKRGIA 75
           MS+F++FNPLLKGSN+FK R +  LFNNVST+TIRTLMKTHKGTAKRWRRTGNTFKRGIA
Sbjct: 15  MSLFNLFNPLLKGSNSFKPRLNQLLFNNVSTITIRTLMKTHKGTAKRWRRTGNTFKRGIA 74

Query: 76  GRKHGNIGWSHRSLKALTGRKTANSAYLKHLKRLLPYH 113
           GRKHGNIGWSHRSLK LTGRKTANS+YLKHLKRLLPYH
Sbjct: 75  GRKHGNIGWSHRSLKVLTGRKTANSSYLKHLKRLLPYH 112

>YNL122C Chr14 complement(398023..398370) [348 bp, 115 aa] {ON}
           Putative protein of unknown function; green fluorescent
           protein (GFP)-fusion protein localizes to mitochondria;
           YNL122C is not an essential gene
          Length = 115

 Score =  176 bits (447), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 85/103 (82%), Positives = 94/103 (91%)

Query: 11  EQIQIMSMFSIFNPLLKGSNNFKARFHGFLFNNVSTVTIRTLMKTHKGTAKRWRRTGNTF 70
           +Q Q MS+F++  PLLKGSN+FK + +GFLFNNVST+TIRTLMKTHKGTAKRWRRTGNTF
Sbjct: 13  DQNQNMSVFNVLKPLLKGSNSFKVKLNGFLFNNVSTITIRTLMKTHKGTAKRWRRTGNTF 72

Query: 71  KRGIAGRKHGNIGWSHRSLKALTGRKTANSAYLKHLKRLLPYH 113
           KRGIAGRKHGNIGWSHRSLKALTGRK A+ AY KHLKRLLPYH
Sbjct: 73  KRGIAGRKHGNIGWSHRSLKALTGRKIAHPAYSKHLKRLLPYH 115

>Skud_14.210 Chr14 complement(388110..388406,388410..388421) [309
           bp, 103 aa] {ON} YNL122C (REAL)
          Length = 103

 Score =  176 bits (445), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 95/102 (93%), Gaps = 1/102 (0%)

Query: 13  IQI-MSMFSIFNPLLKGSNNFKARFHGFLFNNVSTVTIRTLMKTHKGTAKRWRRTGNTFK 71
           +QI MS+F++ NPLLKGSN+ + +F+G LFNNV T+TIRTLMKTHKGTAKRWRRTGNTFK
Sbjct: 2   VQITMSLFNVLNPLLKGSNSLRPKFNGILFNNVCTITIRTLMKTHKGTAKRWRRTGNTFK 61

Query: 72  RGIAGRKHGNIGWSHRSLKALTGRKTANSAYLKHLKRLLPYH 113
           RGIAGRKHGNIGWSHRSLKALTGRKTA+ AYLKHLKRLLPYH
Sbjct: 62  RGIAGRKHGNIGWSHRSLKALTGRKTAHPAYLKHLKRLLPYH 103

>NCAS0G02470 Chr7 complement(439576..439842) [267 bp, 88 aa] {ON}
           Anc_2.151 YNL122C
          Length = 88

 Score =  107 bits (267), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 61/71 (85%), Gaps = 1/71 (1%)

Query: 43  NVSTVTI-RTLMKTHKGTAKRWRRTGNTFKRGIAGRKHGNIGWSHRSLKALTGRKTANSA 101
           N++T+TI R LMKTHKGTAKRWRRT  +FKRGIAGR HGN GWS RSLK L+GRK A+ +
Sbjct: 17  NLTTLTITRNLMKTHKGTAKRWRRTAQSFKRGIAGRNHGNAGWSRRSLKHLSGRKDADPS 76

Query: 102 YLKHLKRLLPY 112
           YL+HLKRL+PY
Sbjct: 77  YLRHLKRLMPY 87

>KNAG0I02130 Chr9 (416674..416952) [279 bp, 92 aa] {ON} Anc_2.151
           YNL122C
          Length = 92

 Score =  107 bits (267), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 65/98 (66%), Gaps = 6/98 (6%)

Query: 16  MSMFSIFNPLLKGSNNFKARFHGFLFNNVSTVTIRTLMKTHKGTAKRWRRTGNTFKRGIA 75
           MS  S  +PL      FK  F  +   + S +  R+LMKTHKG AKRWR+  N FKRGI+
Sbjct: 1   MSFLSALSPL------FKNGFAAWKIPSASMIVTRSLMKTHKGAAKRWRKNANGFKRGIS 54

Query: 76  GRKHGNIGWSHRSLKALTGRKTANSAYLKHLKRLLPYH 113
           GRKHGN GWS R LKALTGR  A+ + +K LK+LLPYH
Sbjct: 55  GRKHGNCGWSQRGLKALTGRTEAHQSQIKRLKKLLPYH 92

>NDAI0F02820 Chr6 (693148..693534) [387 bp, 128 aa] {ON} Anc_2.151
           YNL122C
          Length = 128

 Score =  103 bits (256), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 54/69 (78%)

Query: 45  STVTIRTLMKTHKGTAKRWRRTGNTFKRGIAGRKHGNIGWSHRSLKALTGRKTANSAYLK 104
           S V  R LMKTHKG AKRWR++   FKRGIAGR HGN+GWSHR L  LTGRK A+  ++K
Sbjct: 60  SLVITRNLMKTHKGAAKRWRKSAQGFKRGIAGRNHGNVGWSHRYLNKLTGRKEADPTHVK 119

Query: 105 HLKRLLPYH 113
           HLKR+LPYH
Sbjct: 120 HLKRMLPYH 128

>KLLA0F24068g Chr6 (2242939..2243226) [288 bp, 95 aa] {ON} similar
           to uniprot|P53921 Saccharomyces cerevisiae YNL122C
           Hypothetical ORF
          Length = 95

 Score = 99.4 bits (246), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 65/98 (66%), Gaps = 6/98 (6%)

Query: 18  MFSIFNPLLKGSNNFKAR--FHGFLFNNVSTVTIRTLMKTHKGTAKRWRRTGNTFKRGIA 75
           + SIF  ++    NF AR    G   N  S +  R LMKTHKG AKRWR+T N+FKRG A
Sbjct: 2   LSSIFGSMM----NFSARTGLLGSKTNVSSLILTRNLMKTHKGAAKRWRKTANSFKRGKA 57

Query: 76  GRKHGNIGWSHRSLKALTGRKTANSAYLKHLKRLLPYH 113
           GR HGN GWS  SLK+L+GR  A+S ++  LKRLLPYH
Sbjct: 58  GRNHGNAGWSRNSLKSLSGRSLADSTHMHRLKRLLPYH 95

>KAFR0J02090 Chr10 (400769..401047) [279 bp, 92 aa] {ON} Anc_2.151
           YNL122C
          Length = 92

 Score = 98.2 bits (243), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 48/66 (72%), Positives = 52/66 (78%)

Query: 47  VTIRTLMKTHKGTAKRWRRTGNTFKRGIAGRKHGNIGWSHRSLKALTGRKTANSAYLKHL 106
           +  R LMKTHKGTAKRWR+T N FKRGIAGR HGN GWS RSLK LTGRKTA  +  K L
Sbjct: 26  IIARNLMKTHKGTAKRWRKTANGFKRGIAGRNHGNGGWSRRSLKCLTGRKTATPSQAKRL 85

Query: 107 KRLLPY 112
           KRLLP+
Sbjct: 86  KRLLPF 91

>CAGL0L04070g Chr12 (478686..478973) [288 bp, 95 aa] {ON} highly
           similar to uniprot|P53921 Saccharomyces cerevisiae
           YNL122c
          Length = 95

 Score = 97.8 bits (242), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 46/66 (69%), Positives = 53/66 (80%)

Query: 47  VTIRTLMKTHKGTAKRWRRTGNTFKRGIAGRKHGNIGWSHRSLKALTGRKTANSAYLKHL 106
           V  RTLMKTH+G  KRWR+T   FKRGIAGRKHGNIGWSHRSLK+LTGR  A+   +K L
Sbjct: 29  VFCRTLMKTHRGALKRWRQTSTGFKRGIAGRKHGNIGWSHRSLKSLTGRTDAHPTQMKRL 88

Query: 107 KRLLPY 112
           +RL+PY
Sbjct: 89  RRLMPY 94

>ZYRO0G06490g Chr7 complement(515132..515410) [279 bp, 92 aa] {ON}
           similar to uniprot|Q75D91 Ashbya gossypii ABR133W 50S
           ribosomal protein L35 and some similarites with YNL122C
           uniprot|P53921 Saccharomyces cerevisiae YNL122C
           Hypothetical ORF
          Length = 92

 Score = 96.3 bits (238), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 51/93 (54%), Positives = 67/93 (72%), Gaps = 3/93 (3%)

Query: 21  IFNPLLK-GSNNFKARFHGFLFNNVSTVTIRTLMKTHKGTAKRWRRTGNTFKRGIAGRKH 79
            FN ++  GS +  A F GF  N+ S V  R LMKTHKGTAKRW++T + FKRG AGR H
Sbjct: 2   FFNSIVGLGSRSAFASFGGF--NSSSLVFTRNLMKTHKGTAKRWKKTADGFKRGKAGRNH 59

Query: 80  GNIGWSHRSLKALTGRKTANSAYLKHLKRLLPY 112
           GN+GWS RSLK L+G+  A+ ++++ L+RLLPY
Sbjct: 60  GNVGWSRRSLKVLSGKTPAHESHIQRLRRLLPY 92

>Ecym_8202 Chr8 complement(418239..418535) [297 bp, 98 aa] {ON}
           similar to Ashbya gossypii ABR133W
          Length = 98

 Score = 96.7 bits (239), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 61/98 (62%)

Query: 16  MSMFSIFNPLLKGSNNFKARFHGFLFNNVSTVTIRTLMKTHKGTAKRWRRTGNTFKRGIA 75
           M +  +F PL K ++ F              +  R+LMKTHKG AKRWR+T N+FKRG A
Sbjct: 1   MLIQGLFRPLEKLTSRFGGGVGCGSVGVSYLIFSRSLMKTHKGAAKRWRKTANSFKRGKA 60

Query: 76  GRKHGNIGWSHRSLKALTGRKTANSAYLKHLKRLLPYH 113
           GR HGN GWS  SLK L+GR  AN + L  LKRLLPYH
Sbjct: 61  GRSHGNSGWSKNSLKVLSGRALANGSQLNRLKRLLPYH 98

>ABR133W Chr2 (644796..645086) [291 bp, 96 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YNL122C
          Length = 96

 Score = 94.7 bits (234), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 60/98 (61%), Gaps = 7/98 (7%)

Query: 19  FSIFNPLLKGSNNFKARFHGFLF---NNVSTVTIRTLMKTHKGTAKRWRRTGNTFKRGIA 75
           F++  PL         RF    F      S + +RTLMKTHKG AKRWR+T   +KR  A
Sbjct: 3   FNMLRPL----TGLPVRFGSGAFAATTQPSLIMVRTLMKTHKGAAKRWRKTAGGYKRSKA 58

Query: 76  GRKHGNIGWSHRSLKALTGRKTANSAYLKHLKRLLPYH 113
           GR HGN GW  R+LK L+GR  A SA+LK L+RLLPYH
Sbjct: 59  GRSHGNTGWGQRALKQLSGRTMAASAHLKRLRRLLPYH 96

>TDEL0B05130 Chr2 complement(904074..904355) [282 bp, 93 aa] {ON}
           Anc_2.151 YNL122C
          Length = 93

 Score = 94.7 bits (234), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 64/97 (65%), Gaps = 5/97 (5%)

Query: 15  IMSMFSIFNPLLKGSNNFKARFHGFLFNNVSTVTIRTLMKTHKGTAKRWRRTGNTFKRGI 74
           +M   SI NP+ +   N  ++         S +  R+LMKTHKG AKRWR+T  +FKRG 
Sbjct: 1   MMFFSSIINPIFRTCLNTFSKVEA-----PSLILTRSLMKTHKGAAKRWRKTATSFKRGK 55

Query: 75  AGRKHGNIGWSHRSLKALTGRKTANSAYLKHLKRLLP 111
           AGR HGN GWS RSLK+L+G+  A+  ++KHLKRL+P
Sbjct: 56  AGRSHGNAGWSRRSLKSLSGKTLAHETHIKHLKRLMP 92

>SAKL0E10978g Chr5 (919541..919828) [288 bp, 95 aa] {ON} some
           similarities with uniprot|P53921 Saccharomyces
           cerevisiae YNL122C Hypothetical ORF
          Length = 95

 Score = 93.6 bits (231), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 64/95 (67%), Gaps = 2/95 (2%)

Query: 21  IFNPLLKGSNNFKARFHGFL--FNNVSTVTIRTLMKTHKGTAKRWRRTGNTFKRGIAGRK 78
           + + LL+  +N   +F   L    + S V  R LMKTHKG AKRW++T N++KRG AGR 
Sbjct: 1   MLSSLLRPLSNISVKFGTSLSQIQHPSLVLTRNLMKTHKGAAKRWKKTANSYKRGRAGRN 60

Query: 79  HGNIGWSHRSLKALTGRKTANSAYLKHLKRLLPYH 113
           HGN GW+  +LK+L G+  A+  ++KHLKRLLPYH
Sbjct: 61  HGNAGWNKSTLKSLDGKTLAHPTHIKHLKRLLPYH 95

>Kwal_33.14762 s33 complement(808878..809153) [276 bp, 91 aa] {ON}
           YNL122C - Hypothetical ORF [contig 101] FULL
          Length = 91

 Score = 91.7 bits (226), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 51/64 (79%)

Query: 50  RTLMKTHKGTAKRWRRTGNTFKRGIAGRKHGNIGWSHRSLKALTGRKTANSAYLKHLKRL 109
           R LMKTHKGTAKRWR+T  ++KRG AGR HGN GW   +LKAL G+  A+S ++KHLKRL
Sbjct: 28  RNLMKTHKGTAKRWRKTSTSYKRGRAGRNHGNAGWGKSTLKALDGKTLAHSTHIKHLKRL 87

Query: 110 LPYH 113
           LPYH
Sbjct: 88  LPYH 91

>KLTH0B05214g Chr2 (430231..430506) [276 bp, 91 aa] {ON} some
           similarities with uniprot|P53921 Saccharomyces
           cerevisiae YNL122C Hypothetical ORF
          Length = 91

 Score = 86.3 bits (212), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 40/66 (60%), Positives = 50/66 (75%)

Query: 47  VTIRTLMKTHKGTAKRWRRTGNTFKRGIAGRKHGNIGWSHRSLKALTGRKTANSAYLKHL 106
           +  R LMKTHKGTAKRWR+T  ++KRG AGR HGN GW   +LK+L G+  A+  ++KHL
Sbjct: 25  MQTRNLMKTHKGTAKRWRKTSTSYKRGRAGRNHGNAGWGKSTLKSLDGKTLAHPTHIKHL 84

Query: 107 KRLLPY 112
           KRLLPY
Sbjct: 85  KRLLPY 90

>TPHA0F01880 Chr6 (428432..428731) [300 bp, 99 aa] {ON} Anc_2.151
           YNL122C
          Length = 99

 Score = 84.7 bits (208), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 51/65 (78%), Gaps = 2/65 (3%)

Query: 50  RTLMKTHKGTAKRWRRTG--NTFKRGIAGRKHGNIGWSHRSLKALTGRKTANSAYLKHLK 107
           RTLMKTHKGTAKRW+     +TFKRG +GR+HGNIGWS RSLK L+GR  A+  ++  L+
Sbjct: 34  RTLMKTHKGTAKRWKYISKLDTFKRGKSGRQHGNIGWSQRSLKTLSGRTYADKTHVSKLR 93

Query: 108 RLLPY 112
           +LLPY
Sbjct: 94  KLLPY 98

>Kpol_505.21 s505 (56756..57013) [258 bp, 85 aa] {ON} (56756..57013)
           [258 nt, 86 aa]
          Length = 85

 Score = 84.0 bits (206), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 62/77 (80%), Gaps = 4/77 (5%)

Query: 40  LFNN-VSTVTI-RTLMKTHKGTAKRWR--RTGNTFKRGIAGRKHGNIGWSHRSLKALTGR 95
           LFN+ +S + I R+LMKTHKGTAKRW+  ++ +TFKRG +GR+HGN+GWS RSLK L+GR
Sbjct: 8   LFNSKISILQITRSLMKTHKGTAKRWKFIKSLDTFKRGKSGRQHGNVGWSQRSLKHLSGR 67

Query: 96  KTANSAYLKHLKRLLPY 112
             A++ ++  L++LLPY
Sbjct: 68  TYAHTTHVSRLRKLLPY 84

>TBLA0B01230 Chr2 complement(262437..262730) [294 bp, 97 aa] {ON}
           Anc_2.151 YNL122C
          Length = 97

 Score = 71.6 bits (174), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 45/67 (67%), Gaps = 7/67 (10%)

Query: 53  MKTHKGTAKRWRR-------TGNTFKRGIAGRKHGNIGWSHRSLKALTGRKTANSAYLKH 105
           +KTHKGT KRWRR           F R  AGR HGNIGWSHR+L AL+ R  A+S ++K 
Sbjct: 31  LKTHKGTLKRWRRRVAPGGPAAEQFVRSKAGRNHGNIGWSHRALAALSRRVPAHSTHVKA 90

Query: 106 LKRLLPY 112
           L++LLPY
Sbjct: 91  LRKLLPY 97

>KLLA0A01826g Chr1 complement(163010..167404) [4395 bp, 1464 aa]
           {ON} some similarities with uniprot|P41809 Saccharomyces
           cerevisiae YDR420W HKR1 Serine/threonine rich cell
           surface protein that contains an EF hand motif involved
           in the regulation of cell wall beta-1 3 glucan synthesis
           and bud site selection overexpression confers resistance
           to Hansenula mrakii killer toxin HM-1
          Length = 1464

 Score = 32.0 bits (71), Expect = 0.24,   Method: Composition-based stats.
 Identities = 19/56 (33%), Positives = 25/56 (44%), Gaps = 10/56 (17%)

Query: 19  FSIFNPLLKGSNNFKARFHGFLFNNVSTVTIRTLMKTHKGTAKRWRRTGNTFKRGI 74
           F I NPL              +FN +  V +R    T  G A  +RR+ N FK+GI
Sbjct: 782 FLIANPLASAQ----------IFNFLPKVLVRPFQLTTTGAAPVYRRSWNIFKKGI 827

>CAGL0M06919g Chr13 complement(703702..706572) [2871 bp, 956 aa]
           {ON} similar to uniprot|P53971 Saccharomyces cerevisiae
           YNL023c FAP1
          Length = 956

 Score = 29.3 bits (64), Expect = 2.0,   Method: Composition-based stats.
 Identities = 17/46 (36%), Positives = 22/46 (47%), Gaps = 4/46 (8%)

Query: 7   EKEREQIQIMSMFSI----FNPLLKGSNNFKARFHGFLFNNVSTVT 48
           EKE++Q    SM +     F P +       ARF+GFL  NV   T
Sbjct: 830 EKEKKQANFESMTTTRLINFTPEMSPELESAARFNGFLVTNVGEFT 875

>Skud_15.303 Chr15 (541019..543265) [2247 bp, 748 aa] {ON} YOR140W
           (REAL)
          Length = 748

 Score = 28.1 bits (61), Expect = 5.6,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 34/77 (44%), Gaps = 5/77 (6%)

Query: 3   TGVDEKEREQIQIMSMFSIFNPLLKGSNNFKARFHGFLFNNVSTVTIRTLMKTHKGTAKR 62
           T + E   + I+I+     F  L    +NF ++   F F NVS      +MK H+   K 
Sbjct: 287 THLKEINVDMIKIIESMQHFISL---QHNFCSK--SFTFKNVSKKKSENIMKDHQKQLKT 341

Query: 63  WRRTGNTFKRGIAGRKH 79
           +     TFK+ +  R H
Sbjct: 342 FENDMLTFKQHVMSRAH 358

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.135    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 11,807,527
Number of extensions: 425678
Number of successful extensions: 922
Number of sequences better than 10.0: 33
Number of HSP's gapped: 919
Number of HSP's successfully gapped: 33
Length of query: 113
Length of database: 53,481,399
Length adjustment: 83
Effective length of query: 30
Effective length of database: 43,964,121
Effective search space: 1318923630
Effective search space used: 1318923630
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 59 (27.3 bits)