Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_13.5038.853ON96996950080.0
YMR287C (DSS1)8.853ON96996942600.0
Skud_13.4608.853ON96996941080.0
Suva_13.4778.853ON96996940000.0
TDEL0B002208.853ON93590422300.0
SAKL0D01078g8.853ON93693322060.0
ZYRO0C14938g8.853ON96691021940.0
KNAG0E011408.853ON92989821540.0
CAGL0M07051g8.853ON92391221090.0
KAFR0L019708.853ON93291620450.0
NCAS0C003008.853ON94090520280.0
Kwal_27.102138.853ON93693319700.0
KLTH0C03674g8.853ON94891319490.0
NDAI0K003208.853ON96292218370.0
Kpol_237.48.853ON91691917340.0
TPHA0I003508.853ON94391716630.0
KLLA0C06314g8.853ON98395515500.0
AFR448W8.853ON81783214830.0
TBLA0B029208.853ON102945211221e-136
CAGL0H04411g1.367ON10074491594e-10
Smik_15.1451.367ON10014411542e-09
Ecym_27151.367ON9884651471e-08
Skud_15.1371.367ON10304411433e-08
KAFR0C045301.367ON10004581433e-08
Suva_15.1471.367ON10014391434e-08
TPHA0A023201.367ON10154641425e-08
KNAG0C019501.367ON9964411415e-08
TDEL0D023801.367ON9974451407e-08
ZYRO0G01166g1.367ON9934491408e-08
NDAI0H035601.367ON10124401372e-07
AEL031C1.367ON9974491362e-07
YOL021C (DIS3)1.367ON10014411362e-07
NCAS0D005901.367ON9984391353e-07
TBLA0D050701.367ON9974451344e-07
SAKL0D10186g1.367ON9884391326e-07
Kpol_1043.421.367ON9884391292e-06
KLTH0H13420g1.367ON9864741263e-06
KLLA0A10835g1.367ON10084411192e-05
Kwal_34.162451.367ON9864401131e-04
Ecym_31865.307ON1241336920.032
NDAI0C040505.307ON1260127880.093
TDEL0E032005.307ON1257137880.10
AAL072C5.307ON1220330860.17
Skud_4.5555.307ON125283850.20
Suva_2.4595.307ON125883850.22
TBLA0C032805.307ON1313360850.23
Kpol_1004.685.307ON125083820.54
NCAS0F028905.356ON382129800.67
TPHA0D020905.356ON382129790.94
Smik_4.5815.356ON381129781.1
YDR321W (ASP1)5.356ON381129781.2
Skud_4.5885.356ON381129781.3
Kpol_1051.75.356ON375129771.4
KNAG0C054705.356ON384129771.4
NCAS0A137307.282ON14257731.7
TBLA0A031505.356ON393129761.8
KAFR0C018205.356ON386118762.0
Kwal_27.123245.356ON385129762.2
YDR293C (SSD1)5.307ON1250103762.7
KLTH0G06248g5.307ON122574762.9
Suva_2.4915.356ON381129753.0
NDAI0D019205.190ON207796753.3
KAFR0F002802.51ON54832734.7
ZYRO0A06138g8.734ON25036725.0
CAGL0H07051g5.356ON378129725.4
KLTH0H14960g5.356ON375118726.0
NDAI0C043405.356ON392122726.0
ZYRO0G16852g5.307ON127388736.5
YDL225W (SHS1)2.51ON55132719.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_13.503
         (969 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_13.503 Chr13 complement(825111..828020) [2910 bp, 969 aa] {...  1933   0.0  
YMR287C Chr13 complement(842436..845345) [2910 bp, 969 aa] {ON} ...  1645   0.0  
Skud_13.460 Chr13 complement(815990..818899) [2910 bp, 969 aa] {...  1587   0.0  
Suva_13.477 Chr13 complement(824387..827296) [2910 bp, 969 aa] {...  1545   0.0  
TDEL0B00220 Chr2 complement(40373..43180) [2808 bp, 935 aa] {ON}...   863   0.0  
SAKL0D01078g Chr4 (78360..81170) [2811 bp, 936 aa] {ON} similar ...   854   0.0  
ZYRO0C14938g Chr3 complement(1159657..1162557) [2901 bp, 966 aa]...   849   0.0  
KNAG0E01140 Chr5 complement(222456..225245) [2790 bp, 929 aa] {O...   834   0.0  
CAGL0M07051g Chr13 complement(716775..719546) [2772 bp, 923 aa] ...   816   0.0  
KAFR0L01970 Chr12 complement(372452..375250) [2799 bp, 932 aa] {...   792   0.0  
NCAS0C00300 Chr3 (39415..42237) [2823 bp, 940 aa] {ON} Anc_8.853...   785   0.0  
Kwal_27.10213 s27 complement(243200..246010) [2811 bp, 936 aa] {...   763   0.0  
KLTH0C03674g Chr3 complement(317119..319965) [2847 bp, 948 aa] {...   755   0.0  
NDAI0K00320 Chr11 (60516..63404) [2889 bp, 962 aa] {ON} Anc_8.85...   712   0.0  
Kpol_237.4 s237 complement(4514..7264) [2751 bp, 916 aa] {ON} co...   672   0.0  
TPHA0I00350 Chr9 complement(65929..68760) [2832 bp, 943 aa] {ON}...   645   0.0  
KLLA0C06314g Chr3 complement(556468..559419) [2952 bp, 983 aa] {...   601   0.0  
AFR448W Chr6 (1244187..1246640) [2454 bp, 817 aa] {ON} Syntenic ...   575   0.0  
TBLA0B02920 Chr2 complement(671467..674556) [3090 bp, 1029 aa] {...   436   e-136
CAGL0H04411g Chr8 complement(415101..418124) [3024 bp, 1007 aa] ...    66   4e-10
Smik_15.145 Chr15 complement(248837..251842) [3006 bp, 1001 aa] ...    64   2e-09
Ecym_2715 Chr2 complement(1383023..1385989) [2967 bp, 988 aa] {O...    61   1e-08
Skud_15.137 Chr15 complement(241849..244941) [3093 bp, 1030 aa] ...    60   3e-08
KAFR0C04530 Chr3 (904255..907257) [3003 bp, 1000 aa] {ON} Anc_1....    60   3e-08
Suva_15.147 Chr15 complement(255214..258219) [3006 bp, 1001 aa] ...    60   4e-08
TPHA0A02320 Chr1 complement(485855..488902) [3048 bp, 1015 aa] {...    59   5e-08
KNAG0C01950 Chr3 (377736..380726) [2991 bp, 996 aa] {ON} Anc_1.3...    59   5e-08
TDEL0D02380 Chr4 complement(463000..465993) [2994 bp, 997 aa] {O...    59   7e-08
ZYRO0G01166g Chr7 complement(91672..94653) [2982 bp, 993 aa] {ON...    59   8e-08
NDAI0H03560 Chr8 (869622..872660) [3039 bp, 1012 aa] {ON} Anc_1....    57   2e-07
AEL031C Chr5 complement(574534..577527) [2994 bp, 997 aa] {ON} S...    57   2e-07
YOL021C Chr15 complement(282421..285426) [3006 bp, 1001 aa] {ON}...    57   2e-07
NCAS0D00590 Chr4 complement(98734..101730) [2997 bp, 998 aa] {ON...    57   3e-07
TBLA0D05070 Chr4 (1255978..1258971) [2994 bp, 997 aa] {ON} Anc_1...    56   4e-07
SAKL0D10186g Chr4 (852303..855269) [2967 bp, 988 aa] {ON} highly...    55   6e-07
Kpol_1043.42 s1043 (83527..86493) [2967 bp, 988 aa] {ON} (83527....    54   2e-06
KLTH0H13420g Chr8 (1172833..1175793) [2961 bp, 986 aa] {ON} high...    53   3e-06
KLLA0A10835g Chr1 (938712..941738) [3027 bp, 1008 aa] {ON} highl...    50   2e-05
Kwal_34.16245 s34 complement(260089..263049) [2961 bp, 986 aa] {...    48   1e-04
Ecym_3186 Chr3 complement(354713..358438) [3726 bp, 1241 aa] {ON...    40   0.032
NDAI0C04050 Chr3 complement(921707..925489) [3783 bp, 1260 aa] {...    39   0.093
TDEL0E03200 Chr5 (603078..606851) [3774 bp, 1257 aa] {ON} Anc_5....    39   0.10 
AAL072C Chr1 complement(218958..222620) [3663 bp, 1220 aa] {ON} ...    38   0.17 
Skud_4.555 Chr4 complement(988201..991959) [3759 bp, 1252 aa] {O...    37   0.20 
Suva_2.459 Chr2 complement(810378..814154) [3777 bp, 1258 aa] {O...    37   0.22 
TBLA0C03280 Chr3 complement(794118..798059) [3942 bp, 1313 aa] {...    37   0.23 
Kpol_1004.68 s1004 complement(143077..144804,144807..146831) [37...    36   0.54 
NCAS0F02890 Chr6 (575888..577036) [1149 bp, 382 aa] {ON} Anc_5.3...    35   0.67 
TPHA0D02090 Chr4 (428969..430117) [1149 bp, 382 aa] {ON} Anc_5.3...    35   0.94 
Smik_4.581 Chr4 (1035189..1036334) [1146 bp, 381 aa] {ON} YDR321...    35   1.1  
YDR321W Chr4 (1108702..1109847) [1146 bp, 381 aa] {ON}  ASP1Cyto...    35   1.2  
Skud_4.588 Chr4 (1044915..1046060) [1146 bp, 381 aa] {ON} YDR321...    35   1.3  
Kpol_1051.7 s1051 (12463..13590) [1128 bp, 375 aa] {ON} (12463.....    34   1.4  
KNAG0C05470 Chr3 complement(1067393..1068547) [1155 bp, 384 aa] ...    34   1.4  
NCAS0A13730 Chr1 (2698652..2699080) [429 bp, 142 aa] {ON} Anc_7....    33   1.7  
TBLA0A03150 Chr1 (750581..751762) [1182 bp, 393 aa] {ON} Anc_5.3...    34   1.8  
KAFR0C01820 Chr3 complement(367009..368169) [1161 bp, 386 aa] {O...    34   2.0  
Kwal_27.12324 s27 (1177349..1178506) [1158 bp, 385 aa] {ON} YDR3...    34   2.2  
YDR293C Chr4 complement(1045640..1049392) [3753 bp, 1250 aa] {ON...    34   2.7  
KLTH0G06248g Chr7 (494464..498141) [3678 bp, 1225 aa] {ON} simil...    34   2.9  
Suva_2.491 Chr2 (866068..867213) [1146 bp, 381 aa] {ON} YDR321W ...    33   3.0  
NDAI0D01920 Chr4 (451715..457948) [6234 bp, 2077 aa] {ON} Anc_5....    33   3.3  
KAFR0F00280 Chr6 (69827..71473) [1647 bp, 548 aa] {ON} Anc_2.51 ...    33   4.7  
ZYRO0A06138g Chr1 complement(490489..491241) [753 bp, 250 aa] {O...    32   5.0  
CAGL0H07051g Chr8 complement(698202..699338) [1137 bp, 378 aa] {...    32   5.4  
KLTH0H14960g Chr8 (1295363..1296490) [1128 bp, 375 aa] {ON} high...    32   6.0  
NDAI0C04340 Chr3 (987226..988404) [1179 bp, 392 aa] {ON} Anc_5.356     32   6.0  
ZYRO0G16852g Chr7 complement(1381740..1385561) [3822 bp, 1273 aa...    33   6.5  
YDL225W Chr4 (52445..54100) [1656 bp, 551 aa] {ON}  SHS1Componen...    32   9.7  

>Smik_13.503 Chr13 complement(825111..828020) [2910 bp, 969 aa] {ON}
           YMR287C (REAL)
          Length = 969

 Score = 1933 bits (5008), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 936/969 (96%), Positives = 936/969 (96%)

Query: 1   MVARGNAHILLIARSFHSCGPCFRVTTRGXXXXXXXXXXXXXXFDYTQLLDNEQVIESGA 60
           MVARGNAHILLIARSFHSCGPCFRVTTRG              FDYTQLLDNEQVIESGA
Sbjct: 1   MVARGNAHILLIARSFHSCGPCFRVTTRGKRQQSKKRQQAKAQFDYTQLLDNEQVIESGA 60

Query: 61  NGSVGTEKDIESINKDFLQRTKGLEPDIELKQLSQIKEEFYQRYKDRYIKPSEAWYTNTW 120
           NGSVGTEKDIESINKDFLQRTKGLEPDIELKQLSQIKEEFYQRYKDRYIKPSEAWYTNTW
Sbjct: 61  NGSVGTEKDIESINKDFLQRTKGLEPDIELKQLSQIKEEFYQRYKDRYIKPSEAWYTNTW 120

Query: 121 RSLTKPKISFHKLINSDVQLDTKLKDLDPMEFQPAQLMENPLNVGDLVLLKVKPNELAMC 180
           RSLTKPKISFHKLINSDVQLDTKLKDLDPMEFQPAQLMENPLNVGDLVLLKVKPNELAMC
Sbjct: 121 RSLTKPKISFHKLINSDVQLDTKLKDLDPMEFQPAQLMENPLNVGDLVLLKVKPNELAMC 180

Query: 181 VSLPSSTMDPRYTFVAIDGTMCFATKNRVLLRIPHKLPVGVNSLIQPEGHHKHLPIGTLK 240
           VSLPSSTMDPRYTFVAIDGTMCFATKNRVLLRIPHKLPVGVNSLIQPEGHHKHLPIGTLK
Sbjct: 181 VSLPSSTMDPRYTFVAIDGTMCFATKNRVLLRIPHKLPVGVNSLIQPEGHHKHLPIGTLK 240

Query: 241 NISNQTNILPIVTRQLITSRYPAQISKLAWKCLPITTKKLQLLHRSLQNYMGPWQIPFFT 300
           NISNQTNILPIVTRQLITSRYPAQISKLAWKCLPITTKKLQLLHRSLQNYMGPWQIPFFT
Sbjct: 241 NISNQTNILPIVTRQLITSRYPAQISKLAWKCLPITTKKLQLLHRSLQNYMGPWQIPFFT 300

Query: 301 LVGLVQKLDLNKALDGKYGIDYLTDLVNNYHTADNVAINSPTFVSTYWAILQQQESNLWG 360
           LVGLVQKLDLNKALDGKYGIDYLTDLVNNYHTADNVAINSPTFVSTYWAILQQQESNLWG
Sbjct: 301 LVGLVQKLDLNKALDGKYGIDYLTDLVNNYHTADNVAINSPTFVSTYWAILQQQESNLWG 360

Query: 361 EIHLNTALLSPISVTIVPLKSQHLYYAQVIEKLEANSYKEVNTFVKLVNERKYRDISNLY 420
           EIHLNTALLSPISVTIVPLKSQHLYYAQVIEKLEANSYKEVNTFVKLVNERKYRDISNLY
Sbjct: 361 EIHLNTALLSPISVTIVPLKSQHLYYAQVIEKLEANSYKEVNTFVKLVNERKYRDISNLY 420

Query: 421 PSVIQLLKDFAAGNFHNNGIIVTLISKIFRKIVRYKDYDITRDVCQDLINEIVXXXXXXX 480
           PSVIQLLKDFAAGNFHNNGIIVTLISKIFRKIVRYKDYDITRDVCQDLINEIV       
Sbjct: 421 PSVIQLLKDFAAGNFHNNGIIVTLISKIFRKIVRYKDYDITRDVCQDLINEIVPNSLSNP 480

Query: 481 XXXXXXXXXXXXSKLMESQQKLYYLTNIEDLQRENSGNDSDRYDFGDLRVFCIDSDTAHE 540
                       SKLMESQQKLYYLTNIEDLQRENSGNDSDRYDFGDLRVFCIDSDTAHE
Sbjct: 481 LLLNMDLALPSSSKLMESQQKLYYLTNIEDLQRENSGNDSDRYDFGDLRVFCIDSDTAHE 540

Query: 541 IDDGVSVENHGKDGMYTLHIHIADPTSMFPESTAIDSVGISTDILNIAFKRSFTTYLPDV 600
           IDDGVSVENHGKDGMYTLHIHIADPTSMFPESTAIDSVGISTDILNIAFKRSFTTYLPDV
Sbjct: 541 IDDGVSVENHGKDGMYTLHIHIADPTSMFPESTAIDSVGISTDILNIAFKRSFTTYLPDV 600

Query: 601 VVPMLPQAICHLSDLGKHGKRTKTISFSVDVKVGYQGCGKSLEIMYDSFRIRKGFVSNFP 660
           VVPMLPQAICHLSDLGKHGKRTKTISFSVDVKVGYQGCGKSLEIMYDSFRIRKGFVSNFP
Sbjct: 601 VVPMLPQAICHLSDLGKHGKRTKTISFSVDVKVGYQGCGKSLEIMYDSFRIRKGFVSNFP 660

Query: 661 KATYDDVDKILSAPDNESSPVKADLESLSMISKLLREQRIKKNNAVIFGEGFNKGMVTLN 720
           KATYDDVDKILSAPDNESSPVKADLESLSMISKLLREQRIKKNNAVIFGEGFNKGMVTLN
Sbjct: 661 KATYDDVDKILSAPDNESSPVKADLESLSMISKLLREQRIKKNNAVIFGEGFNKGMVTLN 720

Query: 721 ANAEGELTEVSFSNQEETPSTVLVSEMMILANTLTGRYFAENNIGGVFRCYKQLPLDLIA 780
           ANAEGELTEVSFSNQEETPSTVLVSEMMILANTLTGRYFAENNIGGVFRCYKQLPLDLIA
Sbjct: 721 ANAEGELTEVSFSNQEETPSTVLVSEMMILANTLTGRYFAENNIGGVFRCYKQLPLDLIA 780

Query: 781 QQQYDSMITGTKKGLFPKLRDIVKLSSLLNSSFYTGRPFRHEMIGAKQYLTVTSPLRRFP 840
           QQQYDSMITGTKKGLFPKLRDIVKLSSLLNSSFYTGRPFRHEMIGAKQYLTVTSPLRRFP
Sbjct: 781 QQQYDSMITGTKKGLFPKLRDIVKLSSLLNSSFYTGRPFRHEMIGAKQYLTVTSPLRRFP 840

Query: 841 DLINHLQIHRHLQKKPLCFTQTQIDSLIWSIQSRADILKRASRDSSTYWTLNYLKKLAKS 900
           DLINHLQIHRHLQKKPLCFTQTQIDSLIWSIQSRADILKRASRDSSTYWTLNYLKKLAKS
Sbjct: 841 DLINHLQIHRHLQKKPLCFTQTQIDSLIWSIQSRADILKRASRDSSTYWTLNYLKKLAKS 900

Query: 901 DPGRTYDVMITSVPQNGFAGCVFPSLSFARGTLKLQPKAKYYPMIGDIVKDCKISKIDCL 960
           DPGRTYDVMITSVPQNGFAGCVFPSLSFARGTLKLQPKAKYYPMIGDIVKDCKISKIDCL
Sbjct: 901 DPGRTYDVMITSVPQNGFAGCVFPSLSFARGTLKLQPKAKYYPMIGDIVKDCKISKIDCL 960

Query: 961 EGMLELEKL 969
           EGMLELEKL
Sbjct: 961 EGMLELEKL 969

>YMR287C Chr13 complement(842436..845345) [2910 bp, 969 aa] {ON}
           DSS13'-5' exoribonuclease, component of the
           mitochondrial degradosome along with the ATP-dependent
           RNA helicase Suv3p; the degradosome associates with the
           ribosome and mediates turnover of aberrant or
           unprocessed RNAs
          Length = 969

 Score = 1645 bits (4260), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 791/969 (81%), Positives = 856/969 (88%)

Query: 1   MVARGNAHILLIARSFHSCGPCFRVTTRGXXXXXXXXXXXXXXFDYTQLLDNEQVIESGA 60
           MV R   H+LLIARSFHS  PCFRVTTRG               D+T+ LDN+Q  E+  
Sbjct: 1   MVVRRKVHVLLIARSFHSYTPCFRVTTRGKRQRSKSKQQAKVELDHTRELDNDQATETVV 60

Query: 61  NGSVGTEKDIESINKDFLQRTKGLEPDIELKQLSQIKEEFYQRYKDRYIKPSEAWYTNTW 120
           + SVG EKDIESINKDFLQRTKGLEPDIELKQL QIK+EF QRYKDRY+KPSE WY N+W
Sbjct: 61  DRSVGPEKDIESINKDFLQRTKGLEPDIELKQLPQIKQEFNQRYKDRYVKPSEDWYVNSW 120

Query: 121 RSLTKPKISFHKLINSDVQLDTKLKDLDPMEFQPAQLMENPLNVGDLVLLKVKPNELAMC 180
           RSLTKPKI  +KLINSD QL TKLK  +PMEFQP QLME+PLNVGD VLLK++PNELAMC
Sbjct: 121 RSLTKPKIPLYKLINSDFQLITKLKAPNPMEFQPVQLMESPLNVGDFVLLKMRPNELAMC 180

Query: 181 VSLPSSTMDPRYTFVAIDGTMCFATKNRVLLRIPHKLPVGVNSLIQPEGHHKHLPIGTLK 240
           VSLPSSTMDPRYTFV IDGTMCFATKNRVLLRIPHKLP G++SLIQPE HHKHLPIGT+K
Sbjct: 181 VSLPSSTMDPRYTFVTIDGTMCFATKNRVLLRIPHKLPAGIHSLIQPESHHKHLPIGTVK 240

Query: 241 NISNQTNILPIVTRQLITSRYPAQISKLAWKCLPITTKKLQLLHRSLQNYMGPWQIPFFT 300
           N SNQTNILPIV RQLITSRYPAQISKLAWK LPITTKKLQLLHRSLQNYMGPWQIPFFT
Sbjct: 241 NFSNQTNILPIVARQLITSRYPAQISKLAWKDLPITTKKLQLLHRSLQNYMGPWQIPFFT 300

Query: 301 LVGLVQKLDLNKALDGKYGIDYLTDLVNNYHTADNVAINSPTFVSTYWAILQQQESNLWG 360
           LVGLVQKLDLNKALD K GI+YLT LVNNYHT +++ INSPTFVSTYWAI+QQQESNLWG
Sbjct: 301 LVGLVQKLDLNKALDDKNGINYLTSLVNNYHTVNDIPINSPTFVSTYWAIMQQQESNLWG 360

Query: 361 EIHLNTALLSPISVTIVPLKSQHLYYAQVIEKLEANSYKEVNTFVKLVNERKYRDISNLY 420
           EIHLNTALLSPISVTI+PLKSQHLYYAQVIEKLEANSY+EVN FVKLVNERKYRDIS LY
Sbjct: 361 EIHLNTALLSPISVTIIPLKSQHLYYAQVIEKLEANSYREVNKFVKLVNERKYRDISALY 420

Query: 421 PSVIQLLKDFAAGNFHNNGIIVTLISKIFRKIVRYKDYDITRDVCQDLINEIVXXXXXXX 480
           PSVIQLLKDFAAGNFHNNGIIV LISKIFRKI RYKD DITRD+CQDLINEI        
Sbjct: 421 PSVIQLLKDFAAGNFHNNGIIVALISKIFRKIERYKDCDITRDICQDLINEITPNSIPNP 480

Query: 481 XXXXXXXXXXXXSKLMESQQKLYYLTNIEDLQRENSGNDSDRYDFGDLRVFCIDSDTAHE 540
                       SKL++ QQKLY LTNIE+LQ + SG D DRYDFGDLRVFCIDS+TAHE
Sbjct: 481 LLLNMDLALPASSKLVKWQQKLYDLTNIEELQWKKSGTDDDRYDFGDLRVFCIDSETAHE 540

Query: 541 IDDGVSVENHGKDGMYTLHIHIADPTSMFPESTAIDSVGISTDILNIAFKRSFTTYLPDV 600
           IDDGVSV+N+G+DG+YTL+IHIADPTSMFPEST +D  GISTDILN+A KRSFTTYLPD 
Sbjct: 541 IDDGVSVKNYGRDGLYTLYIHIADPTSMFPESTNVDIEGISTDILNVALKRSFTTYLPDT 600

Query: 601 VVPMLPQAICHLSDLGKHGKRTKTISFSVDVKVGYQGCGKSLEIMYDSFRIRKGFVSNFP 660
           VVPMLPQ+ICHLSDLGK G+RTKTISFSVDVK+  +  GKS+EIMYDSF+IRKG VSNFP
Sbjct: 601 VVPMLPQSICHLSDLGKQGQRTKTISFSVDVKITSKCSGKSIEIMYDSFKIRKGIVSNFP 660

Query: 661 KATYDDVDKILSAPDNESSPVKADLESLSMISKLLREQRIKKNNAVIFGEGFNKGMVTLN 720
           KATY+DVD+IL  P++E+SPVK DLESLSMISKLLREQRIK +NAVIFGEGFNKG+V LN
Sbjct: 661 KATYEDVDRILGTPNSEASPVKKDLESLSMISKLLREQRIKNSNAVIFGEGFNKGLVMLN 720

Query: 721 ANAEGELTEVSFSNQEETPSTVLVSEMMILANTLTGRYFAENNIGGVFRCYKQLPLDLIA 780
           A++EGELTEV+FS+QEET ST+LVSEMMILANTLTGRYFAEN IGGVFRCYKQLPL  +A
Sbjct: 721 ADSEGELTEVTFSDQEETLSTILVSEMMILANTLTGRYFAENKIGGVFRCYKQLPLGEVA 780

Query: 781 QQQYDSMITGTKKGLFPKLRDIVKLSSLLNSSFYTGRPFRHEMIGAKQYLTVTSPLRRFP 840
           QQQYDSMIT TKKG+FPKL+DIVKLSSLLNSSFYTGRPFRHEMIGAKQYLTVTSPLRRFP
Sbjct: 781 QQQYDSMITSTKKGIFPKLKDIVKLSSLLNSSFYTGRPFRHEMIGAKQYLTVTSPLRRFP 840

Query: 841 DLINHLQIHRHLQKKPLCFTQTQIDSLIWSIQSRADILKRASRDSSTYWTLNYLKKLAKS 900
           DLINHLQIHRHLQKKPLCF QTQIDSLIW IQSRADILKRASR+SSTYWTLNYLKKL K 
Sbjct: 841 DLINHLQIHRHLQKKPLCFNQTQIDSLIWPIQSRADILKRASRNSSTYWTLNYLKKLTKL 900

Query: 901 DPGRTYDVMITSVPQNGFAGCVFPSLSFARGTLKLQPKAKYYPMIGDIVKDCKISKIDCL 960
           +P RT+DVM+TSVPQNGF GCVFP LSFARGTLKL P + +YPMIGDIVK+CKISKIDCL
Sbjct: 901 EPERTFDVMVTSVPQNGFTGCVFPDLSFARGTLKLHPSSMHYPMIGDIVKNCKISKIDCL 960

Query: 961 EGMLELEKL 969
           EGMLELEKL
Sbjct: 961 EGMLELEKL 969

>Skud_13.460 Chr13 complement(815990..818899) [2910 bp, 969 aa] {ON}
           YMR287C (REAL)
          Length = 969

 Score = 1587 bits (4108), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 762/969 (78%), Positives = 843/969 (86%)

Query: 1   MVARGNAHILLIARSFHSCGPCFRVTTRGXXXXXXXXXXXXXXFDYTQLLDNEQVIESGA 60
           M+ RGN H LLIARSFHS  PCFRVT RG               DYTQLLDN +V E   
Sbjct: 1   MIPRGNTHALLIARSFHSYKPCFRVTIRGKRQRSKTKQQGKAQEDYTQLLDNGKVSEVTV 60

Query: 61  NGSVGTEKDIESINKDFLQRTKGLEPDIELKQLSQIKEEFYQRYKDRYIKPSEAWYTNTW 120
           N S+ + KDIESINKDFL RTKGLEP+IELKQLSQIKEEF QRY+DRYIKPSE WYTN+W
Sbjct: 61  NSSIKSAKDIESINKDFLHRTKGLEPNIELKQLSQIKEEFQQRYRDRYIKPSETWYTNSW 120

Query: 121 RSLTKPKISFHKLINSDVQLDTKLKDLDPMEFQPAQLMENPLNVGDLVLLKVKPNELAMC 180
           RSL KPKIS H LINS++QLD +LK  +P+EFQP QLME PLNVGDLVLL+V+PNELAMC
Sbjct: 121 RSLAKPKISSHNLINSNIQLDAQLKFSNPLEFQPVQLMERPLNVGDLVLLRVRPNELAMC 180

Query: 181 VSLPSSTMDPRYTFVAIDGTMCFATKNRVLLRIPHKLPVGVNSLIQPEGHHKHLPIGTLK 240
           VSLPSSTMDPRYTFVAIDG+MCFATKNR+LLRIPH+LPVGVNSLIQPE  + HLPIGT+K
Sbjct: 181 VSLPSSTMDPRYTFVAIDGSMCFATKNRILLRIPHRLPVGVNSLIQPEERYGHLPIGTIK 240

Query: 241 NISNQTNILPIVTRQLITSRYPAQISKLAWKCLPITTKKLQLLHRSLQNYMGPWQIPFFT 300
           N SNQTNILPI  RQ+ITSRYPAQISKLAW+ LP TTKKLQLLHRSLQ+Y GPWQIPFFT
Sbjct: 241 NFSNQTNILPIAARQIITSRYPAQISKLAWRDLPFTTKKLQLLHRSLQDYRGPWQIPFFT 300

Query: 301 LVGLVQKLDLNKALDGKYGIDYLTDLVNNYHTADNVAINSPTFVSTYWAILQQQESNLWG 360
           LVGLVQ+LDLN+ALD KYG  YL +L+  + TADNV I+S TFVSTYWAI+QQQESN WG
Sbjct: 301 LVGLVQRLDLNEALDDKYGATYLANLLGTHQTADNVPISSATFVSTYWAIMQQQESNFWG 360

Query: 361 EIHLNTALLSPISVTIVPLKSQHLYYAQVIEKLEANSYKEVNTFVKLVNERKYRDISNLY 420
           EIHLNTALLSPISVT++PLKS+HLYY QV+ KLEA+ Y E+N FVKLVNERKYRDIS LY
Sbjct: 361 EIHLNTALLSPISVTVIPLKSRHLYYEQVVGKLEADDYNEINRFVKLVNERKYRDISTLY 420

Query: 421 PSVIQLLKDFAAGNFHNNGIIVTLISKIFRKIVRYKDYDITRDVCQDLINEIVXXXXXXX 480
           PSVIQ+LKDFAAGNFHNNGIIVTL+SKIFRKI RYKD DITRD+CQDLINEI+       
Sbjct: 421 PSVIQMLKDFAAGNFHNNGIIVTLVSKIFRKIERYKDCDITRDICQDLINEILPNSMSNP 480

Query: 481 XXXXXXXXXXXXSKLMESQQKLYYLTNIEDLQRENSGNDSDRYDFGDLRVFCIDSDTAHE 540
                       SKL+ SQQKLY LTNIEDLQR+NS N S+RYDFGDL+VFCIDS+TAHE
Sbjct: 481 LLLNMDLALPASSKLVRSQQKLYDLTNIEDLQRKNSDNSSERYDFGDLKVFCIDSETAHE 540

Query: 541 IDDGVSVENHGKDGMYTLHIHIADPTSMFPESTAIDSVGISTDILNIAFKRSFTTYLPDV 600
           IDDGVS+ENHG DG+YTLHIHIADPTSMFPEST  DS GI TDILN+A +RSFTTYLPDV
Sbjct: 541 IDDGVSIENHGTDGLYTLHIHIADPTSMFPESTNYDSEGIITDILNVALERSFTTYLPDV 600

Query: 601 VVPMLPQAICHLSDLGKHGKRTKTISFSVDVKVGYQGCGKSLEIMYDSFRIRKGFVSNFP 660
           VVPMLP++IC+LSDLGK G++TKTISFSVDVKV  +G G+SLEIM+DSF+IRKG VSNFP
Sbjct: 601 VVPMLPKSICNLSDLGKQGQKTKTISFSVDVKVMSKGDGESLEIMFDSFKIRKGIVSNFP 660

Query: 661 KATYDDVDKILSAPDNESSPVKADLESLSMISKLLREQRIKKNNAVIFGEGFNKGMVTLN 720
           K TYDDVD+IL+ P++E+SPVK DLESLSM+S LLR++RIK NNAVIFGEGFNKG+VTLN
Sbjct: 661 KVTYDDVDRILNTPNDEASPVKKDLESLSMVSNLLRDRRIKNNNAVIFGEGFNKGLVTLN 720

Query: 721 ANAEGELTEVSFSNQEETPSTVLVSEMMILANTLTGRYFAENNIGGVFRCYKQLPLDLIA 780
           AN EGELTE+SFS+Q ET STVLVSEMMILANTLTG+YFA+N I GVFRCYKQLPLD+IA
Sbjct: 721 ANEEGELTEISFSDQVETLSTVLVSEMMILANTLTGKYFADNKICGVFRCYKQLPLDIIA 780

Query: 781 QQQYDSMITGTKKGLFPKLRDIVKLSSLLNSSFYTGRPFRHEMIGAKQYLTVTSPLRRFP 840
           Q+QYDSMIT TKKGLFP+L+DIVKLSSLLNSSFYTGRPFRHEMIGAKQYLTVTSPLRRFP
Sbjct: 781 QEQYDSMITSTKKGLFPQLKDIVKLSSLLNSSFYTGRPFRHEMIGAKQYLTVTSPLRRFP 840

Query: 841 DLINHLQIHRHLQKKPLCFTQTQIDSLIWSIQSRADILKRASRDSSTYWTLNYLKKLAKS 900
           DLINHLQIHRHLQKKPLCF+Q QID LIW IQSRADILKRA R+SSTYWTLNYLKKL K 
Sbjct: 841 DLINHLQIHRHLQKKPLCFSQVQIDRLIWPIQSRADILKRAGRNSSTYWTLNYLKKLKKL 900

Query: 901 DPGRTYDVMITSVPQNGFAGCVFPSLSFARGTLKLQPKAKYYPMIGDIVKDCKISKIDCL 960
           DP +TYDVMIT+VPQNGF  CVFP LSFARGTLKL P AK+YPMIGDIVK+CKI +IDCL
Sbjct: 901 DPEKTYDVMITAVPQNGFVSCVFPDLSFARGTLKLHPSAKHYPMIGDIVKNCKILRIDCL 960

Query: 961 EGMLELEKL 969
           EGMLELE L
Sbjct: 961 EGMLELETL 969

>Suva_13.477 Chr13 complement(824387..827296) [2910 bp, 969 aa] {ON}
           YMR287C (REAL)
          Length = 969

 Score = 1545 bits (4000), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 737/969 (76%), Positives = 829/969 (85%)

Query: 1   MVARGNAHILLIARSFHSCGPCFRVTTRGXXXXXXXXXXXXXXFDYTQLLDNEQVIESGA 60
           MV RGN   L IARSFH+  PCFRVT R               FDYT L   ++V ++  
Sbjct: 1   MVVRGNPQALRIARSFHAYRPCFRVTIRNERQRSKNNQKEKALFDYTALFKKDKVKDTAI 60

Query: 61  NGSVGTEKDIESINKDFLQRTKGLEPDIELKQLSQIKEEFYQRYKDRYIKPSEAWYTNTW 120
              V  EK+IESIN+DFL R KGLEPDIELKQL QIKEEFY+RY+DRY+ PSE+WY+N+W
Sbjct: 61  TRPVENEKEIESINEDFLHRIKGLEPDIELKQLYQIKEEFYKRYRDRYVVPSESWYSNSW 120

Query: 121 RSLTKPKISFHKLINSDVQLDTKLKDLDPMEFQPAQLMENPLNVGDLVLLKVKPNELAMC 180
           RSLTKPKI  +KLIN D+  DTKL+    MEFQPAQLM+NPLNVGDLVLLK +PNELAMC
Sbjct: 121 RSLTKPKIPSYKLINLDIHFDTKLESSKQMEFQPAQLMKNPLNVGDLVLLKSRPNELAMC 180

Query: 181 VSLPSSTMDPRYTFVAIDGTMCFATKNRVLLRIPHKLPVGVNSLIQPEGHHKHLPIGTLK 240
           VSLPSSTMDPRYTF +IDG+M FATKNRVLLRIP KLP G++SL+QPE HHKHLPIGT+K
Sbjct: 181 VSLPSSTMDPRYTFASIDGSMSFATKNRVLLRIPQKLPTGIDSLVQPEDHHKHLPIGTVK 240

Query: 241 NISNQTNILPIVTRQLITSRYPAQISKLAWKCLPITTKKLQLLHRSLQNYMGPWQIPFFT 300
           N SNQT+ILPIV RQ+ITS+ PAQISKLAWK LPITTKKLQLLHRSLQNYMGPWQIPFFT
Sbjct: 241 NFSNQTSILPIVARQMITSKSPAQISKLAWKHLPITTKKLQLLHRSLQNYMGPWQIPFFT 300

Query: 301 LVGLVQKLDLNKALDGKYGIDYLTDLVNNYHTADNVAINSPTFVSTYWAILQQQESNLWG 360
           LVGLVQKLDLNKALD K G++YL DLVN+Y +AD+V +NS TFVSTYWAI+QQQESNLWG
Sbjct: 301 LVGLVQKLDLNKALDNKNGVNYLADLVNSYKSADSVPMNSATFVSTYWAIVQQQESNLWG 360

Query: 361 EIHLNTALLSPISVTIVPLKSQHLYYAQVIEKLEANSYKEVNTFVKLVNERKYRDISNLY 420
           +IHLNTALLSP SVTI+PLKS+HLYYAQVIEKLEA++YK+++ FVKLVNERKYRDIS+LY
Sbjct: 361 KIHLNTALLSPTSVTIIPLKSRHLYYAQVIEKLEADNYKDIDRFVKLVNERKYRDISSLY 420

Query: 421 PSVIQLLKDFAAGNFHNNGIIVTLISKIFRKIVRYKDYDITRDVCQDLINEIVXXXXXXX 480
           PSVIQLLKDFAAGNFHNNGIIVTLISKIFRKI  YK  DITRD+CQDL+NEI+       
Sbjct: 421 PSVIQLLKDFAAGNFHNNGIIVTLISKIFRKIELYKGSDITRDICQDLVNEILPNKMINP 480

Query: 481 XXXXXXXXXXXXSKLMESQQKLYYLTNIEDLQRENSGNDSDRYDFGDLRVFCIDSDTAHE 540
                       SKL +SQQKLY LTNIE++QR+NS  + DRYDFGDL+VFCIDS+TAHE
Sbjct: 481 LLLNMDLALPASSKLGQSQQKLYELTNIENMQRKNSNINGDRYDFGDLKVFCIDSETAHE 540

Query: 541 IDDGVSVENHGKDGMYTLHIHIADPTSMFPESTAIDSVGISTDILNIAFKRSFTTYLPDV 600
           IDDGVS+ENH KDG+YTLHIHIADP S+FPEST I+S GI+TD+LN+A KRSFTTYLPD+
Sbjct: 541 IDDGVSIENHKKDGLYTLHIHIADPASLFPESTDIESQGITTDVLNVALKRSFTTYLPDL 600

Query: 601 VVPMLPQAICHLSDLGKHGKRTKTISFSVDVKVGYQGCGKSLEIMYDSFRIRKGFVSNFP 660
           VVPMLP++IC LSDLGK G++T+T+SFSVDVKV  +  GK +EI+Y+S +IRKG VSNFP
Sbjct: 601 VVPMLPESICDLSDLGKQGQKTRTLSFSVDVKVLPKSTGKPIEIIYNSLKIRKGIVSNFP 660

Query: 661 KATYDDVDKILSAPDNESSPVKADLESLSMISKLLREQRIKKNNAVIFGEGFNKGMVTLN 720
           KATY+DVD+ILS  D+E+ P K DLESLSMISKLLRE RIKKNNAVIFGEGFN+G+VTLN
Sbjct: 661 KATYNDVDRILSITDSEAPPFKEDLESLSMISKLLRELRIKKNNAVIFGEGFNRGLVTLN 720

Query: 721 ANAEGELTEVSFSNQEETPSTVLVSEMMILANTLTGRYFAENNIGGVFRCYKQLPLDLIA 780
            N EGELTEVSFS+Q ETPSTVLVSEMMILANTL GR+FAEN I GVFRCYKQLPLD IA
Sbjct: 721 TNKEGELTEVSFSDQAETPSTVLVSEMMILANTLVGRFFAENKISGVFRCYKQLPLDAIA 780

Query: 781 QQQYDSMITGTKKGLFPKLRDIVKLSSLLNSSFYTGRPFRHEMIGAKQYLTVTSPLRRFP 840
           QQQY+S+IT  KKG+FPKL DI KLSSLLNSSFYTG+PFRHEMIGA QYLTVTSPLRRFP
Sbjct: 781 QQQYNSLITSAKKGVFPKLEDITKLSSLLNSSFYTGQPFRHEMIGANQYLTVTSPLRRFP 840

Query: 841 DLINHLQIHRHLQKKPLCFTQTQIDSLIWSIQSRADILKRASRDSSTYWTLNYLKKLAKS 900
           DLINHLQIHRHLQKKPLCF+Q QID LIW IQSRADILK ASR+SSTYWTLNYLK + KS
Sbjct: 841 DLINHLQIHRHLQKKPLCFSQAQIDRLIWPIQSRADILKTASRNSSTYWTLNYLKTMMKS 900

Query: 901 DPGRTYDVMITSVPQNGFAGCVFPSLSFARGTLKLQPKAKYYPMIGDIVKDCKISKIDCL 960
           +P +TYDVMITSVPQNGFAGCVFP LSFARGTLKL P  ++YPMIGD VK CKI KIDCL
Sbjct: 901 NPEKTYDVMITSVPQNGFAGCVFPDLSFARGTLKLNPSTEHYPMIGDTVKTCKILKIDCL 960

Query: 961 EGMLELEKL 969
           EG+LELEKL
Sbjct: 961 EGILELEKL 969

>TDEL0B00220 Chr2 complement(40373..43180) [2808 bp, 935 aa] {ON}
           Anc_8.853 YMR287C
          Length = 935

 Score =  863 bits (2230), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/904 (48%), Positives = 601/904 (66%), Gaps = 24/904 (2%)

Query: 68  KDIESINKDFLQRTKGLEPDIELKQLSQIKEEFYQRYKDRYIKPSEAWYTNTWRSLTKPK 127
           +DIE IN  FL RTK LEP +E+KQL QI  EF  R+  RY +PS+ W+   W  L + K
Sbjct: 51  EDIERINLQFLSRTKDLEPGMEVKQLPQIGREFRDRFDARYYEPSKIWFEKNW--LNRTK 108

Query: 128 ISFHKLINSDVQLDTKLKDLDPMEFQPAQLMENPLNVGDLVLLKVKPNELAMCVSLPSST 187
            S   L     + DTK    +  +++ + LM  PL+VGDLVLLK  P+EL+MC+ +PSST
Sbjct: 109 FSRKMLNAVPRKEDTK----EVFQYKASALMAKPLDVGDLVLLKSHPSELSMCIDVPSST 164

Query: 188 MDPRYTFVAIDGTMCFATKNRVLLRIPHKLPVGVN---SLIQPEGHHKHLPIGTLKNISN 244
            DPRY F  +DG++ F +++ VL+RIPH LP  ++   +L+  E  H   PIGT+KN +N
Sbjct: 165 KDPRYCFTTVDGSLKFGSRSLVLMRIPHSLPQELSKMAALLVREAKHGFEPIGTIKNQAN 224

Query: 245 QTNILPIVTRQLITSRYPAQISKLAWKCLPITTKKLQLLHRSLQNYMGPWQIPFFTLVGL 304
           +T +LP++ RQL+TS    +ISK AW  LP+T KKL+LLHR LQ+  GP  +PFF LV +
Sbjct: 225 ETLVLPVIARQLVTSCVTQRISKSAWDQLPVTIKKLELLHRRLQDSTGPVPVPFFDLVMM 284

Query: 305 VQKLDLNKALDGKYGIDYLTDLVNNYHTADNVAINSPTFVSTYWAILQQQESNLWGEIHL 364
           +Q LD+ KA+  + G  Y+ D++ N  T     I+S   ++TYWAI  QQ+++L+G+I +
Sbjct: 285 IQSLDITKAISNRDGEPYIRDVIENSRTGSTSTIDSSCALATYWAIEAQQKNHLFGDIQI 344

Query: 365 NTALLSPISVTIVPLKSQHLYYAQVIEKLEANSYKEVNTFVKLVNERKYRDISNLYPSVI 424
           + ALLSP+SV I+P  SQHL+Y+++ E+L++N  + +  F KL N+ KY +++  +P +I
Sbjct: 345 SGALLSPVSVLILPFASQHLFYSELKEQLKSNGQEAIQEFSKLANKGKYTELTTRFPHII 404

Query: 425 QLLKDFAAGNFHNNGIIVTLISKIFRKIVRYKDYDITRDVCQDLINEIVXXXXXXXXXXX 484
           Q+LK +AAGN HN+  IV+LI+ IFRKI  +KD DITRD C+ L++  +           
Sbjct: 405 QVLKGYAAGNLHNDEGIVSLIAAIFRKIDEFKDNDITRDACEKLLSRTLPQGTVENPIYA 464

Query: 485 XXXXXXXXSKLMESQQKLYYLTNIEDLQRENSGNDSD-RYDFGDLRVFCIDSDTAHEIDD 543
                   S      Q+  Y     DL +  S   ++ R+DF  LRV+CIDS+ AHEIDD
Sbjct: 465 NFTLGLPDSSARSRTQQQVY-----DLSKPASAQSTENRHDFKHLRVYCIDSEEAHEIDD 519

Query: 544 GVSVENHGKDGMYTLHIHIADPTSMFPESTAIDSVGISTDILNIAFKRSFTTYLPDVVVP 603
           G+S+E+ G +G YTLHIHIADP S+FPES + +  GI+ ++L +A +R FTTYLPDVV P
Sbjct: 520 GISIEDCG-NGKYTLHIHIADPASLFPESESSEQSGINDEVLKVAAERCFTTYLPDVVSP 578

Query: 604 MLPQAICHLSDLGKHGKRTKTISFSVDVKVGYQGCGKSLEIMYDSFRIRKGFVSNFPKAT 663
           MLPQ    + DLG  GK+TKTI+FSVDV V       +++I +DS++IR G VSNFPK T
Sbjct: 579 MLPQTFTTVCDLGHQGKKTKTITFSVDVLVK----DGAIKIFFDSYKIRLGLVSNFPKVT 634

Query: 664 YDDVDKILSAPDNESSPVKADLESLSMISKLLREQRIKKNNAVIFGEGFNKGMVTLNANA 723
           Y+ VD+ LS P N +  +  DL+ +  I+++LRE RI+K+ A++FG GFN+G+V ++   
Sbjct: 635 YETVDRYLSEPKNVNEEILYDLKLMHKIAEILREARIQKDGAIVFGSGFNQGLVAVSPVD 694

Query: 724 EGELTEVSFSNQEETPSTVLVSEMMILANTLTGRYFAENNIGGVFRCYKQLPLDLIAQQQ 783
           +    E+SF +Q+E+ ST+LVSE MILAN+L GR+FAE  I G+FR Y+ L L   A Q+
Sbjct: 695 Q----EISFFDQKESKSTLLVSEFMILANSLAGRFFAEKEIPGIFRTYQPLTLRGQADQE 750

Query: 784 YDSMITGTKKGLFPKLRDIVKLSSLLNSSFYTGRPFRHEMIGAKQYLTVTSPLRRFPDLI 843
           Y+ M    KKG+ P  +DI  LSSLLNSSFY   P  H MIGA QYLTVTSPLRRFPD+I
Sbjct: 751 YERMKKSVKKGILPTTKDINMLSSLLNSSFYCEYPTAHAMIGASQYLTVTSPLRRFPDII 810

Query: 844 NHLQIHRHLQKKPLCFTQTQIDSLIWSIQSRADILKRASRDSSTYWTLNYLKKLAKSDPG 903
           NHLQIHR L+  PLCFT+  +  ++W IQ R   LK+AS   ++YWTL Y+K L +  P 
Sbjct: 811 NHLQIHRVLRNLPLCFTEDALSKMLWHIQLRDAALKKASAHQASYWTLKYIKNLIRDTPH 870

Query: 904 RTYDVMITSVPQNGFAGCVFPSLSFARGTLKLQPKAKYYPMIGDIVKDCKISKIDCLEGM 963
           + +DV ITSVPQ   A CV  +   ARG LKL+P A   P +GD VK CK+SKIDCL+ +
Sbjct: 871 QRFDVTITSVPQLNVARCVLANFPSARGVLKLKPSATNIPTVGDTVKGCKVSKIDCLDSL 930

Query: 964 LELE 967
           LELE
Sbjct: 931 LELE 934

>SAKL0D01078g Chr4 (78360..81170) [2811 bp, 936 aa] {ON} similar to
           uniprot|P39112 Saccharomyces cerevisiae YMR287C MSU1
           RNase component of the mitochondrial degradosome along
           with the ATP-dependent RNA helicase Suv3p the
           degradosome associates with the ribosome and mediates
           turnover of aberrant or unprocessed RNAs
          Length = 936

 Score =  854 bits (2206), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/933 (47%), Positives = 611/933 (65%), Gaps = 53/933 (5%)

Query: 67  EKDIESINKDFLQRTKGLEPDIELKQLSQIKEEFYQRYKDRYIKPSEAWYT-NTWRSLTK 125
           ++  +++ K F    K LEP++E+KQLSQ++++   RY  RY  PS+ W+T N  R+   
Sbjct: 21  DRSKDNLEKIFFSHAKDLEPEVEIKQLSQVRQDSDNRYYHRYFTPSKIWFTQNVSRTQ-- 78

Query: 126 PKISFHKLINSDVQ----------LDTKLKDLDPMEF--QPAQLMENPLNVGDLVLLKVK 173
              SF    N D Q          L+ +L D     F   P+ LM  PL +GDLVLL+  
Sbjct: 79  ---SFKHFFNLDPQRSSDKYILPTLNERLYDKGSHTFYLSPSDLMNTPLKIGDLVLLRSN 135

Query: 174 PNELAMCVSLPSSTMDPRYTFVAIDGTMCFATKNRVLLRIPHKLPVGVNSLIQPEGHHKH 233
           P +L+MCV LP+  MDPRYTF ++DG + FA +  ++LRIP      ++ L+Q E  H +
Sbjct: 136 PTQLSMCVDLPTDIMDPRYTFASMDGGLQFAARTMIMLRIPSCHKQELDGLVQLERKHSY 195

Query: 234 LPIGTLKNISNQTNILPIVTRQLITSRYPAQISKLAWKCLPITTKKLQLLHRSLQNYMGP 293
            PIG +KN    T +LPI+ RQLITS  P +I+K AW  +PI +KKL+LLHR LQ   GP
Sbjct: 196 EPIGVVKNSPTHTYVLPILARQLITSYVPFEITKKAWNQVPIVSKKLELLHRFLQRSTGP 255

Query: 294 WQIPFFTLVGLVQKLDLNKALDGKYGI--DYLTDLVN--------------NYHTADNVA 337
           WQI  FTL  LVQ LDL +AL  + G   DY++ L                N H      
Sbjct: 256 WQISIFTLCELVQNLDLQRALSKQDGSLQDYMSSLFQKVGLDSNLYCLGEQNLHVNPPNK 315

Query: 338 INSPTFVSTYWAILQQQESNLWGEIHLNTALLSPISVTIVPLKSQHLYYAQVIEKLEANS 397
           I++  F+STYW++++QQE  +WG I  +  +L+PISVT++PL S+HLYY  V+  L+ ++
Sbjct: 316 IDASYFLSTYWSLVKQQELQIWGGIQTHRGILTPISVTVLPLNSEHLYYENVVSTLKQDN 375

Query: 398 YKEVNTFVKLVNERKYRDISNLYPSVIQLLKDFAAGNFHNNGIIVTLISKIFRKIVRYKD 457
           Y+ ++ F +LVN++ Y+ I N +P +IQ+LK++AAGNF+NNG ++TL+SKIFRK+  YK+
Sbjct: 376 YRMLDEFAELVNKKNYKPIQNRFPQLIQILKNYAAGNFNNNGAMITLVSKIFRKLHTYKE 435

Query: 458 YDITRDVCQDLINEIVXXXXXXXXXXXXXXXXXXXSKLMESQQKLYYLTNIEDLQRENSG 517
            D TRD+C +L+ +I                    S+    +Q +Y      D+ +    
Sbjct: 436 RDTTRDMCHELLTQISPDKLINPLLLNKDLGLPMASQRSALEQVVY------DISKPPLT 489

Query: 518 NDSD--RYDFGDLRVFCIDSDTAHEIDDGVSVENHGKDGMYTLHIHIADPTSMFPESTAI 575
            D    R+DFGD+ V+CIDS+TAHEIDDG+S+E    +  Y LHIHIADP S F +ST  
Sbjct: 490 EDDSYVRHDFGDMPVYCIDSETAHEIDDGISIETLS-EKKYRLHIHIADPASSFAKSTDP 548

Query: 576 DSVGISTDILNIAFKRSFTTYLPDVVVPMLPQAICHLSDLGKHGKRTKTISFSVDVKVGY 635
           ++     D+L+IAF+RSFTTYLPD+V+PMLP++ C  +DLGK G +TKT+SFS+D+   +
Sbjct: 549 EA---RDDVLDIAFQRSFTTYLPDMVLPMLPESYCRAADLGKDGNKTKTLSFSIDIYF-H 604

Query: 636 QGCGKSLEIMYDSFRIRKGFVSNFPKATYDDVDKILSAPDNESSPVKA-DLESLSMISKL 694
           QG   +L ++ D+F++R G VS FP+ TY+ VD +L  P  E  P +A DL+ +  ++K 
Sbjct: 605 QG---TLRLLDDTFKMRLGLVSRFPRVTYEKVDILLQYP--EKQPKEASDLKLMYEVAKS 659

Query: 695 LREQRIKKNNAVIFGEGFNKGMVTLNANAEGELTEVSFSNQEETPSTVLVSEMMILANTL 754
           LR +R+K  +A+IFGEGFNKG+V L+ +  GELT++SF +Q E+ STVLVSEMMILANTL
Sbjct: 660 LRAKRVKNQDAIIFGEGFNKGLVKLSPDETGELTKISFEDQVESKSTVLVSEMMILANTL 719

Query: 755 TGRYFAENNIGGVFRCYKQLPLDLIAQQQYDSMITGTKKGLFPKLRDIVKLSSLLNSSFY 814
           TG YF +N I GVFRCY +L L   A ++Y  M   TK G FP +RDI  +SSLLNSSFY
Sbjct: 720 TGGYFKKNKIPGVFRCYNELQLKDRALKEYTKMKEMTKSGQFPTIRDINTISSLLNSSFY 779

Query: 815 TGRPFRHEMIGAKQYLTVTSPLRRFPDLINHLQIHRHLQKKPLCFTQTQIDSLIWSIQSR 874
           TG+P +HEMIGA +YLTVTSPLRRFPD+INHLQIHRHL+  PLCF+Q ++D + W IQSR
Sbjct: 780 TGKPKKHEMIGASEYLTVTSPLRRFPDMINHLQIHRHLRGLPLCFSQQEVDGITWHIQSR 839

Query: 875 ADILKRASRDSSTYWTLNYLKKLAKSDPGRTYDVMITSVPQNGFAGCVFPSLSFARGTLK 934
             +LK A+R S+TYWTL +LK   +      + VM+TSVP  G   C FP+L+ ARGTL 
Sbjct: 840 DVVLKNAARMSATYWTLKFLKNELEKKKDIRFTVMVTSVPHMGTVSCAFPNLNAARGTLN 899

Query: 935 LQPKAKYYPMIGDIVKDCKISKIDCLEGMLELE 967
           L PK   YP IGD++  CK++K+DCL+G++ELE
Sbjct: 900 LDPKHTPYPAIGDLIHKCKLTKLDCLDGVIELE 932

>ZYRO0C14938g Chr3 complement(1159657..1162557) [2901 bp, 966 aa]
           {ON} similar to uniprot|P39112 Saccharomyces cerevisiae
           YMR287C MSU1 RNase component of the mitochondrial
           degradosome along with the ATP-dependent RNA helicase
           Suv3p the degradosome associates with the ribosome and
           mediates turnover of aberrant or unprocessed RNAs
          Length = 966

 Score =  849 bits (2194), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/910 (48%), Positives = 604/910 (66%), Gaps = 21/910 (2%)

Query: 66  TEKDIESINKDFLQRTKGLEPDIELKQLSQIKEEFYQRYKDRYIKPSEAWYTNTWRSLTK 125
           +++DI+ IN  FL RTK LEP +E+K L++IK+EFY RY  RY+ P  +W+  + +++  
Sbjct: 69  SQEDIDRINYMFLSRTKDLEPGVEVKDLNRIKQEFYSRYGARYLNPCNSWFQRSEQNILG 128

Query: 126 PKISFHKLINSDVQLDTKLKDLDPMEFQPAQLMENPLNVGDLVLLKVKPNELAMCVSLPS 185
              S   LIN+D +    +K+   ++F P +LM  PL +GDLVLLK +  +L MC+ +PS
Sbjct: 129 KSFS-RSLINADPEA-LGIKNKRFLKFDPKELMSRPLQIGDLVLLKHQSPQLCMCIDVPS 186

Query: 186 STMDPRYTFVAIDGTMCFATKNRVLLRIPHKLPVGVNSLIQPEGHHKHLPIGTLKNISNQ 245
           ST DPRYTF  +DGT+ F+T+N+VL+RIPH LP     L+  E  H   P+G +KN + +
Sbjct: 187 STRDPRYTFTTVDGTIIFSTRNKVLMRIPHHLPNV--PLLMKEMKHGFEPVGCVKNTTTE 244

Query: 246 TNILPIVTRQLITSRYPAQISKLAWKCLPITTKKLQLLHRSLQNYMGPWQIPFFTLVGLV 305
           T ILPIV RQ ITS    QISK AW+ +P T KKL+LLHR LQ+  GPWQ+PF  LV +V
Sbjct: 245 TFILPIVPRQQITSPISHQISKRAWEEMPFTLKKLELLHRHLQDARGPWQVPFMNLVSMV 304

Query: 306 QKLDLNKALDGKYGIDYLTDLVNNYHTADNVAINSPTFVSTYWAILQQQESNLWGEIHLN 365
           +KLD+  A     G  Y+ DL+          ++S  F+S Y AI  QQ+S+LWG IH +
Sbjct: 305 EKLDMQLASASNTGAAYVEDLIRTCTFEPQAKLDSAIFLSVYCAIENQQQSHLWGNIHSS 364

Query: 366 TALLSPISVTIVPLKSQHLYYAQVIEKLEANSYKEVNTFVKLVNERKYRDISNLYPSVIQ 425
            ALLSP+SVT++PL+SQHLY+  V++ L+  +Y+ V+ F +LV+  KY +    YP +++
Sbjct: 365 RALLSPVSVTVMPLRSQHLYHRSVLQNLKVRNYEAVSKFARLVDTGKYNEAIMEYPEIVK 424

Query: 426 LLKDFAAGNFHNNGIIVTLISKIFRKIVRYKDYDITRDVCQDLINEI-VXXXXXXXXXXX 484
           LL+D+AAGNF+N+   ++++SKIFRKI R+++ DITRD+C  L+ E+             
Sbjct: 425 LLQDYAAGNFYNDATAISVVSKIFRKIQRFQEEDITRDICHQLLKELDSSQTTRNPLHYN 484

Query: 485 XXXXXXXXSKLMESQQKLYYLTNIEDLQRENSGNDSD-RYDFGDLRVFCIDSDTAHEIDD 543
                   S    S+Q +Y L +    +    G D + R+DFGD++V+CIDS+TAHEIDD
Sbjct: 485 LDLGLPSSSLRSSSEQDIYNLAHPVTFE----GQDKNLRHDFGDMKVYCIDSETAHEIDD 540

Query: 544 GVSVENHGKDGMYTLHIHIADPTSMFPESTAIDSVGISTDILNIAFKRSFTTYLPDVVVP 603
           GVS+E+H  D   TLHIHIADP S F E     + GI ++IL IA  +SFTTYLPD++ P
Sbjct: 541 GVSIESHS-DVKRTLHIHIADPASFFRECQE-GTHGIESEILQIALNKSFTTYLPDLMSP 598

Query: 604 MLPQAICHLSDLGKHGKRTKTISFSVDVKVGYQGCGKSLEIMYDSFRIRKGFVSNFPKAT 663
           MLP +    +DLGK G++ KTI+FSVD      G     ++  +SFRI+ G VSNFP+ T
Sbjct: 599 MLPGSYSKAADLGKQGQKAKTITFSVDGSWIKNG---QFQLQPESFRIKLGLVSNFPQVT 655

Query: 664 YDDVDKIL---SAPDNESSPVKAD---LESLSMISKLLREQRIKKNNAVIFGEGFNKGMV 717
           Y+ VD +L   S   N S+ +  D   L+ L  IS+ LR  RI    AV+FG  FNKG V
Sbjct: 656 YNTVDSMLAQASEVKNGSANLTDDQRNLKELYAISQNLRANRINTQQAVVFGSEFNKGQV 715

Query: 718 TLNANAEGELTEVSFSNQEETPSTVLVSEMMILANTLTGRYFAENNIGGVFRCYKQLPLD 777
            L+ +  G L +VSF +Q ETPS+VLVSEMMILANTL+G++F +NN+ GVFRCY+ L L 
Sbjct: 716 ALSPDENGVLQKVSFKDQLETPSSVLVSEMMILANTLSGQFFKDNNLPGVFRCYQPLALG 775

Query: 778 LIAQQQYDSMITGTKKGLFPKLRDIVKLSSLLNSSFYTGRPFRHEMIGAKQYLTVTSPLR 837
             AQ +Y+ + +  K+G     +DI  +S++LNSSFY+   +RHEMIGA  YLTVTSPLR
Sbjct: 776 PQAQNEYELLKSKIKEGKSLTFKDICMISTILNSSFYSSDGYRHEMIGAPHYLTVTSPLR 835

Query: 838 RFPDLINHLQIHRHLQKKPLCFTQTQIDSLIWSIQSRADILKRASRDSSTYWTLNYLKKL 897
           RFPD+INHLQIHR L+  PLCF +  +D  +W IQSR  ILK ASR S+TYWTL YLK+L
Sbjct: 836 RFPDMINHLQIHRLLKGLPLCFNKDDVDRFVWHIQSRDSILKDASRCSNTYWTLKYLKQL 895

Query: 898 AKSDPGRTYDVMITSVPQNGFAGCVFPSLSFARGTLKLQPKAKYYPMIGDIVKDCKISKI 957
            ++D  + + VMI SVPQ GF  CV P  S AR TLKL+P    +P+IGDI+++C+I+KI
Sbjct: 896 VENDKNKKFSVMINSVPQVGFVRCVLPDYSSARATLKLKPNEISHPVIGDIIENCRITKI 955

Query: 958 DCLEGMLELE 967
           D LEG+LE+E
Sbjct: 956 DALEGLLEME 965

>KNAG0E01140 Chr5 complement(222456..225245) [2790 bp, 929 aa] {ON}
           Anc_8.853 YMR287C
          Length = 929

 Score =  834 bits (2154), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/898 (48%), Positives = 583/898 (64%), Gaps = 22/898 (2%)

Query: 69  DIESINKDFLQRTKGLEPDIELKQLSQIKEEFYQRYKDRYIKPSEAWYTNTWRSLTKPKI 128
           DIE IN+ FL RTK LEP +E+K+L QIK+EF  R+ +RY  PS+ W+ + W  + +P  
Sbjct: 51  DIERINEMFLSRTKDLEPGMEIKKLKQIKKEFNTRFAERYFNPSKQWFQDNW--VVEPST 108

Query: 129 SFHKLINSDVQLDTKLKDLDPMEFQPAQLMENPLNVGDLVLLKVKPNELAMCVSLPSSTM 188
           +     +S   +  K K      F+ ++ + + L +GDLVL    PNELAMCV LP S  
Sbjct: 109 NTAGKSSSQNSMTGKNKH---YTFKLSEFISSVLQMGDLVLTTPYPNELAMCVGLPESAE 165

Query: 189 DPRYTFVAIDGTMCFATKNRVLLRIPHKLPVGVNSLIQPEGHHKHLPIGTLKNISNQTNI 248
           DPRYTFV + G M F TK+ V LRIP++LP  V  LI  EG H   P+GT+K   + T I
Sbjct: 166 DPRYTFVTVSGKMFFGTKSFVHLRIPYRLPEKVRYLISKEGPHAFEPVGTIKGTRDVTYI 225

Query: 249 LPIVTRQLITSRYPAQISKLAWKCLPITTKKLQLLHRSLQNYMGPWQIPFFTLVGLVQKL 308
           LP + RQL+TS  P+QI+KLAW+ LP   K+L+LL R L+ Y G WQ+PF  LV  VQ+L
Sbjct: 226 LPYLARQLVTSELPSQINKLAWQKLPSIIKRLELLSRYLRKYNGTWQVPFVQLVDAVQRL 285

Query: 309 DLNKALDGKYGIDYLTDLVNNYHTADNVAINSPTFVSTYWAILQQQESNLWGEIHLNTAL 368
           +  K   G++  +Y+  L          +I++ T+++TYWAI +QQ  N+WG+IH+N A 
Sbjct: 286 E-EKGGPGEF--EYIKSLFERPSLGSRRSIHAATYLATYWAIKEQQNFNIWGKIHVNKAF 342

Query: 369 LSPISVTIVPLKSQHLYYAQVIEKLEANSYKEVNTFVKLVNERKYRDISNLYPSVIQLLK 428
           L+PIS ++VP  S   ++ ++I   +    K VN    L+N + Y  +   YP  +QLL 
Sbjct: 343 LAPISTSVVPAASLRSFHDELINDPKR---KHVNKITDLINTKDYELVRERYPEFLQLLS 399

Query: 429 DFAAGNFHNNGIIVTLISKIFRKIVRYKDYDITRDVCQDLINEIVXXXXXXXXXXXXXXX 488
           DF AGNF NN  +VTLIS+IFR +  Y++ ++TRD C DL+ EI                
Sbjct: 400 DFTAGNFDNNCEVVTLISQIFRMLDVYRECNVTRDTCFDLLKEISEDNFCENPILSNSDL 459

Query: 489 XXXXSKLMESQQKLYYLTNIEDLQRENSGNDSDRYDFGDLRVFCIDSDTAHEIDDGVSVE 548
               S    + QK  Y     D+Q +     + R+DF D+ V+CIDS+TAHEIDDGVS+E
Sbjct: 460 ALAQSSERSALQKCVYSVVQPDIQLDTK---TKRHDFLDMPVYCIDSETAHEIDDGVSIE 516

Query: 549 NHGKDGMYTLHIHIADPTSMFPESTAIDSVGISTDILNIAFKRSFTTYLPDVVVPMLPQA 608
            +GK G YTLH+HIADP S FPES   +S  +S D+L IAF +SFTTYLPDVV  MLP++
Sbjct: 517 KNGK-GSYTLHVHIADPASFFPESYT-ESTKLS-DVLKIAFDKSFTTYLPDVVEAMLPES 573

Query: 609 ICHLSDLGKHGKRTKTISFSVDVKVGYQGCGKSLEIMYDSFRIRKGFVSNFPKATYDDVD 668
            C  +DLGK  K+T+TI+FSV VK+   G    L I  D+FR R G VSNFPK TY+ VD
Sbjct: 574 FCRAADLGKQDKKTRTITFSVRVKMDEHG---GLHIQSDTFRARLGLVSNFPKVTYNIVD 630

Query: 669 KILSAPDNESSPVKADLESLSMISKLLREQRIKKNNAVIFGEGFNKGMVTLNANAEGELT 728
            +L+   + +SP++ DL +L  I+  LR  R+K N AV+FGEGFN G V L  ++  ++ 
Sbjct: 631 SVLND-SSSNSPLRQDLLTLYKIASGLRHNRVKLNGAVVFGEGFNNGQVRLIRDSANKVK 689

Query: 729 EVSFSNQEETPSTVLVSEMMILANTLTGRYFAENNIGGVFRCYKQLPLDLIAQQQYDSMI 788
           +++F N  ETPSTVLVSE+MILANTL+G +F EN I G+FRCY +L LD  A   Y S+ 
Sbjct: 690 DITFENNNETPSTVLVSELMILANTLSGNFFRENKIPGIFRCYNELKLDGKALSDYRSIQ 749

Query: 789 TGTKKGLFPKLRDIVKLSSLLNSSFYTGRPFRHEMIGAKQYLTVTSPLRRFPDLINHLQI 848
              ++G  P L+DI K++SL+NSSFY+G P  H+MIGAKQYLTVTSPLRR+PDLINH+Q+
Sbjct: 750 DNVQRGKNPTLKDIAKITSLMNSSFYSGEPRNHQMIGAKQYLTVTSPLRRYPDLINHIQL 809

Query: 849 HRHLQKKPLCFTQTQIDSLIWSIQSRADILKRASRDSSTYWTLNYLKKLAKSDPGRTYDV 908
           H+HL  KPL F+Q  ID +IW +QSRADILK  S   S YWTL YLKK  + D    +DV
Sbjct: 810 HKHLANKPLTFSQQAIDQMIWQVQSRADILKSISTTVSAYWTLTYLKKRIEKDSSARFDV 869

Query: 909 MITSVPQNGFAGCVFPSLSFARGTLKLQPKAKYYPMIGDIVKDCKISKIDCLEGMLEL 966
           M+TS PQ+G   C+FP+ S+ARG LKL+   +  P IGDIVKDC+I+ IDCL+  L+L
Sbjct: 870 MVTSFPQDGMVNCLFPNHSYARGKLKLKVD-RLPPQIGDIVKDCQITSIDCLDSNLQL 926

>CAGL0M07051g Chr13 complement(716775..719546) [2772 bp, 923 aa]
           {ON} similar to uniprot|P39112 Saccharomyces cerevisiae
           YMR287c MSU1
          Length = 923

 Score =  816 bits (2109), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/912 (47%), Positives = 591/912 (64%), Gaps = 30/912 (3%)

Query: 70  IESINKDFLQRTKGLEPDIELKQLSQIKEEFYQRYKDRYIKPSEAWYTNTWRS------- 122
           +E+  K++L RTKGLEPD E++QL QI   F +RY+ RY++PS+ W+   W++       
Sbjct: 21  LENSVKNYLARTKGLEPDFEIRQLPQIISGFNKRYRARYLEPSQRWFKADWKASDHGEDK 80

Query: 123 ---LTKPKISFHKLINSDVQLDT--KLKDLDPMEFQPAQLMENPLNVGDLVLLKVKPNEL 177
              L +P++    +INSD       + +    + F PA+L+   LNVGD+VLLK   +EL
Sbjct: 81  ATRLLRPEVFDKFIINSDFHRGNMEQYQKAQKLSFDPAELLRTSLNVGDIVLLKQCTSEL 140

Query: 178 AMCVSLPSSTMDPRYTFVAIDGTMCFATKNRVLLRIPHKLPVGVNSLIQPEGHHKHLPIG 237
            MCV+LP ST DPRYTF   DGT+ +A KN V+LRIP  LP  VN L++ E +H +  IG
Sbjct: 141 TMCVNLPQSTTDPRYTFAKKDGTLVYAMKNSVILRIPKDLPEEVNQLLKRESNHPYQKIG 200

Query: 238 TLKNISNQTNILPIVTRQLITSRYPAQISKLAWKCLPITTKKLQLLHRSLQNYMGPWQIP 297
           T+KN SN+T ILP++TRQLI S   A  +K AW  LPI  KKL+L+HR LQ+  G   + 
Sbjct: 201 TIKNSSNETEILPVLTRQLIVSFTLATFTKFAWTQLPIVLKKLELIHRYLQDSRGSKHVN 260

Query: 298 FFTLVGLVQKLDLNKALDGKYGIDYLTDLVNNYHTADNVAINSPTFVSTYWAILQQQESN 357
           F +LV +++ L++ +A D   G  Y+  +++   +  N +I+  T ++TYW + +QQ++N
Sbjct: 261 FMSLVRIIKNLNIKEATDAINGDAYVRKVIDESMSVVNKSIDPTTLLATYWGVREQQQNN 320

Query: 358 LWGEIHLNTALLSPISVTIVPLKSQHLYYAQVIEKLEANSYKEVNTFVKLVNERKYRDIS 417
           LWG ++ NTALLSP +V ++PLK  HL+Y +VI +LE+N Y+E+  F KLVN++ Y  I+
Sbjct: 321 LWGSVYTNTALLSPTTVAVLPLKKAHLFYQEVITRLESNDYQEIKAFAKLVNDKDYHSIA 380

Query: 418 NLYPSVIQLLKDFAAGNFHNNGIIVTLISKIFRKIVRYKDYDITRDVCQDLINEIVXXXX 477
             Y  +  LL D+AAGN   N ++ T+ISKIFR I  Y+D D+TR +C  L+ EI     
Sbjct: 381 KRYDYIRTLLNDYAAGNIEENAVLTTIISKIFRHIDMYRDQDVTRSLCGKLLVEISPQSN 440

Query: 478 XXXXXXXXXXXXXXXSKLMES-QQKLYYLTNIEDLQRENSGNDSDRYDFGDLRVFCIDSD 536
                          S  + S +QKLY      D       +D+DRYDFGD+ VFCIDS+
Sbjct: 441 SSNFILGNWDLNIPKSSGISSVEQKLY------DTAMPTIVSDTDRYDFGDMPVFCIDSE 494

Query: 537 TAHEIDDGVSVENHGKDGMYT-LHIHIADPTSMFPESTAIDSVGISTDILNIAFKRSFTT 595
            AHEIDDG+S+E    DG+ + +HIHIADP  +FPES      GIS D+L ++ KR+FTT
Sbjct: 495 DAHEIDDGISIEE--LDGVRSRIHIHIADPAGLFPESFDYTKSGISDDVLRVSLKRAFTT 552

Query: 596 YLPDVVVPMLPQAICHLSDLGKHGKRTKTISFSVDVKVGYQGCGKSLEIMYDSFRIRKGF 655
           YLPD+VVPMLP++ C+ +DLGKH ++T+TISFS ++     G    L + YD+F++R G 
Sbjct: 553 YLPDLVVPMLPKSFCNRADLGKHDRKTETISFSFELVNKEDG---GLHVDYDTFQVRLGI 609

Query: 656 VSNFPKATYDDVDKILSAPDNE-SSPVKADLESLSMISKLLREQRIKKNNAVIFGEGFNK 714
           VSNFPK TYD VD IL+  DN   S  K  LE L  ++  L  +RI  +NAV+FG+GFNK
Sbjct: 610 VSNFPKVTYDKVDSILNGDDNSLPSKQKKQLELLHTLATKLLHKRIHDDNAVVFGDGFNK 669

Query: 715 GMVTLNANAEGELTEVSFSNQEETPSTVLVSEMMILANTLTGRYFAENNIGGVFRCYKQL 774
           G+V+L+ + +GEL   +F +Q +T ST+LVSE MIL N L   +F EN I GV+RCY  L
Sbjct: 670 GLVSLSPDDDGELCIPTFYDQSQTKSTLLVSEFMILTNKLCAAFFQENKIPGVYRCYNGL 729

Query: 775 PLDLIAQQQYDSMITGTKKGLFPKLRDIVKLSSLLNSSFYTGRPFRHEMIGAKQYLTVTS 834
            L   A+ Q++ +    K G  P L+DI K+SS L+SSFY+  P  H+MIG   YLTVTS
Sbjct: 730 NLGNQAKAQFELLKENIKLGKLPSLKDITKISSQLSSSFYSPFPLPHKMIGNTAYLTVTS 789

Query: 835 PLRRFPDLINHLQIHRHLQKKPLCFTQTQIDSLIWSIQSRADILKRASRDSSTYWTLNYL 894
           P+RR PDLINHLQ+HR L+K PLCF Q  +D  +WS Q+RADILK   R SSTYWTL +L
Sbjct: 790 PMRRGPDLINHLQLHRFLKKLPLCFKQEYLDQYVWSFQARADILKIFQRHSSTYWTLKHL 849

Query: 895 KKLAKSDPGRTYDVMITSVPQNGFAGCVFPSLSFARGTLKLQPKAKYYPMIGDIVKDCKI 954
           ++       +T+DV++TSVPQNG   C+FP  S+ARGTLKL P  K  P IGD ++ CK+
Sbjct: 850 EQSGT----KTHDVIVTSVPQNGTVNCLFPEYSYARGTLKLDPAMKKIPRIGDTIRHCKV 905

Query: 955 SKIDCLEGMLEL 966
             I  L+G+L L
Sbjct: 906 ESIHPLDGILTL 917

>KAFR0L01970 Chr12 complement(372452..375250) [2799 bp, 932 aa] {ON}
           Anc_8.853 YMR287C
          Length = 932

 Score =  792 bits (2045), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/916 (44%), Positives = 589/916 (64%), Gaps = 27/916 (2%)

Query: 61  NGSVGT----EKDIESINKDFLQRTKGLEPDIELKQLSQIKEEFYQRYKDRYIKPSEAWY 116
           N S GT    +++I+ INK FL RT GLEPD+E+K+L+ I++++ +RY  R I PS+ WY
Sbjct: 34  NPSFGTTPLKKEEIKLINKLFLSRTSGLEPDLEIKELADIEKDYNERYLKRIIWPSKRWY 93

Query: 117 TNTWRSLTKPKISFHK----LINSDVQLDTKLKDLDPMEFQPAQLMENPLNVGDLVLLKV 172
            + W+  +   +   +    LIN       K  +   + F   +L+E+PL VGD+VLLK 
Sbjct: 94  EHDWKDRSTKILGMERFSKNLINGAKPNFNKRNE--GITFHTQELLESPLKVGDIVLLKS 151

Query: 173 KPNELAMCVSLPSSTMDPRYTFVAIDGTMCFATKNRVLLRIPHKLPVGVNSLIQPEGHHK 232
              EL+MCV+LP S  DPRYTF  I G + F+T++ + LRIP+ +P G+ +LI  E  H 
Sbjct: 152 NATELSMCVALPESADDPRYTFATIKGNLLFSTRSSINLRIPYSIPNGIANLITREIPHG 211

Query: 233 HLPIGTLKNISNQTNILPIVTRQLITSRYPAQISKLAWKCLPITTKKLQLLHRSLQNYMG 292
             PIG +K+  N+T ILP VTRQ ITS  P  +S +AW+ LP+T KKL++LHR LQN +G
Sbjct: 212 FNPIGVIKSSINETFILPTVTRQHITSLKPFTVSHIAWEELPLTIKKLEVLHRFLQNPLG 271

Query: 293 PWQIPFFTLVGLVQKLDLNKALDGKYGIDYLTDLVNNYHTADNVAINSPTFVSTYWAILQ 352
            +QIPFF LV LV  +D++   D KY    +  L++N        +++   +STYWAI++
Sbjct: 272 WYQIPFFQLVHLVDTIDMSSCNDRKY----MKTLIDNSKNDSYNNLDASRCLSTYWAIIE 327

Query: 353 QQESNLWGEIHLNTALLSPISVTIVPLKSQHLYYAQVIEKLEANSYKEVNTFVKLVNERK 412
           QQE+N+WG+I  N+  +SPISVT+ PLK+   +   ++   +     ++    +L+NE+ 
Sbjct: 328 QQETNMWGDIQRNSCSMSPISVTVNPLKAYQHFNDYLVCGTKQKDLDKIGQVTRLMNEKN 387

Query: 413 YRDISNLYPSVIQLLKDFAAGNFHNNGIIVTLISKIFRKIVRYKDYDITRDVCQDLINEI 472
           Y  I   YP  + +LKD+A+GN + N  +  LIS   RK+  YKD D+++ VC  L+ EI
Sbjct: 388 YTIIKEKYPEFMSMLKDYASGNLNQNSQVAVLISAFLRKLNYYKDMDVSKTVCYKLLQEI 447

Query: 473 -VXXXXXXXXXXXXXXXXXXXSKLMESQQKLYYLTNIEDLQRENSGNDSDRYDFGDLRVF 531
                                S L +S ++LY L   +         D+DR DFG+LRV+
Sbjct: 448 DPTQFFDNILLFNHDLNLSNSSNLGQSNKQLYALCGPQ------ISADADRVDFGNLRVY 501

Query: 532 CIDSDTAHEIDDGVSVENHGKDGMYTLHIHIADPTSMFPESTAIDSVGISTDILNIAFKR 591
           CIDS+TAHEIDDG+S+ N G +G+Y+L IHIADP+ +F  ++ I    ++ D+  +A ++
Sbjct: 502 CIDSETAHEIDDGISIINKG-NGIYSLSIHIADPSILFSGASEIQG-PLNDDVFKLAMEK 559

Query: 592 SFTTYLPDVVVPMLPQAICHLSDLGKHGKRTKTISFSVDVKVGYQGCGKSLEIMYDSFRI 651
           SFTTYLPD+V P+LP      +DLGK+G+ T  ++F+V+VK       ++L ++YD+F I
Sbjct: 560 SFTTYLPDIVEPLLPNTYSEAADLGKNGQVTNAMTFTVNVKTL---PDETLHVLYDTFDI 616

Query: 652 RKGFVSNFPKATYDDVDKILSAPDNESSPVKADLESLSMISKLLREQRIKKNNAVIFGEG 711
           +   + NFPK TY  V+KIL + D  +  VK DLE L  I++ LR  R+K   AV+FGEG
Sbjct: 617 KLSKIRNFPKVTYSRVNKILQSSDYSNPSVKQDLEDLHKIARALRNNRMKNGGAVVFGEG 676

Query: 712 FNKGMVTLNANAEGELTEVSFSNQEETPSTVLVSEMMILANTLTGRYFAENNIGGVFRCY 771
           FNKGM+      + E+  V F +QEETP+T+LVSE+MIL NTL G +F +NNI G++R Y
Sbjct: 677 FNKGMIEFFEEGQAEVKNVKFIDQEETPATLLVSELMILTNTLCGWFFKKNNIPGIYRSY 736

Query: 772 KQLPLDLIAQQQYDSMITGTKKGLFPKLRDIVKLSSLLNSSFYTGRPFRHEMIGAKQYLT 831
            +L L   A  +Y S+ + TK G+ P ++D+ ++SSL+NSS YT +P  HEMIGA+QYLT
Sbjct: 737 NKLLLGSKATMEYMSLQSSTKSGVSPSIKDMTRVSSLMNSSVYTSKPRMHEMIGAQQYLT 796

Query: 832 VTSPLRRFPDLINHLQIHRHLQKKPLCFTQTQIDSLIWSIQSRADILKRASRDSSTYWTL 891
           VTSPLRRFPDL+NH QIHR L+K P  F   ++ +LIW IQSRADILK+ SR  +TYWTL
Sbjct: 797 VTSPLRRFPDLLNHFQIHRFLKKLPFVFNDEKLQNLIWHIQSRADILKKMSRAINTYWTL 856

Query: 892 NYLKKLAKSDPGRTYDVMITSVPQNGFAGCVFPSLSFARGTLKLQPKAKYYPMIGDIVKD 951
            YL+K    +P + +DVMITSVP NG   C+FP +SFARG LKL+ K   YP+IGD V +
Sbjct: 857 EYLQKAIFENPNKRFDVMITSVPNNGVVNCLFPDMSFARGKLKLK-KGMPYPVIGDTVTN 915

Query: 952 CKISKIDCLEGMLELE 967
           C+I K++ L+G+L LE
Sbjct: 916 CRIVKLESLDGILYLE 931

>NCAS0C00300 Chr3 (39415..42237) [2823 bp, 940 aa] {ON} Anc_8.853
           YMR287C
          Length = 940

 Score =  785 bits (2028), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/905 (46%), Positives = 585/905 (64%), Gaps = 15/905 (1%)

Query: 69  DIESINKDFLQRTKGLEPDIELKQLSQIKEEFYQRYKDRYIKPSEAWYTNTW-RSLTKPK 127
           DI+ I + FL+RT  LEP+I+LK L QI  E+ +R+  RYI+PS+ WY   W  + TKP 
Sbjct: 46  DIKFIRESFLKRTNWLEPNIQLKSLPQIYREYEKRFLSRYIRPSKFWYETLWLNNDTKP- 104

Query: 128 ISFHKL-INSDVQLDTKLKDLDPMEFQPAQLMENPLNVGDLVLLKVKPNELAMCVSLPSS 186
             F+KL +N+ +      K L  + F    L + PL + DL +L+  P+EL+MCV LP S
Sbjct: 105 -PFNKLFLNNPLPDSISKKQL--LNFDYNDLAKTPLKIRDLAILRATPSELSMCVQLPES 161

Query: 187 TMDPRYTFVAIDGTMCFATKNRVLLRIPHKLPVGVNSLIQPEGHHKHLPIGTLKNISNQT 246
             DPRYTF +  G + F  ++ + +RIP+++P G+  LI  E  H+  PIGTLK+ +  T
Sbjct: 162 VEDPRYTFASRSGKLYFVYRSMIKIRIPYQVPKGIQGLILKELQHEFSPIGTLKSNTKDT 221

Query: 247 NILPIVTRQLITSRYPAQISKLAWKCLPITTKKLQLLHRSLQNYMGPWQIPFFTLVGLVQ 306
            ILP + R L++    + I+K A    PI  KKL+LLHR LQN  GP  IPF  L+ LV 
Sbjct: 222 FILPYLARNLLSRTGLSDINKAASYQRPIVMKKLELLHRYLQNDKGPTSIPFTHLINLVN 281

Query: 307 KLDLNKALDGKYGIDYLTDLVNNYHTADNVAINSPTFVSTYWAILQQQESNLWGEIHLNT 366
           KLDL++AL  + G DY+ +L+   +   ++ +N+   ++ YW++++  E+ LW  I+ N+
Sbjct: 282 KLDLSQALHLQAGNDYIINLIKEANDPPSI-MNASLTIAVYWSLVELSETFLWDGINRNS 340

Query: 367 ALLSPISVTIVPLKSQHLYYAQVIEKLEANSYKEVNTFVKLVNERKYRDISNLYPSVIQL 426
           A L P +VT++PL S  ++Y ++IE LE N+YK++N F  LVN++ Y++I   +  +I L
Sbjct: 341 ASLFPTTVTVLPLLSYRVHYTELIEDLERNNYKQLNKFSNLVNDKNYQEIEQSFSKIINL 400

Query: 427 LKDFAAGNFHNNGIIVTLISKIFRKIVRYKDYDITRDVCQDLINEIVXXXXXXX-XXXXX 485
           L+++ AGN  NN  I TLISK+FR I  Y+  DITRD+C +L+ +               
Sbjct: 401 LQEYTAGNLQNNPKITTLISKLFRGIKEYQRCDITRDLCNELLMKFPSIKPNSNPLLKNH 460

Query: 486 XXXXXXXSKLMESQQKLYYLTNIEDLQRENSGNDSDRYDFGDLRVFCIDSDTAHEIDDGV 545
                  S+  + QQ LY      DL  + S  D  R+DFGDLRV+CIDS+TAHEIDDG+
Sbjct: 461 DLATRADSQHGQRQQILYDYVKPNDLLIQESLRD--RFDFGDLRVYCIDSETAHEIDDGI 518

Query: 546 SVENHGKDGMYTLHIHIADPTSMFPESTAIDSV-GISTDILNIAFKRSFTTYLPDVVVPM 604
           S+E    +G +TLHIHIADP   FPE      V G+  D+L IA++ SFTTYLPD VVPM
Sbjct: 519 SIEKKF-NGKFTLHIHIADPAIFFPECNNEKGVLGLQDDVLKIAYENSFTTYLPDTVVPM 577

Query: 605 LPQAICHLSDLGKHGKRTKTISFSVDVKVGYQGCGKSLEIMYDSFRIRKGFVSNFPKATY 664
           LP++ C ++DLG +GK+T +ISFSVDV +  +    +L+I YD+F+IR G VSNFPKATY
Sbjct: 578 LPKSYCKMADLGINGKKTPSISFSVDVILNKEKS--NLKICYDTFQIRLGLVSNFPKATY 635

Query: 665 DDVDKILSAPDN-ESSPVKADLESLSMISKLLREQRIKKNNAVIFGEGFNKGMVTLNANA 723
           D+VD ILS+  N E   ++ DL  LSMI+ +LR +R ++N A+ FGEGFN+G    + ++
Sbjct: 636 DNVDDILSSEVNSEQKLLQDDLRQLSMIAGILRNKRTQENGAITFGEGFNRGTPKYSEDS 695

Query: 724 EGELTEVSFSNQEETPSTVLVSEMMILANTLTGRYFAENNIGGVFRCYKQLPLDLIAQQQ 783
           E E   +SF +Q+ T S  LV+E+MILANTL GRYF EN I GV+RCY  L L+  A+ Q
Sbjct: 696 ETESDVISFVDQKNTKSNELVTELMILANTLCGRYFKENKIFGVYRCYNDLNLEPKAKMQ 755

Query: 784 YDSMITGTKKGLFPKLRDIVKLSSLLNSSFYTGRPFRHEMIGAKQYLTVTSPLRRFPDLI 843
           Y+ +    K G  P L DIVK+ SLLNSS+Y+  P RH+MIG++QYLTVTSPLRRF DL+
Sbjct: 756 YNKLREECKNGKLPTLEDIVKVQSLLNSSYYSEHPSRHDMIGSEQYLTVTSPLRRFTDLV 815

Query: 844 NHLQIHRHLQKKPLCFTQTQIDSLIWSIQSRADILKRASRDSSTYWTLNYLKKLAKSDPG 903
           +H+Q+H HL+  PL F Q  I + +  IQSRAD L++ S +S+   TL+YLK L K+ P 
Sbjct: 816 SHIQLHNHLKGHPLPFNQKAIRNFVPHIQSRADKLRKISTESNVCMTLSYLKNLLKTKPD 875

Query: 904 RTYDVMITSVPQNGFAGCVFPSLSFARGTLKLQPKAKYYPMIGDIVKDCKISKIDCLEGM 963
             +DV ITSVP  G A C+ P  SFARG ++L P  K YP +GD V  CK+ KI C++G+
Sbjct: 876 TMFDVKITSVPSEGRARCLIPEYSFARGEIRLSPSLKVYPKVGDTVNSCKVVKISCVDGI 935

Query: 964 LELEK 968
           LE  K
Sbjct: 936 LEFNK 940

>Kwal_27.10213 s27 complement(243200..246010) [2811 bp, 936 aa] {ON}
           YMR287C (MSU1) - component of 3'-5'exonuclease complex
           [contig 39] FULL
          Length = 936

 Score =  763 bits (1970), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/933 (42%), Positives = 578/933 (61%), Gaps = 44/933 (4%)

Query: 62  GSVGTEKDIESINKDFLQRTKGLEPDIELKQLSQIKEEFYQRYKDRYIKPSEAWYTNT-- 119
           G V + +++    K   +R   LEP +E+KQLS+I+     RY ++Y+ PS+ W  +   
Sbjct: 19  GPVRSVQNVPDSAKIIYKRAGQLEPGVEIKQLSEIQSGLNDRYYEQYLIPSKEWCRDNGT 78

Query: 120 -WRSLTK------PKISFHKLINSDVQLDTKLKDLDPMEFQ--PAQLMENPLNVGDLVLL 170
            W  +          +S  +  + D  L+ K+ D     F+  P +L+++PL +GDLVLL
Sbjct: 79  KWGGMKNYLNMDLMSLSEKQQADMDASLEPKVYDKTSETFRLVPKELLKSPLKIGDLVLL 138

Query: 171 KVKPNELAMCVSLPSSTMDPRYTFVAIDGTMCFATKNRVLLRIPHKLPVGVNSLIQPEGH 230
           +  P +L  CV +P+  M+P Y F  IDG + +A ++ +LLRIP       + LI+ E  
Sbjct: 139 RSNPTQLCTCVEVPTDVMNPSYAFATIDGQIKYAMRSMILLRIPSFHRRSAHHLIREEKP 198

Query: 231 HKHLPIGTLKNISNQTNILPIVTRQLITSRYPAQISKLAWKCLPITTKKLQLLHRSLQNY 290
           +    IGT+K+   +T ILPI+ RQL TS  P +I+K AW  + I T+KL+LLHR LQ  
Sbjct: 199 YLDARIGTVKDSPEKTFILPILARQLYTSYAPFKITKQAWSRMAILTQKLELLHRFLQRS 258

Query: 291 MGPWQIPFFTLVGLVQKLDLNKALDGKYGIDYLTDLV----------------NNYHTAD 334
            GPWQ+  F L  +   LDL K     +   Y+ +L                  N H  +
Sbjct: 259 SGPWQVSIFKLCQMAVMLDLEK-FRSSHAESYIKELFQKLGLNGSPNSFQKQSGNLHYIE 317

Query: 335 NVAINSPTFVSTYWAILQQQESNLWGEIHLNTALLSPISVTIVPLKSQHLYYAQVIEKLE 394
           +V  ++  +++T+WA+ QQQE+NLWG+   + A+L+P+SVT++PL S+HLYY  V++ L+
Sbjct: 318 SV--DAADYLATFWALEQQQENNLWGQFQTHQAMLAPLSVTVLPLASRHLYYETVLKDLK 375

Query: 395 ANSYKEVNTFVKLVNERKYRDISNLYPSVIQLLKDFAAGNFHNNGIIVTLISKIFRKIVR 454
            ++++ +  F  LVN   +    +  P   Q+LKD+AAGNFHNNG + T++SK+FR I  
Sbjct: 376 KDNHRLITKFAGLVNSGNFTGADSEVPQFKQILKDYAAGNFHNNGAMATVVSKLFRSIDV 435

Query: 455 YKDYDITRDVCQDLINEIVXXXXXXXXXXXXXXXXXXXSKLMESQQKLYYLTNIEDLQRE 514
           +K  DITRD+C +L+ ++                    S     ++K+Y     E  Q  
Sbjct: 436 FKGRDITRDLCHELMEKLSHRNTLNPLLLSDDLALPSSSANTALEEKIY-----EMAQPS 490

Query: 515 NSGNDSDRYDFGDLRVFCIDSDTAHEIDDGVSVENHGKDGMYTLHIHIADPTSMFPESTA 574
              +   R+DF  + V+CIDS++AHEIDDG+S+E  G++  +TLHIHIADP S+F E   
Sbjct: 491 TKEDIPARFDFSSMNVYCIDSESAHEIDDGISIEPLGRNA-FTLHIHIADPVSLFTEDGG 549

Query: 575 IDSVGISTDILNIAFKRSFTTYLPDVVVPMLPQAICHLSDLGKHGKRTKTISFSVDVKVG 634
                 + ++ NIA++R FTTYLPD+V+PMLPQ+ C    LG +  ++KT+SFSV++K+ 
Sbjct: 550 ---TKFNDEVWNIAYRRGFTTYLPDLVLPMLPQSFCLAGSLGINNGKSKTVSFSVNIKMH 606

Query: 635 YQGCGKSLEIMYDSFRIRKGFVSNFPKATYDDVDKILSAPDNESSPVKADLESLSMISKL 694
             G    L I  +SF++R G+ + FPK TYD VD+IL   ++++   K +L +L  IS L
Sbjct: 607 DGG----LRIDEESFKVRLGYATKFPKVTYDSVDRILQQNNDKTQEAK-ELRTLYQISLL 661

Query: 695 LREQRIKKNNAVIFGEGFNKGMVTLNANAEGELTEVSFSNQEETPSTVLVSEMMILANTL 754
           L+ +RI +  A+IFGEGFN+G+V LN    G L ++ F +Q +TPSTVLVSEMMILANTL
Sbjct: 662 LQSKRINEQRAIIFGEGFNRGLVKLNEGESGRLDKIGFEDQSQTPSTVLVSEMMILANTL 721

Query: 755 TGRYFAENNIGGVFRCYKQLPLDLIAQQQYDSMITGTKKGLFPKLRDIVKLSSLLNSSFY 814
            GRYF  N I GVFRCYK+L L   A++ Y+S+   T+    P + DI KLSSLLNSSFY
Sbjct: 722 AGRYFQVNKIPGVFRCYKELLLKSGARESYESLRAMTQSTSLPAVEDIAKLSSLLNSSFY 781

Query: 815 TGRPFRHEMIGAKQYLTVTSPLRRFPDLINHLQIHRHLQKKPLCFTQTQIDSLIWSIQSR 874
           TG P RH MIGA  YLTVTSPLRRFPDLINHLQI +HL + PL F++  ID +IW +QSR
Sbjct: 782 TGTPDRHSMIGAPAYLTVTSPLRRFPDLINHLQIRQHLTQNPLPFSKLDIDEMIWHLQSR 841

Query: 875 ADILKRASRDSSTYWTLNYLKKLAKSDPGRTYDVMITSVPQNGFAGCVFPSLSFARGTLK 934
             ++++A+RDS+++WTL +LK L  S P R   VM+TS+P+ GF  CV P LS ARG LK
Sbjct: 842 DLVIRKAARDSASFWTLKHLKSLQDSSPDRKISVMVTSIPRMGFVRCVLPDLSAARGILK 901

Query: 935 LQPKAKYYPMIGDIVKDCKISKIDCLEGMLELE 967
           L+P+      IGD++ +C I+K+DCL+ ++EL+
Sbjct: 902 LKPEVSADVAIGDLMHNCVITKLDCLDAVMELK 934

>KLTH0C03674g Chr3 complement(317119..319965) [2847 bp, 948 aa] {ON}
           similar to uniprot|P39112 Saccharomyces cerevisiae
           YMR287C MSU1 RNase component of the mitochondrial
           degradosome along with the ATP-dependent RNA helicase
           Suv3p the degradosome associates with the ribosome and
           mediates turnover of aberrant or unprocessed RNAs
          Length = 948

 Score =  755 bits (1949), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/913 (43%), Positives = 570/913 (62%), Gaps = 40/913 (4%)

Query: 79  QRTKGLEPDIELKQLSQIKEEFYQRYKDRYIKPSEAW-------YTNTWRSLTKPKISFH 131
           QR   LEP +E+KQLS I++   +R+ +++  PS+ W       + N    L     S  
Sbjct: 50  QRPGQLEPGVEIKQLSHIQKGLDERFYNQHFLPSKNWCRDNAVNWANMKDYLNMDLTSLS 109

Query: 132 KLINSDVQLDTKLKDLDP----MEFQPAQLMENPLNVGDLVLLKVKPNELAMCVSLPSST 187
               +D+    K +  D         P+ L+++ L +GDLVLL+  P++L MCV +P+  
Sbjct: 110 SKQRADMNDSLKPEVFDSESGTFRMHPSHLLDSSLKIGDLVLLRSDPSQLCMCVEVPTEV 169

Query: 188 MDPRYTFVAIDGTMCFATKNRVLLRIPHKLPVGVNSLIQPEGHHKHLPIGTLKNISNQTN 247
            +P Y F  IDG + F  +N +LLRIP         LI+ E    +  IG +K+   +T 
Sbjct: 170 TNPSYAFATIDGHIRFGERNMILLRIPSFHKAAAKYLIKEEVPFLNTRIGAVKDSPEKTF 229

Query: 248 ILPIVTRQLITSRYPAQISKLAWKCLPITTKKLQLLHRSLQNYMGPWQIPFFTLVGLVQK 307
           +L IV RQL TS  P +I+K AW  + +TTKKL+LLHR LQ   GPWQ+  F L  LV  
Sbjct: 230 MLSIVARQLYTSYVPFEITKAAWNRMGVTTKKLELLHRFLQRSTGPWQMSIFKLCELVAL 289

Query: 308 LDLNKALD---GKY--GIDYLTDLVNNYHTADNVA------INSPTFVSTYWAILQQQES 356
           LD++K      G Y  GI     +  + H  ++ +      I++  F++TYW+++QQQE 
Sbjct: 290 LDIDKCQSSSTGSYIEGILKEAGMFRDAHPIESFSGRSLKSIDASDFLATYWSLVQQQEH 349

Query: 357 NLWGEIHLNTALLSPISVTIVPLKSQHLYYAQVIEKLEANSYKEVNTFVKLVNERKYRDI 416
           NLWG+IH + A+L+PISVT++PL S HLYY +V+++L+ ++Y  + +F KL+N  +    
Sbjct: 350 NLWGQIHSHRAMLTPISVTVLPLTSHHLYYKEVLKELKKDNYAALESFAKLINTGERNSA 409

Query: 417 SNLYPSVIQLLKDFAAGNFHNNGIIVTLISKIFRKIVRYKDYDITRDVCQDLINEIVXXX 476
              YP + +LL+D+AAGNFHNNG I+T++SK+FRK+ +Y++ DITRD+C + + E+    
Sbjct: 410 KLQYPQISRLLRDYAAGNFHNNGPIITIVSKLFRKLDKYQNNDITRDLCHEFLQELTCES 469

Query: 477 XXXXXXXXXXXXXXXXSKLMESQQKLYYLTNIEDLQRENSGND-SDRYDFGDLRVFCIDS 535
                           S+    +QK+Y      DL   N  +D S R+DFG + V+CIDS
Sbjct: 470 IPNPQLLSNEIRSPSTSERAVLEQKIY------DLALPNQNDDISRRHDFGKMNVYCIDS 523

Query: 536 DTAHEIDDGVSVENHGKDGMYTLHIHIADPTSMFPESTAIDSVGISTDILNIAFKRSFTT 595
           +TAHEIDDG+S+E  G++  YTLHIHIADP S+F  S        S +I NIA +R FT+
Sbjct: 524 ETAHEIDDGISIEATGENA-YTLHIHIADPVSLFSNS---QEGSFSKEIWNIALQRGFTS 579

Query: 596 YLPDVVVPMLPQAICHLSDLGKHGKRTKTISFSVDVKVGYQGCGKS-LEIMYDSFRIRKG 654
           YLPD V PMLP++     DLGK G  +KT+SFSVD++     C K+ +EI+ ++F ++ G
Sbjct: 580 YLPDCVTPMLPKSYSKAGDLGKDGIASKTLSFSVDIR-----CRKNNVEILEETFSVKLG 634

Query: 655 FVSNFPKATYDDVDKILSAPDNESSPVKADLESLSMISKLLREQRIKKNNAVIFGEGFNK 714
            VS FP+ TY  VD+IL   + ++S    +L +L  I+ LLR +R+K+ NA+IFGEGFN+
Sbjct: 635 LVSQFPRVTYKVVDRILGL-EQDASQQTQELRTLHKIALLLRSKRVKEQNAIIFGEGFNR 693

Query: 715 GMVTLNANAEGELTEVSFSNQEETPSTVLVSEMMILANTLTGRYFAENNIGGVFRCYKQL 774
           G+V L        T +SF +QEET STVLVSE+MILANT+ G++F +  I GVFRCYK L
Sbjct: 694 GLVKLMPTQTNTATALSFEDQEETASTVLVSEIMILANTMAGKFFRDRGIPGVFRCYKGL 753

Query: 775 PLDLIAQQQYDSMITGTKKGLFPKLRDIVKLSSLLNSSFYTGRPFRHEMIGAKQYLTVTS 834
            L   A+Q Y+S+        FP  +DI KLSSLLNSSFY+ R  +HEMIGA  YL VTS
Sbjct: 754 QLKDNARQGYNSLRDMMHSQKFPSAKDIAKLSSLLNSSFYSARAEKHEMIGAPAYLPVTS 813

Query: 835 PLRRFPDLINHLQIHRHLQKKPLCFTQTQIDSLIWSIQSRADILKRASRDSSTYWTLNYL 894
           PLRRF DL+NH Q+H +L   PL F++ Q+  L W IQSR  +L++A+RDS+++WTL +L
Sbjct: 814 PLRRFADLVNHWQLHCYLAGFPLKFSEDQVSDLAWHIQSRDVVLRKAARDSASFWTLVHL 873

Query: 895 KKLAKSDPGRTYDVMITSVPQNGFAGCVFPSLSFARGTLKLQPKAKYYPMIGDIVKDCKI 954
           K   + +P R   VM+TSVP+ G   CV P LS ARG LKL+P+A     IGD+V +C+I
Sbjct: 874 KSQQELNPSRRLSVMVTSVPRLGVVRCVLPELSTARGILKLKPEASSTVAIGDVVHNCRI 933

Query: 955 SKIDCLEGMLELE 967
           +++DCL+ ++ELE
Sbjct: 934 TRLDCLDSIMELE 946

>NDAI0K00320 Chr11 (60516..63404) [2889 bp, 962 aa] {ON} Anc_8.853
           YMR287C
          Length = 962

 Score =  712 bits (1837), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/922 (41%), Positives = 577/922 (62%), Gaps = 37/922 (4%)

Query: 66  TEKDIESINKDFLQRTKGLEPDIELKQLSQIKEEFYQRYKDRYIKPSEAWYTNTWRSLTK 125
           + +DI+ I  +FL+RT  LEPDI LK  +QI  E  +R+  RY++PS++WY + W  L +
Sbjct: 50  SREDIQLIQANFLKRTNDLEPDIRLKTTAQIHYELDKRFNARYLQPSKSWYESNWEKLNE 109

Query: 126 PKI--SFHKLINSDVQLDTKLKDLDPMEFQPAQLMENPLNVGDLVLLKVKPNELAMCVSL 183
            ++  S  +LIN D   + K      ++F    + E PL +GD+VLLK   +E +MC+ L
Sbjct: 110 KRLTLSIRELINKD-PAEFKFNYYKNLKFNIEDVTE-PLKIGDIVLLKTNTSEFSMCIDL 167

Query: 184 PSSTMDPRYTFVAIDGTMCFATKNRVLLRIPHKLPVGVNSLIQPEGHHKHLPIGTLKNIS 243
           P S  DPRYTF++  G + F  ++ +LL+IP KLP  +  LI  E  HK+ PIGT+K+  
Sbjct: 168 PQSLKDPRYTFISSTGDLIFGMRSMILLKIPFKLPGNIERLIIKEPAHKYNPIGTIKSSL 227

Query: 244 NQTNILPIVTRQLITSRYPAQISKLAWKCLPITTKKLQLLHRSLQNYMGPWQIPFFTLVG 303
           ++T ++P++ RQL+ +  PAQISK A K LP+  KKL+LLHR LQ++ GP QI F  L+ 
Sbjct: 228 DETVLVPVIARQLLINFMPAQISKCATKQLPVIIKKLELLHRYLQDFSGPQQIHFHKLIN 287

Query: 304 LVQKLDLNKALDGKYGIDYLTDLV-----NNYHTADNVAINSPTFVSTYWAILQQQESNL 358
           +++ L+L++A D + G +Y+ +L+     N+Y      ++++   +STYWAI++QQ+  L
Sbjct: 288 IIEALNLDRATDYEKGNEYVNELLKQKYYNDYTDLSLSSLDATVALSTYWAIIEQQDLFL 347

Query: 359 WGEIHLNTALLSPISVTIVPLKSQHLYYAQVIEKLEANSYKEVNTFVKLVNERKYR---- 414
           WGEI  N++ L P +VTI+P  S H+YY ++I+ L  N+++  N F   +NE        
Sbjct: 348 WGEIKRNSSSLFPTTVTILPF-SHHVYYTKLIKSLRKNNFRRTNEFSAFINEHNLNTSSP 406

Query: 415 DISNLYPSVIQLLKDFAAGNFHNNGIIVTLISKIFRKIVRYKDYDITRDVCQDLINEIVX 474
           +I   +P  + LLK++ AGN  +N  I+T++SKIFR +  +K+ DIT+D+  +L+ +++ 
Sbjct: 407 EIQFKFPEFLHLLKEYCAGNLLDNPKIITILSKIFRNLNDFKERDITKDLAYELLTKLIP 466

Query: 475 XXXXXXXXXXXXXXXX--XXSKLMESQQKLYYLTNIEDLQRENSGNDSDRYDFGDLRVFC 532
                               S   E+Q KLY L     +  E+    + R++F DL V+C
Sbjct: 467 TSNLLANPLLANHDLSLPTNSGRGENQSKLYELATPTKI--ESGETTTKRHNFNDLNVYC 524

Query: 533 IDSDTAHEIDDGVSVENHGK-DGMYTLHIHIADPTSMFPESTAIDSVGISTDILNIAFKR 591
           IDS+TAHEIDDG+S++ + K D +Y+  +      SM  +S      GI  DIL IA+ R
Sbjct: 525 IDSETAHEIDDGISIKKYLKIDLLYSFILLTLQFISM-KDSNKEKKTGIDDDILKIAYYR 583

Query: 592 SFTTYLPDVVVPMLPQAICHLSDLGKHGKRTKTISFSVDVKVGYQGCG--KSLEIMYDSF 649
           SFTTYLPD VVPMLP   C +SDLGK  +  +T++FSVD+ + + G    ++L+I+YD+F
Sbjct: 584 SFTTYLPDNVVPMLPSKYCEMSDLGKSNQNIETLTFSVDITI-FDGSNNEETLKILYDTF 642

Query: 650 RIRKGFVSNFPKATYDDVDKILSAPDNES----SPVKADLESLSMISKLLREQRIKKNNA 705
           +I+ G VSNFPK TYD VDKIL   DN +    + +  DL  LS I+KLLR+ RI +NNA
Sbjct: 643 KIQFGLVSNFPKVTYDTVDKIL---DNSTKIPDTSITEDLRQLSRIAKLLRKYRINENNA 699

Query: 706 VIFGEGFNKGMVTLNANAEGELTEVSFSNQEETPSTVLVSEMMILANTLTGRYFAENNIG 765
           ++FGEGFN+G+  L +  +    E+ F++Q+ + S  LVSEMMILANTLTG+Y  ++ I 
Sbjct: 700 IVFGEGFNRGIPDLQSTED----EIIFTDQKNSDSNELVSEMMILANTLTGKYCKDHKIP 755

Query: 766 GVFRCYKQLPLDLIAQQQYDSMITGTKK-GLFPKLRDIVKLSSLLNSSFYTGRPFRHEMI 824
            ++RCY   PLD+  + Q + +I  +K     P   D+ K+SS LNSS+Y+G P RH M+
Sbjct: 756 VIYRCYS--PLDIGPEAQQECIILRSKNIDRLPSNIDMAKMSSFLNSSYYSGTPSRHSML 813

Query: 825 GAKQYLTVTSPLRRFPDLINHLQIHRHLQKKPLCFTQTQIDSLIWSIQSRADILKRASRD 884
           G+ +Y TVTSPLRRFPDL+NH+Q+H HL+   L FT   +   + +IQSR+D LK     
Sbjct: 814 GSDEYATVTSPLRRFPDLLNHIQLHNHLKGYQLPFTPNHVAHYLTTIQSRSDTLKNIGNA 873

Query: 885 SSTYWTLNYLKKLAKSDPGRTYDVMITSVPQNGFAGCVFPSLSFARGTLKLQPKAKYYPM 944
             T  TLNY+K L   +P + +DV++TSVP  G A C      +ARGT+KL+ +    P+
Sbjct: 874 VYTEMTLNYIKLLINKEPTKAFDVLVTSVPIEGSARCAIVGYEYARGTIKLKAEINPVPI 933

Query: 945 IGDIVKDCKISKIDCLEGMLEL 966
           IGDI+  CK++KI  +EG LEL
Sbjct: 934 IGDIITKCKVTKIFPIEGALEL 955

>Kpol_237.4 s237 complement(4514..7264) [2751 bp, 916 aa] {ON}
           complement(4514..7264) [2751 nt, 917 aa]
          Length = 916

 Score =  672 bits (1734), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/919 (42%), Positives = 556/919 (60%), Gaps = 44/919 (4%)

Query: 71  ESINKDFLQRTKGLEPDIELKQLSQIKEEFYQRYKDRYIKPSEAWYTNTWRSLTKPKISF 130
           ++I K FL RT GLE       + +IK    +R+   Y +PS  WY +   S   P +  
Sbjct: 20  DTIIKKFLNRTSGLETISIPHSIQKIKSNSIKRFNLTYNQPSNTWYKSLLISSPPPSLPC 79

Query: 131 HKLINSDVQLDTKLKDLDP---MEFQPAQ-------LMENPLNVGDLVLLKVKPNELAMC 180
               ++     T     +    + F P          +    N GD+VLL    + L MC
Sbjct: 80  SPSTSTSTSATTATSTSNSPKWLSFIPKNNHTFNINQLNKKFNRGDIVLLSQDLSNLYMC 139

Query: 181 VSLPSSTMDPRYTFVAIDGTMCFATKNRVLLRIPHKLPVGV---NSLIQPEGHHKHLPIG 237
           + LP ST DPRY+F   +G + FA ++ VLLRIP +LP  +   +  +QPE       +G
Sbjct: 140 IELPQSTADPRYSFANSNGDIIFANRSSVLLRIPLQLPTNLLLSDDFLQPEPTQG---VG 196

Query: 238 TLKNISNQTNILPIVTRQLITSRYPAQISKLAWKCLPITTKKLQLLHRSLQNYMGPWQIP 297
           T+KN  +   +LP++ RQL+ S   + IS  A   LPI  KKLQLLHR+LQ +     IP
Sbjct: 197 TVKNSIDNPYVLPVLLRQLVISPSLSTISSNANNLLPIVLKKLQLLHRNLQAFKI---IP 253

Query: 298 FFTLVGLVQKLDLNKALDGKYGIDYLTDLVNNYHTADNV-AINSPTFVSTYWAILQQQES 356
              L  LVQ LDL KA     G  Y+++ + N +   ++ +INS   ++T+WAI QQQ+ 
Sbjct: 254 LVQLSSLVQNLDLTKATSND-GESYISNFIANSNENYSIESINSSNLIATFWAIRQQQQD 312

Query: 357 NLWGEIHLNTALLSPISVTIVPLKSQHLYYAQVIEKLEANSYKEVNTFVKLVNERKYRDI 416
           +LWG+IH + ALL P++V+I+PL+S ++YY +++  +E +    +  F K        + 
Sbjct: 313 HLWGDIHYSKALLFPLAVSILPLQSNYMYYKEILPAIELD--HSIERFTK----NGIPNT 366

Query: 417 SNLYPSVIQLLKDFAAGNFHNNGIIVTLISKIFRKIVRYKDYDITRDVCQDLINEIVXXX 476
            N +P ++ LLK +A+G    +  IVT+ISKIFR +  YK YD++RD+CQ L NE+V   
Sbjct: 367 PNEFPQLLNLLKQYASGAVLMDDKIVTMISKIFRNLDDYKKYDVSRDLCQKLYNELVPKE 426

Query: 477 XXXXXXXXXXXXXXX--XSKLMESQQKLYYLTNIEDLQRENSGNDSDRYDFGDLRVFCID 534
                             S   E Q+K+Y + N   +Q   + N+S+R+DFGDLRVFCID
Sbjct: 427 QKIQNSLLYNTDLALPLASNRTEEQEKVYQMYN--PIQ---TSNNSNRHDFGDLRVFCID 481

Query: 535 SDTAHEIDDGVSVENHGKDGMYTLHIHIADPTSMFPESTAIDSVGISTD-ILNIAFKRSF 593
             TAHEIDDGVS+E + ++ +YTLH+HIADP+S F       +V I  D IL IA +RSF
Sbjct: 482 EKTAHEIDDGVSIE-YKQNNVYTLHVHIADPSSYFKICND-HNVNIENDEILKIALQRSF 539

Query: 594 TTYLPDVVVPMLPQAICHLSDLGKHGKRTKTISFSVDVKVGYQGCGKSLEIMYDSFRIRK 653
           TTYLPD V+PMLP+ +C  +DLGK G++TKTI+FSVDVK+  +    +++++ ++F++R 
Sbjct: 540 TTYLPDQVLPMLPKLLCRAADLGKTGEKTKTITFSVDVKLNKKDM--TVKVLDNTFQVRL 597

Query: 654 GFVSNFPK-ATYDDVDKIL--SAPDNESSPVKADLESLSMISKLLREQRIKKNNAVIFGE 710
           G+VSNF K  TY DVD IL  S        V+ DL+S+ +I+K L   RI  NNAVIF +
Sbjct: 598 GYVSNFVKDMTYSDVDSILNDSKESGRDKKVEKDLKSMFLIAKGLNNSRIM-NNAVIFSD 656

Query: 711 GFNKGMVTLNANA-EGELTEVSFSNQEETPSTVLVSEMMILANTLTGRYFAENNIGGVFR 769
             N G + L  +   GE+T+++F   + T S +LVSE+MILAN+L G++FAEN I  ++R
Sbjct: 657 EINNGKIELTKDEITGEVTQINFKGGKFTDSNILVSELMILANSLAGKFFAENGIPAIYR 716

Query: 770 CYKQLPLDLIAQQQYDSMITGTKKGLFPKLRDIVKLSSLLNSSFYTGRPFRHEMIGAKQY 829
            Y  L L   AQ +Y++M++  K G  P L+DI K+SSL N+S +T  P  H MI  K Y
Sbjct: 717 SYSDLLLGKDAQSEYNAMLSNLKLGKRPTLKDINKISSLFNTSKFTTYPSPHSMIATKYY 776

Query: 830 LTVTSPLRRFPDLINHLQIHRHLQKKPLCFTQTQIDSLIWSIQSRADILKRASRDSSTYW 889
            TVTSPLRRFPD+INHLQIHR L K+PLCFTQ  ++++ W+IQ++  IL+ +SR  +TYW
Sbjct: 777 ATVTSPLRRFPDMINHLQIHRILSKQPLCFTQRDLENMNWNIQTKDVILRSSSRMINTYW 836

Query: 890 TLNYLKKLAKSDPGRTYDVMITSVPQNGFAGCVFPSLSFARGTLKLQPKAKYYPMIGDIV 949
           TL ++K     DP + +DVMITSV QNG A C+    SFA+G L   P  + +P+IGD V
Sbjct: 837 TLRHIKDQLSEDPDKKFDVMITSVQQNGVAHCILAQFSFAKGKLVFDPNDESHPLIGDTV 896

Query: 950 KDCKISKIDCLEGMLELEK 968
            +CKI+KIDCL  +LE  K
Sbjct: 897 SNCKITKIDCLGNVLEFSK 915

>TPHA0I00350 Chr9 complement(65929..68760) [2832 bp, 943 aa] {ON}
           Anc_8.853 YMR287C
          Length = 943

 Score =  645 bits (1663), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/917 (40%), Positives = 556/917 (60%), Gaps = 43/917 (4%)

Query: 69  DIESINKDFLQRTKGLEPDIELKQLSQIKEEFYQRYKDRYIKPSEAWYTNTWRSLTKPKI 128
           ++E +   FL+RTKGLE   E+K++ +I+ +    + + YI PS+ W+     S      
Sbjct: 36  NLELVKSKFLERTKGLEHISEIKEVDEIQNQSMMTFNNEYIVPSKVWFDTVTSSG----- 90

Query: 129 SFHKLINSDVQLDTKLKDLDPM--------EFQPAQLMENPLNVGDLVLLKVKPNELAMC 180
           SF   + ++  +  K K    +         F   QL +  L++GDLVLL+    EL MC
Sbjct: 91  SFSNDLINETLISKKWKKFPDLPIKMNGDYSFNALQLFDRSLDIGDLVLLRNSDKELLMC 150

Query: 181 VSLPSSTMDPRYTFVAIDGTMCFATKNRVLLRIPHKLPVGVNSLIQPEGHHKHLPIGTLK 240
           V +P S  DPR+TF   DGT+ F+TK  V LRI + LP  + +    +  ++   I   +
Sbjct: 151 VDIPMSIEDPRFTFAKPDGTLVFSTKQNVTLRILNTLPKNILNHDLIKNKYEAGLINRKE 210

Query: 241 NISNQTNILPIVTRQLITSRYPAQISKLAWKCLPITTKKLQLLHRSLQNYMGPWQIPFFT 300
           N + +   LP+V RQ+ TS  P++IS++A + L +  KKL++LHR + + +    I F  
Sbjct: 211 NNAIKLPSLPVVARQIATSPLPSEISRIAARDLNVNLKKLEVLHRYISDGVETSSISFLK 270

Query: 301 LVGLVQKLDLNKALDGK--YGIDYLTDLVNNYHTADNV----AINSPTFVSTYWAILQQQ 354
           LV LVQ +DLNK    +  +  +++++++ N  T D++     I++ T +STYWA++QQQ
Sbjct: 271 LVHLVQNVDLNKLARNRADHDANHISNIIRN--TKDDIQYMTKIDAITLLSTYWAVIQQQ 328

Query: 355 ESNLWGEIHLNTALLSPISVTIVPLKSQHLYYAQVIEKLEANSYKEVNTFVKLVNERKYR 414
           +S LWG+I +++ALL PISV+++P  +  +Y  + I ++  +  + +N F + +N+    
Sbjct: 329 QSQLWGDIQIHSALLFPISVSVLPFNNV-IYLNETIPRVATD--ENINKFTEAINKHNLE 385

Query: 415 DISNLYPSVIQLLKDFAAGNFHNNGIIVTLISKIFRKIVRYKDYDITRDVCQDLINEI-V 473
            I+  +P  + +LK++  G ++ N  I T+ISK+FR+I  YK+ +++RD CQ L NE+  
Sbjct: 386 KINEKFPDFLNMLKEYGNGCYYGNEKITTIISKLFRRIETYKNKELSRDNCQKLYNELNP 445

Query: 474 XXXXXXXXXXXXXXXXXXXSKLMESQQKLYYLTNIEDLQRENSGNDSDRYDFGDLRVFCI 533
                              S    ++Q +Y LT +++    ++  D  R+DF DL+VFCI
Sbjct: 446 SNKILNSLLLSKDLCLPEISGTTRTEQLIYSLTEVDN----HAIIDQRRHDFKDLKVFCI 501

Query: 534 DSDTAHEIDDGVSVENHGKDGMYT-LHIHIADPTSMFPESTAIDSVGISTDILNIAFKRS 592
           D  TAHEIDDGVSV    KDG  T L IHIADP S+FP    I++   S +ILNIAF+R+
Sbjct: 502 DEKTAHEIDDGVSVLR--KDGNITRLFIHIADPASLFPLHNTIENNSTSDEILNIAFRRA 559

Query: 593 FTTYLPDVVVPMLPQAICHLSDLGKHGKRTKTISFSVDVKVGYQGCGKSLEIMYDSFRIR 652
           FTTYLP+ V+PMLP++ C  SDLG  GK T TI+FSVD          S  I+ D+F I+
Sbjct: 560 FTTYLPEFVLPMLPKSFCTKSDLGNTGKMTNTITFSVDFD------KSSCSILEDTFEIQ 613

Query: 653 KGFVSNFPK-ATYDDVDKILSAPDNESSPVKADLESLSMISKLLREQRIKKNNAVIFGEG 711
            G V+NFPK  TY +VDKIL++     + ++ DL  +  I+  LR+ RI  N+AVIFGEG
Sbjct: 614 LGKVNNFPKNTTYKEVDKILNSSIKRENDIERDLREMRFIANHLRKCRID-NSAVIFGEG 672

Query: 712 FNKGMVTL-NANAEGELT-EVSFSNQEETPSTVLVSEMMILANTLTGRYFAENNIGGVFR 769
           FNKG V L     +GE + +V+F + E TPS ++VSE MILAN+L G+YF  + I  +++
Sbjct: 673 FNKGAVNLIEKKQDGEKSYKVNFKDSETTPSNIIVSEFMILANSLAGKYFKNHKIPAIYK 732

Query: 770 CYKQLPLDLIAQQQYDSMITGTKKGLFPKLRDIVKLSSLLNSSFYTGRPFRHEMIGAKQY 829
            YK L +   A  Q+  ++   KK L P +++I K+ SLL+SS ++ +P  HEMIG  QY
Sbjct: 733 TYKGLNMKPKASSQFKKILNVNKKRL-PSIKEISKIGSLLSSSTFSSKPSIHEMIGTDQY 791

Query: 830 LTVTSPLRRFPDLINHLQIHRHLQKKPLCFTQTQIDSLIWSIQSRADILKRASRDSSTYW 889
            TVTSPLRRFPDLINH Q+HR+L  +PLCF+Q ++D ++W +  R  IL+  SR  + YW
Sbjct: 792 ATVTSPLRRFPDLINHFQLHRYLTNQPLCFSQEKLDEMVWHLIERDTILRHYSRKFNKYW 851

Query: 890 TLNYLKKLAKSDPGRTYDVMITSVPQNGFAGCVFPSLSFARGTLKLQPKAKYYPMIGDIV 949
           TL YL +  + +P   +DVM+ SV +NG   C+ P LS+A GTLKL+P A   P IG+I+
Sbjct: 852 TLQYLNEKIEGNPLLRFDVMVQSVSENGRVHCILPKLSYATGTLKLKPSATTIPAIGEII 911

Query: 950 KDCKISKIDCLEGMLEL 966
           K+CKI+ IDCL   LE 
Sbjct: 912 KNCKIANIDCLGNSLEF 928

>KLLA0C06314g Chr3 complement(556468..559419) [2952 bp, 983 aa] {ON}
           similar to uniprot|P39112 Saccharomyces cerevisiae
           YMR287C MSU1 RNase component of the mitochondrial
           degradosome along with the ATP-dependent RNA helicase
           Suv3p the degradosome associates with the ribosome and
           mediates turnover of aberrant or unprocessed RNAs
          Length = 983

 Score =  601 bits (1550), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/955 (36%), Positives = 533/955 (55%), Gaps = 53/955 (5%)

Query: 55  VIESGANGSVGTEKDIESINKD----FLQRTKGLEPDIELKQLSQIKEEFYQRYKDRYIK 110
           + ++  + + GT    ES+ +D    F  + K + P++E+K   + K E   R+ DR+++
Sbjct: 29  LFQARQSDTSGTNVTTESLQEDEEVIFFSQDKDILPEVEIKPFRRTKAETLMRFNDRFVQ 88

Query: 111 PSEAWYTNTWRSLTK--PKISFHKLINSDVQLDT--------------KLK-------DL 147
           PS  WY    +S  +   K  F  L+ +D+   T              KL+       D 
Sbjct: 89  PSIDWYRKVGKSHGENTDKDEFMHLLRNDISSSTLFEETLKWLSKDNYKLRNNTYNGYDT 148

Query: 148 DPMEF--QPAQLMENPLNVGDLVLLKVKPNELAMCVSLPSSTMDPRYTFVAIDGTMCFAT 205
             +EF   P+ ++ + L  GD+ +LK  P EL +CV  PS  MD R+TF   DG + +A 
Sbjct: 149 QEIEFYFDPSAIVSSTLMPGDICVLKNSPFELLVCVKTPSEAMDARFTFANTDGNVVYAW 208

Query: 206 KNRVLLRIPHKLPVGVNSLIQPEGHHKHLPIGTLKNISNQTNILPIVTRQLITSRYPAQI 265
           K  V LR P         ++Q E  H + P+G++KN  + T ++P + R+++ S    +I
Sbjct: 209 KTSVHLRFPTIFNTTELEILQREKLHGYSPVGSVKNDKDVTFVIPTLPRRMLISNVTFRI 268

Query: 266 SKLAWKCLPITTKKLQLLHRSLQNYMGPWQIPFFTLVGLVQKLDLNKALDG-------KY 318
           +  A + LPI  KKL+L+HR LQ+   PWQIP   LV +   L+L+  ++        K 
Sbjct: 269 ADAAVQQLPIIKKKLELIHRYLQSGSSPWQIPILKLVEICSNLELSNNIEKSIATAFMKS 328

Query: 319 GI--DYLTDLVNNYHTADNVAINS---PTFVSTYWAILQQQESNLWGEIHLNTALLSPIS 373
           G+  D L  L N++    +   N       ++ YWA+L QQ + +WGE+ ++  +  P +
Sbjct: 329 GLSSDALYSLANSHFELSSKVPNKVECSRLLAVYWALLHQQGTQMWGEMTVHRGIFFPSA 388

Query: 374 VTIVPLKSQHLYYAQVIEKLEANSYKEVNTFVKLVNERKYRDISNLYPSVIQLLKDFAAG 433
           VT++PL  QHL+Y  +I KL  +    +N    L+NE     ++  +P ++ LL+D+AAG
Sbjct: 389 VTVLPLTKQHLHYHNIIHKLRQHGGVRINRIAALINENDLASLNKSFPYIVPLLRDYAAG 448

Query: 434 NFHNNGIIVTLISKIFRKIVRYKDYDITRDVCQDLINEIVXXXXXXXXXXXXXXXXXXXS 493
           N  +N  I +LIS +FRK+  YK+ +I+RDVC DL+  I                    +
Sbjct: 449 NLEHNDTITSLISSLFRKLDEYKELNISRDVCFDLLKRINPSEPPNPLLINHELQLPVNN 508

Query: 494 KLMESQQKLYYLTNIEDLQRENSGNDSDRYDFGDLRVFCIDSDTAHEIDDGVSVENHGKD 553
           + ++ +QK+Y L     ++     +   R ++ DL  +CIDS  AHEIDD VS+++ G  
Sbjct: 509 ERVKLEQKIYDLAVPPKIEH----SAEIRTEYKDLICYCIDSPDAHEIDDAVSIKSLG-G 563

Query: 554 GMYTLHIHIADPTSMFPESTAIDSVGISTDILNIAFKRSFTTYLPDVVVPMLPQAICHLS 613
             Y ++IH+ADP S+FPE+   D   I++ +L+IA++R+FTTYLPD V PMLP      S
Sbjct: 564 AKYRIYIHVADPASLFPEANE-DGTTINSPVLDIAYQRAFTTYLPDKVFPMLPTTYARSS 622

Query: 614 DLGKHGKRTKTISFSVDVKVGYQGCGKSLEIMYDSFRIRKGFVSNFPKATYDDVDKILSA 673
           DLG+ GK TK ++FSVD         K L ++ DS ++    +    + TY+ VD++L  
Sbjct: 623 DLGQFGKPTKAVTFSVDCTFSK---SKGLCLLKDSLKVELSVLHKSTRITYEAVDELLDE 679

Query: 674 PDNESSPVK-ADLESLSMISKLLREQRIKKNNAVIFGEGFNKGMVTLNANAEGELTEVSF 732
           P  +    K  DL++L  I+K LR QRI    AV+F E  + G+V+L+ +   EL EVSF
Sbjct: 680 PTTKPKSGKHEDLKTLFYIAKALRRQRIVDGGAVVF-ENSSTGIVSLSPDDNSELVEVSF 738

Query: 733 SNQEETPSTVLVSEMMILANTLTGRYFAENNIGGVFRCYKQLPLDLIAQQQYDSMITGTK 792
            +Q ET ST+LVSE+MILAN+LT  YF EN I G++R Y+ L +   A    + +   T+
Sbjct: 739 KDQIETKSTILVSELMILANSLTASYFEENQIPGIYRGYRPLNVVEDATSVPEWVKAKTQ 798

Query: 793 KGLFPKLRDIVKLSSLLNSSFYTGRPFRHEMIGAKQYLTVTSPLRRFPDLINHLQIHRHL 852
           +       DI K+ S L SSFY+  P  H+M+G   YLT+TSPLRRFPDL+NHLQ+HR L
Sbjct: 799 ENKIISKADIAKMKSFLTSSFYSSLPTPHDMLGTSHYLTITSPLRRFPDLVNHLQLHRTL 858

Query: 853 QKKPLCFTQTQIDSLIWSIQSRADILKRASRDSSTYWTLNYLKKLAKSDPGRTYDVMITS 912
           +  PL + Q+Q+D ++W I +R   LK AS D+  YWTL +LKK  +      + + ITS
Sbjct: 859 KGLPLLYKQSQLDGMVWHILTRDVTLKNASVDAQRYWTLRFLKKEIEDPTKNNWKLQITS 918

Query: 913 VPQNGFAGCVFPSLSFARGTLKLQPKAKYYPMIGDIVKDCKISKIDCLEGMLELE 967
           +  NG+A CV    +FA G LK+    K  P++GD + DC+IS I CL+G+L+ E
Sbjct: 919 LTDNGYAHCVILDKAFAVGQLKINLN-KNPPLVGDQISDCEISNIQCLDGILQFE 972

>AFR448W Chr6 (1244187..1246640) [2454 bp, 817 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR287C (MSU1)
          Length = 817

 Score =  575 bits (1483), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/832 (37%), Positives = 492/832 (59%), Gaps = 34/832 (4%)

Query: 152 FQPAQLMENPLNVGDLVLLKVKPNELAMCVSLPSSTMDPRYTFVAIDGTMCFATKNRVLL 211
            +P  L    L +GDL +L   P +L +CV  P+   D RY F   DG +C+ATK+ V L
Sbjct: 1   MRPGDLAGTTLQIGDLCVLSAVPGKLVVCVEQPTDAADARYAFAGADGAVCYATKSDVRL 60

Query: 212 RIP--HKLPVGVNSLIQPEGHHKHLPIGTLKNISNQTNILPIVTRQLITSRYPAQISKLA 269
           R+P  HK P+    L+  E  H + P+GT+KN  ++T +LP+  R+L  +    +IS+ A
Sbjct: 61  RVPGLHKRPL--RYLLHREADHGYAPVGTVKNNISRTYLLPVAVRRLFAALGVTEISQQA 118

Query: 270 WKCLPITTKKLQLLHRSLQNYMGPWQIPFFTLVGLVQKLDL-NKALDGKYGIDYLTDLVN 328
              LP    KL+LLHR LQ+++GPWQ+  F LV LV +L+L N   +    +  L   +N
Sbjct: 119 VAQLPEVVAKLELLHRHLQSHLGPWQLSLFKLVDLVTRLELPNSPGEASEKVAKLLAELN 178

Query: 329 ----NYHTAD--NVAINSPT------FVSTYWAILQQQESNLWGEIHLNTALLSPISVTI 376
               +Y +A   N+ + +P       +++TYW +LQQQ   +WG+I  + AL SP+SVT+
Sbjct: 179 IGQGSYCSAADINLRMAAPKQVDIALYLATYWGVLQQQGDQMWGDISYHRALFSPLSVTV 238

Query: 377 VPLKSQHLYYAQVIEKLEANSYKEVNTFVKLVNERKYRDISNLYPSVIQLLKDFAAGNFH 436
           +PL+ Q L+Y  ++  ++ + Y  ++ F  LVN+ KY++  + Y SV+QLL+D+ AGN +
Sbjct: 239 LPLRDQTLFYDYLLRDMKRDDYAALDEFACLVNQGKYKEACSNYKSVLQLLRDYCAGNIN 298

Query: 437 NNGIIVTLISKIFRKIVRYKDYDITRDVCQDLINEIVXXXXXXXXXXXXXXXXXXXSKLM 496
           +N  ++ L++++FR++  YK+ ++TR +   L+ ++                    +   
Sbjct: 299 SNAALIYLVTRLFRRLDAYKEEEVTRTIAFQLLGQLCPETPHNPLHWNHQLELPLSNPRT 358

Query: 497 ESQQKLYYLTNIEDLQRENSGNDSDRYDFGDLRVFCIDSDTAHEIDDGVSVENHGKDGMY 556
             +QK+Y L +   L +E  G    R +F  +  +CIDS  AHEIDDGVS+E   K   Y
Sbjct: 359 ALEQKVYDLAS-PPLDQEEPG---PRKEFSGV-CYCIDSPDAHEIDDGVSIERL-KGSRY 412

Query: 557 TLHIHIADPTSMFPESTAIDSVGISTDILNIAFKRSFTTYLPDVVVPMLPQAICHLSDLG 616
            LH+HIA P S+F +S     V I   +++IAF+R+FTTYLPD+V PM+P++    SDLG
Sbjct: 413 RLHVHIAYPYSLFKKSYTPGEVPIDP-VMDIAFRRAFTTYLPDLVFPMMPKSYTRASDLG 471

Query: 617 KHGKRTKTISFSVDVKVGYQGCGKSLEIMYDS-FRIRKGFVSNFPKATYDDVDKILSAPD 675
           +  K TKTI+ SVDV +      K L ++ ++  +I  G      + TYD VD +L +  
Sbjct: 472 QWDKPTKTITISVDVDLS-----KKLRVVDEATLQIALGTTRTSKRVTYDYVDDLLESKR 526

Query: 676 NESSPVKADLESLSMISKLLREQRIKKNNAVIFGEGFNKGMVTLNANAEGELTEVSFSNQ 735
            ++    +DL  L  +++ LRE+R    +A++FG+  N G+++L  N +G+L  V   + 
Sbjct: 527 QDAE--ASDLRLLYKVAESLREERKVLKHAIMFGDVQN-GLISLTPNEDGKLLNVQLVDS 583

Query: 736 EETPSTVLVSEMMILANTLTGRYFAENNIGGVFRCYKQLPLDLIAQQQYDSMITGTKKGL 795
           + T S  LVSE+MI+AN+L GRYF EN I GV+R   +L L   A  QY S+    ++  
Sbjct: 584 KSTKSNTLVSELMIMANSLAGRYFHENTIPGVYRGCTELLLKFEASNQYASLQRAMRQKG 643

Query: 796 FPKLRDIVKLSSLLNSSFYTGRPFRHEMIGAKQYLTVTSPLRRFPDLINHLQIHRHLQKK 855
                D+VK+++ L +S Y+  P RH M+G ++YLT+TSPLRR PD+INH+Q+HRHL+  
Sbjct: 644 SVSSSDLVKVAAFLTNSHYSSTPCRHAMVGTEEYLTITSPLRRLPDMINHMQLHRHLRSL 703

Query: 856 PLCFTQTQIDSLIWSIQSRADILKRASRDSSTYWTLNYLKKLAKSDPGRTYDVMITSVPQ 915
           P CF+Q QID+L W I +R   LK AS+ SS +WTL YLK    ++P + +D+++TS+P 
Sbjct: 704 PPCFSQEQIDALNWHILARDVALKDASKRSSVFWTLGYLKDQLCAEPDKRWDLVVTSLPL 763

Query: 916 NGFAGCVFPSLSFARGTLKLQPKAKYYPMIGDIVKDCKISKIDCLEGMLELE 967
           NGF  C  P + ++ G LK+ P     P +G  V +C I+++D L+G L  E
Sbjct: 764 NGFVHCKIPGIFYSSGKLKI-PSGANNPAVGSTVANCFITRLDSLDGTLRFE 814

>TBLA0B02920 Chr2 complement(671467..674556) [3090 bp, 1029 aa] {ON}
            Anc_8.853 YMR287C
          Length = 1029

 Score =  436 bits (1122), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 221/452 (48%), Positives = 309/452 (68%), Gaps = 15/452 (3%)

Query: 523  YDFGDLRVFCIDSDTAHEIDDGVSVENHGKDGMYTLHIHIADPTSMFPESTAIDSVGIST 582
            +DF DL+V+CIDS+TAHEIDDG+S+E    + ++TLHIHIADP+S+F        +    
Sbjct: 582  HDFNDLKVYCIDSETAHEIDDGISIEKLN-NNLFTLHIHIADPSSIFLNHEKNSDI---Q 637

Query: 583  DILNIAFKRSFTTYLPDVVVPMLPQAICHLSDLGKHGKRTKTISFSVDVKVGYQGCGKSL 642
            ++LN+A  +SFTTYLPD+V PMLP++ C LSDLG   ++T TISFSV+V+V      +S+
Sbjct: 638  NLLNMALSKSFTTYLPDLVSPMLPKSFCKLSDLGYDNQKTATISFSVNVEV--DSNNESI 695

Query: 643  EIMYDSFRIRKGFVSNFP-KATYDDVDKILSAPDNE------SSPVKADLESLSMISKLL 695
            +I++++F++R G VS FP   TYD+VD+ILS    E      +S ++ DL +LS IS LL
Sbjct: 696  KILHNTFKVRLGIVSKFPSNTTYDNVDRILSNSTEENLKSGVTSDIQNDLRNLSQISNLL 755

Query: 696  REQRIKKNNAVIFGEGFNKGMVTLNANAEGELTEVSFSNQEETPSTVLVSEMMILANTLT 755
            ++ RI+  NAVIFGEGFNKG+VTL+ + +G    ++F +Q +T S  LV+EMMILAN+L 
Sbjct: 756  KKNRIQNGNAVIFGEGFNKGLVTLSCSKDGGPV-INFKDQNDTKSVTLVTEMMILANSLA 814

Query: 756  GRYFAENNIGGVFRCYKQLPLDLIAQQQYDSMITGTK-KGLFPKLRDIVKLSSLLNSSFY 814
             R F EN I G+FRCY +L L   AQ ++D +    K     P +++I K  SLLNSSFY
Sbjct: 815  ARLFKENKIPGIFRCYHELHLAKKAQLEFDILRENIKVNSHLPNIKEISKFGSLLNSSFY 874

Query: 815  TGRPFRHEMIGAKQYLTVTSPLRRFPDLINHLQIHRHLQKKPLCFTQTQIDSLIWSIQSR 874
            T  P  H+MIGA  YLTVTSPLRRFPDL+NH+QI   ++KKP  ++ T I  ++  IQSR
Sbjct: 875  TDLPLPHQMIGAANYLTVTSPLRRFPDLVNHMQIQHFIKKKPFKYSTTDIQKMLPIIQSR 934

Query: 875  ADILKRASRDSSTYWTLNYLKKLAKSDPGRTYDVMITSVPQNGFAGCVFPSLSFARGTLK 934
              I++  S   + Y+ LNYLK+  K +P +T+DV+ITSV   GF  C+ P+ S + G LK
Sbjct: 935  DIIIRELSGKCNKYYLLNYLKEQIKKNPSQTFDVLITSVSNLGFIHCILPNFSSSMGILK 994

Query: 935  LQPKAKYYPMIGDIVKDCKISKIDCLEGMLEL 966
            L+P   + P IGD++++CKI KID L+G L+ 
Sbjct: 995  LKPDLDFTPSIGDVIRNCKIDKIDALDGRLDF 1026

 Score =  256 bits (654), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 161/447 (36%), Positives = 249/447 (55%), Gaps = 44/447 (9%)

Query: 66  TEKDIESINKDFLQRTKGLEPDIELKQLSQIKEEFYQRYKDRYIKPSEAWYTNT-WRSLT 124
           + +DIE I + FL R K L+P I +K+L +I  E+ +R+  R+I PS  W+ +  W S T
Sbjct: 51  SNEDIEKIKQTFLIRIKELDPSITIKELPEITNEYRKRFLQRFIIPSSKWFNSIEWDSRT 110

Query: 125 -KPKISFHKLINSDVQLDTKLKDLDP----MEFQPAQLMENPLNVGDLVLLKVKPNELAM 179
             PK S + ++NS    D   + +      + F    L  +PLN+GDL+LL    N L M
Sbjct: 111 ITPKFSKY-MLNSTFSFDAWYQKIISNSFNLTFTKHSLELDPLNIGDLILLPDSSN-LLM 168

Query: 180 CVSLPSSTMDPRYTFVAIDGTMCFATKNRVLLRIPHKLP--VGVNSLIQPEGHHKHLPIG 237
           CV +P +T DPRYTF + DG + F T++ + LRIP+KLP  +  + L+  E  H +  IG
Sbjct: 169 CVDIPHNTKDPRYTFASSDGKLFFKTRSNIPLRIPNKLPNYLMDSRLLFTEFDHGNNSIG 228

Query: 238 TLKNISNQTNILPIVTRQLITSRYPAQISKLAWKCLPITTKKLQLLHRSLQNYMGPWQIP 297
           T+KN  N   +LPI+ RQL+       ++K A   L I  KKL+L+HR +QN  GP+QI 
Sbjct: 229 TIKNTQNIKILLPIIARQLVVRPILNNLNKSANDKLSIILKKLELIHRLIQNGNGPYQIS 288

Query: 298 FFTLVGLVQKLDLNKALDGK---YGIDYLTDLVNNYHTADNVA--INSPTFVSTYWAILQ 352
           FF L+ L+  L+LN   + K     +++   L +N   + N +  I++ TF++TYWAI  
Sbjct: 289 FFKLIKLIDILNLNDFDNSKKFDINLNFSKLLSSNEIESLNSSTEIDASTFLATYWAIRL 348

Query: 353 QQESNLWGEIHLNTALLSPISVTIVPLKSQHLYYAQVIEKLE---ANSYKEVNTFV---- 405
           QQ+  LWG+I +N ALLSPISVT++PL   H YY   +++      N    +++F+    
Sbjct: 349 QQQDFLWGKIQVNKALLSPISVTVLPLVLYHNYYNNFLQRSNNAIKNGKSLLDSFIDDIN 408

Query: 406 ----------------------KLVNERKYRDISNLYPSVIQLLKDFAAGNFHNNGIIVT 443
                                         ++IS  YP  I + +++ AGNF +N  I+ 
Sbjct: 409 NQSTTNTTNNNNNTTIITTTTTNNNKLDSSKNISQNYPEFINIFQNYCAGNFDDNSKIIA 468

Query: 444 LISKIFRKIVRYKDYDITRDVCQDLIN 470
           LISKI R++ ++KD D+T+D C++L++
Sbjct: 469 LISKILRRLTKFKDSDLTKDTCKELLD 495

>CAGL0H04411g Chr8 complement(415101..418124) [3024 bp, 1007 aa]
           {ON} highly similar to uniprot|Q08162 Saccharomyces
           cerevisiae YOL021c DIS3
          Length = 1007

 Score = 65.9 bits (159), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 97/449 (21%), Positives = 173/449 (38%), Gaps = 88/449 (19%)

Query: 522 RYDFGDLRVFCIDSDTAHEIDDGVSVENHGK---DGMYTLHIHIADPTSMFPESTAIDSV 578
           R D  D  +  ID     +IDD +    H K   +G + + +HIAD T      TA+D+ 
Sbjct: 537 RRDLRDKLICSIDPPNCVDIDDAL----HAKMLENGNWEVGVHIADVTHFVKPGTALDAE 592

Query: 579 GISTDILNIAFKRSFTTYLPDVVVPMLPQAICHLSDLGKHGKRTKTISFSVDVKVGYQGC 638
           G S         R  + YL D  + MLP  +   +DL          +FSV  ++     
Sbjct: 593 GAS---------RGTSVYLVDKRIDMLPMLLG--TDLCSLKPYVDRFAFSVLWELDQDAN 641

Query: 639 GKSLEIMYDSFRIRKGFVSNFPKATYDDVDKILSAPDNESSPVKADLESLSMISKLLREQ 698
             +++      R R+ F     +   DD         N++  +   + +L  +SK L+++
Sbjct: 642 IVNVDFTKSVIRSREAFSYEQAQIRIDD--------PNQTDELTQGMRALLQLSKKLKQK 693

Query: 699 RIKKNNAVIFGEGFNKGMVTLNANAEGELTEVSFSNQEETPSTVLVSEMMILANTLTGRY 758
           R+            + G + L A+ E    +V   ++   P+ V + +++   N+L   +
Sbjct: 694 RL------------DAGALNL-ASPE---VKVHMDSETSDPNEVEIKKLLA-TNSLVEEF 736

Query: 759 FAENNIGGVFRCYKQLPLDLIAQQQYDSMITG---------TKKGLF------------- 796
               NI    + Y   P   + ++      T          TKKGL              
Sbjct: 737 MLLANISVARKIYDSFPQTAMLRRHAAPPSTNFEILNEMLQTKKGLTISLESSKALADSL 796

Query: 797 --------PKLRDIVKLSS----LLNSSFYTG----RPFRHEMIGAKQYLTVTSPLRRFP 840
                   P    +V++ S    +    FY+G      FRH  +    Y   TSP+RR+ 
Sbjct: 797 DRCVDKNDPYFNTLVRIMSTRCMMAAQYFYSGAYSYSDFRHYGLAVDIYTHFTSPIRRYC 856

Query: 841 DLINHLQIHRHLQKKPLCFT---QTQIDSLIWSIQSRADILKRASRDSSTYWTLNYLKKL 897
           D++ H Q+   +  +PL  T   +T++D +  +I  +    + A R S  Y+    ++  
Sbjct: 857 DVVAHRQLAAAIGYEPLSLTHRDKTKMDMICKNINRKHRNAQFAGRASIEYYVGQVMRNN 916

Query: 898 AKSDPGRTYDV----MITSVPQNGFAGCV 922
              + G    V    ++  VP+ G  G +
Sbjct: 917 ESVETGYVIKVFNNGIVVLVPKFGVEGLI 945

>Smik_15.145 Chr15 complement(248837..251842) [3006 bp, 1001 aa]
           {ON} YOL021C (REAL)
          Length = 1001

 Score = 63.9 bits (154), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 92/441 (20%), Positives = 168/441 (38%), Gaps = 72/441 (16%)

Query: 522 RYDFGDLRVFCIDSDTAHEIDDGVSVENHGK---DGMYTLHIHIADPTSMFPESTAIDSV 578
           R D  D  +  ID     +IDD +    H K   +G + + +HIAD T      TA+D+ 
Sbjct: 531 RKDLRDKLICSIDPPGCVDIDDAL----HAKRLPNGNWEVGVHIADVTHFVKPGTALDAE 586

Query: 579 GISTDILNIAFKRSFTTYLPDVVVPMLPQAICHLSDLGKHGKRTKTISFSVDVKVGYQGC 638
           G +         R  + YL D  + MLP  +   +DL          +FSV  ++     
Sbjct: 587 GAA---------RGTSVYLVDKRIDMLPMLLG--TDLCSLKPYVDRFAFSVIWELDENAN 635

Query: 639 GKSLEIMYDSFRIRKGFVSNFPKATYDDVDKILSAPDNESSPVKADLESLSMISKLLREQ 698
             +++ M    R R+ F     +   DD+        N++  +   + +L  +S  L+++
Sbjct: 636 IVNVDFMKSVIRSREAFSYEQAQLRIDDI--------NQNDELTLGMRALLQLSVKLKQK 687

Query: 699 RIKKNNAVIFGEGFNKGMVTLNANAEGELT---EVSFSNQEETPSTVLVSEMMILANTLT 755
           R++           N     +  + + E +   EV       T S  LV E M+LAN   
Sbjct: 688 RLEAG-------ALNLASPEVKVHMDSETSDPNEVEIKKLLATNS--LVEEFMLLANISV 738

Query: 756 GRYFAE-------------------NNIGGVFRCYKQLPLDLIAQQQYDSMITGTKKGLF 796
            R   +                     +  +    K + + L + +     +        
Sbjct: 739 ARKIYDAFPQTAMLRRHAAPPSTNFETLNEMLNTRKNMSISLESSKALADSLDRCVDPED 798

Query: 797 PKLRDIVKLSS----LLNSSFYTGR----PFRHEMIGAKQYLTVTSPLRRFPDLINHLQI 848
           P    +V++ S    +    FY+G      FRH  +    Y   TSP+RR+ D++ H Q+
Sbjct: 799 PYFNTLVRIMSTRCMMAAQYFYSGAYSYPDFRHYGLAVDIYTHFTSPIRRYCDVVAHRQL 858

Query: 849 HRHLQKKPLCFT---QTQIDSLIWSIQSRADILKRASRDSSTYWTLNYLKKLAKSDPGRT 905
              +  +PL  T   + ++D +  +I  +    + A R S  Y+    ++    ++ G  
Sbjct: 859 AGAIGYEPLSLTHRDKNKMDMICRNINRKHRNAQFAGRASIEYYVGQVMRNNESTETGYV 918

Query: 906 YDV----MITSVPQNGFAGCV 922
             V    ++  VP+ G  G +
Sbjct: 919 IKVFNNGIVVLVPKFGVEGLI 939

>Ecym_2715 Chr2 complement(1383023..1385989) [2967 bp, 988 aa] {ON}
           similar to Ashbya gossypii AEL031C
          Length = 988

 Score = 61.2 bits (147), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 101/465 (21%), Positives = 182/465 (39%), Gaps = 76/465 (16%)

Query: 522 RYDFGDLRVFCIDSDTAHEIDDGVSVENHGK---DGMYTLHIHIADPTSMFPESTAIDSV 578
           R D  D  +  ID     +IDD +    H K   +G + + +HIAD T     +TA+D+ 
Sbjct: 519 RRDMRDKLICSIDPPGCVDIDDAL----HAKKLINGNWEVGVHIADVTHFVKPNTALDAE 574

Query: 579 GISTDILNIAFKRSFTTYLPDVVVPMLPQAICHLSDLGKHGKRTKTISFSVDVKVGYQGC 638
           G S         R+ + YL D  + MLP  +   +DL          +FSV  ++     
Sbjct: 575 GAS---------RATSVYLVDKRIDMLPMLLG--TDLCSLKASVDRFAFSVIWELDNDAN 623

Query: 639 GKSLEIMYDSFRIRKGFVSNFPKATYDDVDKILSAPDNESSPVKADLESLSMISKLLREQ 698
             S+E      R R+ F       +Y+     +  P N++  +   + +L  +SK L+++
Sbjct: 624 IVSVEFTKSVIRSREAF-------SYEQAQLRIDDP-NQNDELTLGMRALLQLSKKLKQK 675

Query: 699 RIKKNNAVIFGEGFNKGMVTLNANAEGELTEVSFSNQEETPST-VLVSEMMILANTLTGR 757
           R+            N     +  + + E ++ S    ++  ST  LV E M+LAN    R
Sbjct: 676 RLDAG-------ALNLASPEVKVHMDSETSDPSEVEIKKLLSTNSLVEEFMLLANISVAR 728

Query: 758 YFAEN-------------------NIGGVFRCYKQLPLDLIAQQQY-DSM--ITGTKKGL 795
              ++                   ++  + +  K + + L + +   DS+     +    
Sbjct: 729 KIYDSFPQTAMLRRHAAPPSTNFESLNEMLQVRKNMSISLESSKALADSLDRCVDSDDVY 788

Query: 796 FPKLRDIVKLSSLLNSS-FYTG----RPFRHEMIGAKQYLTVTSPLRRFPDLINHLQIHR 850
           F  L  I+    ++ +  FY+G      FRH  +    Y   TSP+RR+ D+I H Q+  
Sbjct: 789 FNTLVRIMSTRCMMAAQYFYSGAYSYSDFRHYGLAVDIYTHFTSPIRRYCDIIAHRQLAA 848

Query: 851 HLQKKPLCFT---QTQIDSLIWSIQSRADILKRASRDSSTYWTLNYLKKLAKSDPGRTYD 907
            +  + L  +   + +++ +  +I  R    + A R S  Y     ++     + G    
Sbjct: 849 AIGYESLDLSHRDKQKMEIICRNINKRHRNAQFAGRASIEYHVGQVMRNNESIETGYVIK 908

Query: 908 V----MITSVPQNGFAGCV--------FPSLSFARGTLKLQPKAK 940
           V    +   VP+ G  G +        F +L F     KL  + K
Sbjct: 909 VFNNGIAVLVPKFGVEGLILAENLTTDFQTLDFVEEEFKLSFRDK 953

>Skud_15.137 Chr15 complement(241849..244941) [3093 bp, 1030 aa]
           {ON} YOL021C (REAL)
          Length = 1030

 Score = 59.7 bits (143), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 91/441 (20%), Positives = 166/441 (37%), Gaps = 72/441 (16%)

Query: 522 RYDFGDLRVFCIDSDTAHEIDDGVSVENHGK---DGMYTLHIHIADPTSMFPESTAIDSV 578
           R D  D  +  ID     +IDD +    H +   +G + + +HIAD T     STA+D+ 
Sbjct: 560 RKDLRDKVICSIDPPGCVDIDDAL----HARKLPNGNWEVGVHIADVTHFVKPSTALDAE 615

Query: 579 GISTDILNIAFKRSFTTYLPDVVVPMLPQAICHLSDLGKHGKRTKTISFSVDVKVGYQGC 638
           G +         R  + YL D  + MLP  +   +DL          +FSV  ++     
Sbjct: 616 GAA---------RGTSVYLVDKRIDMLPMLLG--TDLCSLKPYVDRFAFSVMWELDDNAD 664

Query: 639 GKSLEIMYDSFRIRKGFVSNFPKATYDDVDKILSAPDNESSPVKADLESLSMISKLLREQ 698
             ++E M    + R+ F     +   DD         N+   +   + +L  +S  L+++
Sbjct: 665 IVNVEFMKSVIKSREAFSYEQAQLRIDD--------KNQDDELTLGMRALLKLSIKLKQK 716

Query: 699 RIKKNNAVIFGEGFNKGMVTLNANAEGELT---EVSFSNQEETPSTVLVSEMMILANTLT 755
           R++           N     +  + + E +   EV       T S  LV E M+LAN   
Sbjct: 717 RLEAG-------ALNLASPEVKVHMDSETSDPNEVEIKKLLATNS--LVEEFMLLANISV 767

Query: 756 GRYFAE-------------------NNIGGVFRCYKQLPLDLIAQQQYDSMITGTKKGLF 796
            R   +                     +  +    K + + L + +     +        
Sbjct: 768 ARKIYDAFPQTAMLRRHAAPPSTNFETLNEMLNTRKNMSISLESSKALADSLDRCVDSED 827

Query: 797 PKLRDIVKLSS----LLNSSFYTGR----PFRHEMIGAKQYLTVTSPLRRFPDLINHLQI 848
           P    +V++ S    +    FY+G      FRH  +    Y   TSP+RR+ D++ H Q+
Sbjct: 828 PYFNTLVRIMSTRCMMAAQYFYSGAYSYPDFRHYGLAVDIYTHFTSPIRRYCDVVAHRQL 887

Query: 849 HRHLQKKPLCFT---QTQIDSLIWSIQSRADILKRASRDSSTYWTLNYLKKLAKSDPGRT 905
              +  +PL      + ++D +  +I  +    + A R S  Y+    ++    ++ G  
Sbjct: 888 AGAIGYEPLSLAHRDKNKMDMICRNINRKHRNAQFAGRASIEYYVGQVMRSNESTETGYI 947

Query: 906 YDV----MITSVPQNGFAGCV 922
             V    ++  VP+ G  G +
Sbjct: 948 IKVFNNGIVVLVPKFGVEGLI 968

>KAFR0C04530 Chr3 (904255..907257) [3003 bp, 1000 aa] {ON} Anc_1.367
           YOL021C
          Length = 1000

 Score = 59.7 bits (143), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 100/458 (21%), Positives = 181/458 (39%), Gaps = 73/458 (15%)

Query: 506 TNIEDLQRENSGND---SDRYDFGDLRVFCIDSDTAHEIDDGVSVENHGK---DGMYTLH 559
           +NI+D   E   ND   + R D  D  +  ID     +IDD +    H K   +G + + 
Sbjct: 513 SNIKD--PEALANDPLLAKRTDLRDKLICSIDPPGCVDIDDAL----HAKRLPNGNWEVG 566

Query: 560 IHIADPTSMFPESTAIDSVGISTDILNIAFKRSFTTYLPDVVVPMLPQAICHLSDLGKHG 619
           +HIAD T      TA+D+ G S         R  + YL D  + MLP  +   +DL    
Sbjct: 567 VHIADVTHFVKPGTALDAEGAS---------RGTSVYLVDKRIDMLPMLLG--TDLCSLK 615

Query: 620 KRTKTISFSVDVKVGYQGCGKSLEIMYDSFRIRKGFVSNFPKATYDDVDKILSAPDNESS 679
                 +FSV  ++       +++      R R+ F     +   DD         N+  
Sbjct: 616 PYVDRFAFSVIWELNEDADIVNVDFTKSVIRSREAFSYEQAQVRIDD--------SNQKD 667

Query: 680 PVKADLESLSMISKLLREQRIKKNNAVIFGEGFNKGMVTLNAN-AEGELTEVSFSNQEET 738
            +   + +L  +SK L+++R+      +        M +  ++  E E+ ++  +N    
Sbjct: 668 ELTLGMRALLHLSKKLKQKRLDAGALNLASPEVKVHMDSETSDPGEVEIKKLLATNS--- 724

Query: 739 PSTVLVSEMMILANTLTGR--YFAENNIGGVFRCYK------QLPLDLIAQQQYDSMITG 790
               LV E M+LAN    R  Y A      + R         +L  +++ Q++  ++   
Sbjct: 725 ----LVEEFMLLANISVARKIYDAFPQTAMLRRHAAPPSTNFELLNEMLHQRKNMTISLE 780

Query: 791 TKKGL--------------FPKLRDIVKLSSLLNSS-FYTGR----PFRHEMIGAKQYLT 831
           + K L              F  L  I+    ++ +  FY+G      F+H  +    Y  
Sbjct: 781 SSKALADSLDRCIDPQDAYFNTLVRIMSTRCMMAAQYFYSGAYSYPDFKHYGLAVDIYTH 840

Query: 832 VTSPLRRFPDLINHLQIHRHLQKKPLCFT---QTQIDSLIWSIQSRADILKRASRDSSTY 888
            TSP+RR+ D++ H Q+   +  +PL      + ++D +  +I  +    + A R S  Y
Sbjct: 841 FTSPIRRYCDVVAHRQLAAAIDYEPLSLMHRDKNKMDMVCRNINKKHRNAQFAGRASIEY 900

Query: 889 WTLNYLKKLAKSDPGRTYDV----MITSVPQNGFAGCV 922
           +    ++     + G    V    ++  VP+ G  G +
Sbjct: 901 YVGQVMRNNESVETGYVIKVFNNGIVVLVPKFGVEGLI 938

>Suva_15.147 Chr15 complement(255214..258219) [3006 bp, 1001 aa]
           {ON} YOL021C (REAL)
          Length = 1001

 Score = 59.7 bits (143), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 93/439 (21%), Positives = 180/439 (41%), Gaps = 68/439 (15%)

Query: 522 RYDFGDLRVFCIDSDTAHEIDDGVSVENHGK---DGMYTLHIHIADPTSMFPESTAIDSV 578
           R D  D  +  ID     +IDD +    H K   +G + + +HIAD T     +TA+D+ 
Sbjct: 531 RKDLRDKLICSIDPPGCVDIDDAL----HAKRLPNGNWEVGVHIADVTHFVKPNTALDAE 586

Query: 579 GISTDILNIAFKRSFTTYLPDVVVPMLPQAICHLSDLGKHGKRTKTISFSVDVKVGYQGC 638
           G +         R  + YL D  + MLP  +   +DL          +FSV  ++     
Sbjct: 587 GAA---------RGTSVYLVDKRIDMLPMLLG--TDLCSLKPYVDRFAFSVIWELDDDAN 635

Query: 639 GKSLEIMYDSFRIRKGFVSNFPKATYDDVDKILSAPDNESSPVKADLESLSMISKLLREQ 698
             +++ M    + R+ F  ++ +A +   DK      N++  + + + +L  +S  L+++
Sbjct: 636 IVNVDFMKSVIKSREAF--SYEQAQFRIDDK------NQNDELTSGMRALLELSIKLKQK 687

Query: 699 RIKKNNAVIFGEGFNKGMVTLNANA-EGELTEVSFSNQEETPSTVLVSEMMILANTLTGR 757
           R++     +        M +  ++  E E+ ++  +N        LV E M+LAN    R
Sbjct: 688 RLEAGALNLASPEVKVHMDSETSDPNEVEIKKLLATNS-------LVEEFMLLANISVAR 740

Query: 758 YFAEN-NIGGVFRCYKQLPL-------DLIAQQQYDSMITGTKKGLF-----------PK 798
              +      + R +   P        +++  ++  S+   + K L            P 
Sbjct: 741 KIYDAFPQTAMLRRHAAPPSTNFEIMNEMLNTRKNMSISLESSKALADSLDRCVDPEDPY 800

Query: 799 LRDIVKLSS----LLNSSFYTGR----PFRHEMIGAKQYLTVTSPLRRFPDLINHLQIHR 850
              +V++ S    +    FY+G      FRH  +    Y   TSP+RR+ D++ H Q+  
Sbjct: 801 FNTLVRIMSTRCMMAAQYFYSGAYSYPDFRHYGLAVDIYTHFTSPIRRYCDVVAHRQLAG 860

Query: 851 HLQKKPLCFT---QTQIDSLIWSIQSRADILKRASRDSSTYWTLNYLKKLAKSDPGRTYD 907
            +  +PL  T   + ++D +  +I  +    + A R S  Y+    ++    ++ G    
Sbjct: 861 AIGYEPLSLTHRDKNKMDMICRNINRKHRNAQFAGRASIEYYVGQVMRNNESTETGYVIK 920

Query: 908 V----MITSVPQNGFAGCV 922
           V    ++  VP+ G  G +
Sbjct: 921 VFNNGIVVLVPKFGVEGLI 939

>TPHA0A02320 Chr1 complement(485855..488902) [3048 bp, 1015 aa] {ON}
           Anc_1.367 YOL021C
          Length = 1015

 Score = 59.3 bits (142), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 103/464 (22%), Positives = 183/464 (39%), Gaps = 85/464 (18%)

Query: 506 TNIEDLQRENSGND---SDRYDFGDLRVFCIDSDTAHEIDDGVSVENHGK---DGMYTLH 559
           TNI D Q +    D    +R D  D  +  ID     +IDD +    H K   +G + + 
Sbjct: 528 TNINDPQEQ--AKDPLLKNRQDLRDKLICSIDPPGCVDIDDAL----HAKRLPNGNWEVG 581

Query: 560 IHIADPTSMFPESTAIDSVGISTDILNIAFKRSFTTYLPDVVVPMLPQAICHLSDLGKHG 619
           +HIAD T      TA+D+ G S         R  + YL D  + MLP  +   +DL    
Sbjct: 582 VHIADVTHFVKPGTALDAEGAS---------RGTSVYLVDKRIDMLPMLLG--TDLCSLK 630

Query: 620 KRTKTISFSVDVKVGYQGCGKSLEIMYDSFRIRKGFVSNFPKATYDDVDKILSAPDNESS 679
                 +FSV  ++        ++      R R+ F     +   DD         N++ 
Sbjct: 631 PYVDRFAFSVIWELDDNAEIIDVKFTKSVIRSREAFSYEQAQLRIDD--------KNQTD 682

Query: 680 PVKADLESLSMISKLLREQRIKKNNAVIFGEGFNKGMVTLNANAEGEL---TEVSFSNQE 736
            +   + +L  +S  L+++R+            + G + L A+ E ++   +E S  N+ 
Sbjct: 683 ELTKGMRALLELSVKLKQKRL------------DAGALNL-ASPEVKVHMDSETSDPNEV 729

Query: 737 ET----PSTVLVSEMMILANTLTGR-YFAENNIGGVFRCYKQLPL-------DLIAQQQY 784
           E      +  LV E M+LAN    R  F       + R +   P        +++ +++ 
Sbjct: 730 EIKKLLATNSLVEEFMLLANISVARKIFDAFPQTAMLRRHASPPSTNFAILNEMLQKRKN 789

Query: 785 DSMITGTKKGLF-----------PKLRDIVKLSS----LLNSSFYTG----RPFRHEMIG 825
            S+   + K L            P    ++++ S    +    FY+G      FRH  + 
Sbjct: 790 LSISLESSKALADSLDRCIDPKDPYFNTLIRIMSTRCMMAAQYFYSGAYQYSDFRHYGLA 849

Query: 826 AKQYLTVTSPLRRFPDLINHLQIHRHLQKKPLCFT---QTQIDSLIWSIQSRADILKRAS 882
              Y   TSP+RRF D+I H Q+   +  +PL      + +++ +  +I  +    + A 
Sbjct: 850 VDIYTHFTSPIRRFCDVIAHRQLAGAIGYEPLALMHRDKNKMEMICKNINKKHRNAQFAG 909

Query: 883 RDSSTYWTLNYLKKLAKSDPGRTYDVM----ITSVPQNGFAGCV 922
           R S  Y+    ++    ++ G    V+    +  VP+ G  G +
Sbjct: 910 RASIEYYVGQVMRNNECTETGYVIKVLNNGIVVLVPKFGVEGLI 953

>KNAG0C01950 Chr3 (377736..380726) [2991 bp, 996 aa] {ON} Anc_1.367
           YOL021C
          Length = 996

 Score = 58.9 bits (141), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 97/441 (21%), Positives = 169/441 (38%), Gaps = 68/441 (15%)

Query: 520 SDRYDFGDLRVFCIDSDTAHEIDDGVSVENHGK---DGMYTLHIHIADPTSMFPESTAID 576
           + R D  D  +  ID     +IDD +    H K   +G + + +HIAD T      TA+D
Sbjct: 524 AKRKDLRDKLICSIDPPGCVDIDDAL----HAKKLPNGHWEVGVHIADVTHFVKPGTALD 579

Query: 577 SVGISTDILNIAFKRSFTTYLPDVVVPMLPQAICHLSDLGKHGKRTKTISFSVDVKVGYQ 636
           + G S         R  + YL D  + MLP  +   +DL          +FSV  ++   
Sbjct: 580 AEGAS---------RGTSVYLVDKRIDMLPMLLG--TDLCSLKPYVDRFAFSVIWELDEN 628

Query: 637 GCGKSLEIMYDSFRIRKGFVSNFPKATYDDVDKILSAPDNESSPVKADLESLSMISKLLR 696
               ++E      R R+ F     +   DD             P + D  +L M + L  
Sbjct: 629 ADIINVEFHKSVIRSREAFAYEQAQLRIDD-------------PKQQDELTLGMRALLQL 675

Query: 697 EQRIKKNNAVIFGEGFNKGMVTLNANAE-GELTEVSFSNQEETPSTVLVSEMMILANTLT 755
             ++K+              V ++ ++E  +  EV       T S  LV E M+LAN   
Sbjct: 676 SIKLKQKRLEAGALNLASPEVKVHMDSETSDPGEVEIKKLLATNS--LVEEFMLLANISV 733

Query: 756 GRYFAEN-NIGGVFRCYKQLPL-------DLIAQQQYDSMITGTKKGLF----------- 796
            R   ++     + R +   P        +++ +++  S+   + K L            
Sbjct: 734 ARKIYDSFPQTAMLRRHAPPPATNFEILNEMLQRRKNMSISVESSKALADSLDRCEDPKD 793

Query: 797 PKLRDIVKLSS----LLNSSFYTGR----PFRHEMIGAKQYLTVTSPLRRFPDLINHLQI 848
           P    +V++ S    +    FY+G      FRH  +    Y   TSP+RR+ D++ H Q+
Sbjct: 794 PYFNTLVRIMSTRCMMAAQYFYSGAYSYPDFRHYGLAVDIYTHFTSPIRRYCDIVAHRQL 853

Query: 849 HRHLQKKPLCF---TQTQIDSLIWSIQSRADILKRASRDSSTYWTLNYLKKLAKSDPGRT 905
              +  +PL      + ++D +  +I  +    + A R S  Y+    +K     + G  
Sbjct: 854 AGAIDYEPLSLDHRDKHKMDMICRNINRKHRNAQFAGRASIEYYVGQVMKNNESLESGYV 913

Query: 906 YDV----MITSVPQNGFAGCV 922
             V    ++  VP+ G  G +
Sbjct: 914 IKVFNNGIVVLVPKFGVEGLI 934

>TDEL0D02380 Chr4 complement(463000..465993) [2994 bp, 997 aa] {ON}
           Anc_1.367 YOL021C
          Length = 997

 Score = 58.5 bits (140), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 97/445 (21%), Positives = 178/445 (40%), Gaps = 80/445 (17%)

Query: 522 RYDFGDLRVFCIDSDTAHEIDDGVSVENHGK---DGMYTLHIHIADPTSMFPESTAIDSV 578
           R D  D  +  ID     +IDD +    H K   +G + + +HIAD T     +TA+D+ 
Sbjct: 527 RRDLRDKLICSIDPPGCVDIDDAL----HAKRLSNGNWEVGVHIADVTHFVKPNTALDAE 582

Query: 579 GISTDILNIAFKRSFTTYLPDVVVPMLPQAICHLSDLGKHGKRTKTISFSVDVKVGYQGC 638
           G S         R  + YL D  + MLP  +   +DL       +  +FSV  ++     
Sbjct: 583 GAS---------RGTSVYLVDKRIDMLPMLLG--TDLCSLKPYVERFAFSVIWELDDNAN 631

Query: 639 GKSLEIMYDSFRIRKGFVSNFPKATYDDVDKILSAPDNESSPVKADLESLSMISKLLREQ 698
             +++ M    + R+ F       +Y+     +  P N+   +   + +L  +S  L+++
Sbjct: 632 IVNVDFMKSVIKSREAF-------SYEQAQLRIDDP-NQKDELTEGMRALLQLSIKLKQK 683

Query: 699 RIKKNNAVIFGEGFNKGMVTLNANAEGEL---TEVSFSNQEET----PSTVLVSEMMILA 751
           R+            + G + L A+ E ++   +E S  N+ E      +  LV E M+LA
Sbjct: 684 RL------------DAGALNL-ASPEVKVHMDSETSDPNEVEIKKLLATNSLVEEFMLLA 730

Query: 752 NTLTGR-YFAENNIGGVFRCYKQLPL-------DLIAQQQYDSMITGTKKGLF------- 796
           N    R  F       + R +   P        +++  ++  S+   + K L        
Sbjct: 731 NISVARKIFDAFPQTAMLRRHAAPPSTNFETLNEMLQTRKGLSISIESSKALADSLDRCI 790

Query: 797 ----PKLRDIVKLSS----LLNSSFYTG----RPFRHEMIGAKQYLTVTSPLRRFPDLIN 844
               P    +V++ S    +    FY+G      FRH  +    Y   TSP+RR+ D++ 
Sbjct: 791 DPQDPYFNTLVRIMSTRCMMAAQYFYSGAYSYADFRHYGLAVDIYTHFTSPIRRYCDVVA 850

Query: 845 HLQIHRHLQKKPLCFT---QTQIDSLIWSIQSRADILKRASRDSSTYWTLNYLKKLAKSD 901
           H Q+   +  +PL      + ++D +  +I  +    + A R S  Y+    ++     +
Sbjct: 851 HRQLAGAIGYEPLDLMHRDKNKMDMICRNINKKHRNAQFAGRASIEYYVGQVMRNNETVE 910

Query: 902 PGRTYDVM----ITSVPQNGFAGCV 922
            G    V+    +  VP+ G  G +
Sbjct: 911 AGYVIKVLNNGIVVLVPRFGVEGLI 935

>ZYRO0G01166g Chr7 complement(91672..94653) [2982 bp, 993 aa] {ON}
           highly similar to uniprot|Q08162 Saccharomyces
           cerevisiae YOL021C DIS3 Nucleolar exosome component
           involved in rRNA processing and RNA degradation binds
           Gsp1p/Ran and enhances the GEF activity of Srm1p
           implicated in mitotic control homologous to the E. coli
           RNase R of the RNase II family
          Length = 993

 Score = 58.5 bits (140), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 94/449 (20%), Positives = 172/449 (38%), Gaps = 88/449 (19%)

Query: 522 RYDFGDLRVFCIDSDTAHEIDDGVSVENHGK---DGMYTLHIHIADPTSMFPESTAIDSV 578
           R D  D  +  ID     +IDD +    H K   +G + + +HIAD T     +TA+D  
Sbjct: 523 RRDLRDKLICSIDPPGCVDIDDAL----HAKKLPNGNWEVGVHIADVTHFVKPNTALDGE 578

Query: 579 GISTDILNIAFKRSFTTYLPDVVVPMLPQAICHLSDLGKHGKRTKTISFSVDVKVGYQGC 638
           G S         R  + YL D  + MLP  +   +DL          +FSV  ++     
Sbjct: 579 GAS---------RGTSVYLVDKRIDMLPMLLG--TDLCSLKPYVDRFAFSVLWELNENAD 627

Query: 639 GKSLEIMYDSFRIRKGFVSNFPKATYDDVDKILSAPDNESSPVKADLESLSMISKLLREQ 698
             +++      + R+ F       +Y+     +  P N+   +   + +L  +S  L+E+
Sbjct: 628 IVNVDFAKSVIKSREAF-------SYEQAQLRIDDP-NQQDELTHGMRALLKLSIKLKEK 679

Query: 699 RIKKNNAVIFGEGFNKGMVTLNANAEGELTEVSFSNQEETPSTVLVSEMMILANTLTGRY 758
           RI            N G + L A+ E    +V   ++   P+ V + +++   N+L   +
Sbjct: 680 RI------------NAGALNL-ASPE---VKVHMDSETSDPNEVEIKKLLA-TNSLVEEF 722

Query: 759 FAENNIGGVFRCYKQLPLDLIAQQQYDSMITG---------TKKGLF------------- 796
               NI    + Y   P   + ++      T          T+KG+              
Sbjct: 723 MLLANISVARKIYDSFPQTAMLRRHASPPSTNFELLNEMLQTRKGMSISLESSKALADSL 782

Query: 797 --------PKLRDIVKLSS----LLNSSFYTG----RPFRHEMIGAKQYLTVTSPLRRFP 840
                   P    +V++ S    +    FY+G      FRH  +    Y   TSP+RR+ 
Sbjct: 783 DRCIDPKDPYFNTLVRIMSTRCMMAAQYFYSGAYSYSDFRHYGLAVDIYTHFTSPIRRYC 842

Query: 841 DLINHLQIHRHLQKKPLCFT---QTQIDSLIWSIQSRADILKRASRDSSTYWTLNYLKKL 897
           D++ H Q+   +  +PL  +   + ++D +  +I  +    + A R S  Y+    ++  
Sbjct: 843 DVVAHRQLAGAIGYEPLDLSHRDKNRMDMICKNINKKHRNAQFAGRASIEYYVGQVMRNN 902

Query: 898 AKSDPGRTYDVM----ITSVPQNGFAGCV 922
              + G    V+    +  VP+ G  G +
Sbjct: 903 ESVETGYVIKVLNNGIVVLVPKFGVEGLI 931

>NDAI0H03560 Chr8 (869622..872660) [3039 bp, 1012 aa] {ON} Anc_1.367
           YOL021C
          Length = 1012

 Score = 57.4 bits (137), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 94/440 (21%), Positives = 179/440 (40%), Gaps = 66/440 (15%)

Query: 520 SDRYDFGDLRVFCIDSDTAHEIDDGVSVENHGK---DGMYTLHIHIADPTSMFPESTAID 576
           ++R D  D  +  ID     +IDD +    H K   +G + + +HIAD T    + TA+D
Sbjct: 540 ANRKDLRDKLICSIDPPGCVDIDDAL----HAKKLPNGNWEVGVHIADVTHFVKQGTALD 595

Query: 577 SVGISTDILNIAFKRSFTTYLPDVVVPMLPQAICHLSDLGKHGKRTKTISFSVDVKVGYQ 636
           + G S         R  + YL D  + MLP  +   +DL          +FSV  ++   
Sbjct: 596 AEGAS---------RGTSVYLVDKRIDMLPMLLG--TDLCSLKPYVDRFAFSVLWELDSN 644

Query: 637 GCGKSLEIMYDSFRIRKGFVSNFPKATYDDVDKILSAPDNESSPVKADLESLSMISKLLR 696
                ++      + R+ F       +Y+     +  P N++  +   + +L  +S  L+
Sbjct: 645 ADIVKVDFTKSVIKSREAF-------SYEQAQLRIDDP-NQTDDLTQGMRALLQLSIKLK 696

Query: 697 EQRIKKNNAVIFGEGFNKGMVTLNANAEGELTEVSFSNQEETPSTVLVSEMMILANTLTG 756
           ++R+  N A+       K  +    +  GE+ E+    ++   +  LV E M+LAN    
Sbjct: 697 QKRL-DNGALNLASPEVKVHMDSETSDPGEV-EI----KKLLATNSLVEEFMLLANISVA 750

Query: 757 R--YFAENNIGGVFRCYK------QLPLDLIAQQQYDSMITGTKKGLF-----------P 797
           R  Y A      + R         +L  +++ +++  S+   + K L            P
Sbjct: 751 RKIYDAFPQTAMLRRHAAPPSTNFELLNEMLHRRKNMSISLESSKALADSLDRCEDPKDP 810

Query: 798 KLRDIVKLSS----LLNSSFYTGR----PFRHEMIGAKQYLTVTSPLRRFPDLINHLQIH 849
               +V++ S    +    FY+G      F+H  +    Y   TSP+RR+ D++ H Q+ 
Sbjct: 811 YFNTLVRIMSTRCMMAAQYFYSGAYSYPDFKHYGLAVDIYTHFTSPIRRYCDVVAHRQLA 870

Query: 850 RHLQKKPLCFT---QTQIDSLIWSIQSRADILKRASRDSSTYWTLNYLKKLAKSDPGRTY 906
             +  +PL  +   + ++D +  +I  +    + A R S  Y+    ++     + G   
Sbjct: 871 GAIGYEPLSLSHRDKNKMDMICRNINKKHRNAQFAGRASIEYYVGQVMRNNETVETGYVI 930

Query: 907 DV----MITSVPQNGFAGCV 922
            V    ++  VP+ G  G +
Sbjct: 931 KVFNNGIVVLVPKFGVEGLI 950

>AEL031C Chr5 complement(574534..577527) [2994 bp, 997 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL021C
           (DIS3)
          Length = 997

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 94/449 (20%), Positives = 171/449 (38%), Gaps = 86/449 (19%)

Query: 522 RYDFGDLRVFCIDSDTAHEIDDGVSVENHGK---DGMYTLHIHIADPTSMFPESTAIDSV 578
           R D  D  +  ID     +IDD +    H K   +G + + +HIAD T      TA+D+ 
Sbjct: 528 RRDLRDKLICSIDPPGCVDIDDAL----HAKRLPNGNWEVGVHIADVTHFVKPGTALDTE 583

Query: 579 GISTDILNIAFKRSFTTYLPDVVVPMLPQAICHLSDLGKHGKRTKTISFSVDVKVGYQGC 638
           G S         R+ + YL +  + MLP  +   +DL          +FSV  ++     
Sbjct: 584 GAS---------RATSVYLVNKRIDMLPMLLG--TDLCSLKPYVDRFAFSVLWELDADAN 632

Query: 639 GKSLEIMYDSFRIRKGFVSNFPKATYDDVDKILSAPDNESSPVKADLESLSMISKLLREQ 698
             +++      R R+ F     +   DDV        N++  +   + +L  +SK L+++
Sbjct: 633 IVNVDFTKSVIRSREAFSYEAAQLRIDDV--------NQNDELTNGMRALLELSKKLKQK 684

Query: 699 RIKKNNAVIFGEGFNKGMVTLNANAEGELTEVSFSNQEETPSTV----------LVSEMM 748
           R+            + G + L A+ E    +V   N+   P+ V          LV E M
Sbjct: 685 RL------------DAGALNL-ASPE---VKVHMDNETSDPNEVEIKKLLATNSLVEEFM 728

Query: 749 ILANTLTGRYFAE-------------------NNIGGVFRCYKQLPLDLIAQQQYDSMIT 789
           +LAN    R   +                     +  + +  K++ + L + +     + 
Sbjct: 729 LLANISVARKINDAFPQTAMLRRHAAPPSTNFEALNEMLQVRKKMAISLESSKALADSLD 788

Query: 790 GTKKGLFPKLRDIVKLSS----LLNSSFYTG----RPFRHEMIGAKQYLTVTSPLRRFPD 841
                  P    +V++ S    +    FY+G      F H  +    Y   TSP+RR+ D
Sbjct: 789 RCIDPEDPYFNTLVRIMSTRCMMAAQYFYSGAFSYSDFHHYGLAVDIYTHFTSPIRRYCD 848

Query: 842 LINHLQIHRHLQKKPLCFT---QTQIDSLIWSIQSRADILKRASRDSSTYWTLNYLKKLA 898
           ++ H Q+   +  +PL  T   + +++ +  +I  R    + A R S  Y+    ++   
Sbjct: 849 VVVHRQLAGAIGYEPLDLTHRDKQKMEMICKNINRRHRNAQFAGRASIEYYVGQVMRNNH 908

Query: 899 KSDPGRTYDV----MITSVPQNGFAGCVF 923
             + G    V    +   VP+ G  G + 
Sbjct: 909 SVETGYVIKVFNNGVAVLVPKFGVEGMIL 937

>YOL021C Chr15 complement(282421..285426) [3006 bp, 1001 aa] {ON}
           DIS3Exosome core complex catalytic subunit; possesses
           both endonuclease and 3'-5' exonuclease activity;
           involved in 3'-5' RNA processing and degradation in both
           the nucleus and the cytoplasm; has similarity to E. coli
           RNase R and to human DIS3
          Length = 1001

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 95/441 (21%), Positives = 166/441 (37%), Gaps = 72/441 (16%)

Query: 522 RYDFGDLRVFCIDSDTAHEIDDGVSVENHGK---DGMYTLHIHIADPTSMFPESTAIDSV 578
           R D  D  +  ID     +IDD +    H K   +G + + +HIAD T      TA+D+ 
Sbjct: 531 RKDLRDKLICSIDPPGCVDIDDAL----HAKKLPNGNWEVGVHIADVTHFVKPGTALDAE 586

Query: 579 GISTDILNIAFKRSFTTYLPDVVVPMLPQAICHLSDLGKHGKRTKTISFSVDVKVGYQGC 638
           G +         R  + YL D  + MLP  +   +DL          +FSV  ++     
Sbjct: 587 GAA---------RGTSVYLVDKRIDMLPMLLG--TDLCSLKPYVDRFAFSVIWELDDSAN 635

Query: 639 GKSLEIMYDSFRIRKGFVSNFPKATYDDVDKILSAPDNESSPVKADLESLSMISKLLREQ 698
             ++  M    R R+ F     +   DD               K   + L+M  + L + 
Sbjct: 636 IVNVNFMKSVIRSREAFSYEQAQLRIDD---------------KTQNDELTMGMRALLKL 680

Query: 699 RIKKNNAVIFGEGFNKGMVTLNANAEGELT---EVSFSNQEETPSTVLVSEMMILANTLT 755
            +K     +     N     +  + + E +   EV       T S  LV E M+LAN   
Sbjct: 681 SVKLKQKRLEAGALNLASPEVKVHMDSETSDPNEVEIKKLLATNS--LVEEFMLLANISV 738

Query: 756 GRYFAEN-NIGGVFRCYKQLPL-------DLIAQQQYDSMITGTKKGLF----------- 796
            R   +      + R +   P        +++  ++  S+   + K L            
Sbjct: 739 ARKIYDAFPQTAMLRRHAAPPSTNFEILNEMLNTRKNMSISLESSKALADSLDRCVDPED 798

Query: 797 PKLRDIVKLSS----LLNSSFYTGR----PFRHEMIGAKQYLTVTSPLRRFPDLINHLQI 848
           P    +V++ S    +    FY+G      FRH  +    Y   TSP+RR+ D++ H Q+
Sbjct: 799 PYFNTLVRIMSTRCMMAAQYFYSGAYSYPDFRHYGLAVDIYTHFTSPIRRYCDVVAHRQL 858

Query: 849 HRHLQKKPLCFT---QTQIDSLIWSIQSRADILKRASRDSSTYWTLNYLKKLAKSDPGRT 905
              +  +PL  T   + ++D +  +I  +    + A R S  Y+    ++    ++ G  
Sbjct: 859 AGAIGYEPLSLTHRDKNKMDMICRNINRKHRNAQFAGRASIEYYVGQVMRNNESTETGYV 918

Query: 906 YDV----MITSVPQNGFAGCV 922
             V    ++  VP+ G  G +
Sbjct: 919 IKVFNNGIVVLVPKFGVEGLI 939

>NCAS0D00590 Chr4 complement(98734..101730) [2997 bp, 998 aa] {ON}
           Anc_1.367
          Length = 998

 Score = 56.6 bits (135), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 93/439 (21%), Positives = 174/439 (39%), Gaps = 68/439 (15%)

Query: 522 RYDFGDLRVFCIDSDTAHEIDDGVSVENHGK---DGMYTLHIHIADPTSMFPESTAIDSV 578
           R D  D  +  ID     +IDD +    H K   +G + + +HIAD T      TA+D+ 
Sbjct: 528 RKDLRDKLICSIDPPGCVDIDDAL----HAKRLPNGNWEVGVHIADVTHFVKPGTALDAE 583

Query: 579 GISTDILNIAFKRSFTTYLPDVVVPMLPQAICHLSDLGKHGKRTKTISFSVDVKVGYQGC 638
           G S         R  + YL D  + MLP  +   +DL          +FSV  ++     
Sbjct: 584 GAS---------RGTSVYLVDKRIDMLPMLLG--TDLCSLKPYVDRFAFSVLWELDENAD 632

Query: 639 GKSLEIMYDSFRIRKGFVSNFPKATYDDVDKILSAPDNESSPVKADLESLSMISKLLREQ 698
             +++      + R+ F     +   DD         +++  +   + +L  +S  L+++
Sbjct: 633 IVNVDFTKSVIKSREAFSYEQAQLRIDDA--------SQTDDLTQGMRALLQLSIKLKQK 684

Query: 699 RIKKNNAVIFGEGFNKGMVTLNAN-AEGELTEVSFSNQEETPSTVLVSEMMILANTLTGR 757
           R+      +        M +  ++  E E+ ++  +N        LV E M+LAN    R
Sbjct: 685 RLDAGALNLASPEVKVHMDSETSDPGEVEIKKLLATNS-------LVEEFMLLANISVAR 737

Query: 758 --YFAENNIGGVFRCYK------QLPLDLIAQQQYDSMITGTKKGLF-----------PK 798
             Y A      + R         +L  +++ Q++  S+   + K L            P 
Sbjct: 738 KIYDAFPQTAMLRRHAAPPSTNFELLNEMLHQRKNMSISLESSKALADSLDRCEDPKDPY 797

Query: 799 LRDIVKLSS----LLNSSFYTGR----PFRHEMIGAKQYLTVTSPLRRFPDLINHLQIHR 850
              +V++ S    +    FY+G      F+H  +    Y   TSP+RRF D++ H Q+  
Sbjct: 798 FNTLVRIMSTRCMMAAQYFYSGAYSYPDFKHYGLAVDIYTHFTSPIRRFCDVVAHRQLAG 857

Query: 851 HLQKKPLCFT---QTQIDSLIWSIQSRADILKRASRDSSTYWTLNYLKKLAKSDPGRTYD 907
            +  +PL  +   + ++D +  +I  +    + A R S  Y+    ++    ++ G    
Sbjct: 858 AIGYEPLDLSHRDKNKMDMICRNINRKHRNAQFAGRASIEYYVGQVMRNNESTETGYVIK 917

Query: 908 V----MITSVPQNGFAGCV 922
           V    ++  VP+ G  G +
Sbjct: 918 VFNNGIVVLVPKFGVEGLI 936

>TBLA0D05070 Chr4 (1255978..1258971) [2994 bp, 997 aa] {ON}
           Anc_1.367 YOL021C
          Length = 997

 Score = 56.2 bits (134), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 97/445 (21%), Positives = 173/445 (38%), Gaps = 80/445 (17%)

Query: 522 RYDFGDLRVFCIDSDTAHEIDDGVSVENHGK---DGMYTLHIHIADPTSMFPESTAIDSV 578
           R D  D  +  ID     +IDD +    H K   +G + + +HIAD T     +T +D+ 
Sbjct: 527 RKDLRDKLICSIDPPGCVDIDDAL----HAKKLPNGNWEVGVHIADVTHFVKPNTPLDAE 582

Query: 579 GISTDILNIAFKRSFTTYLPDVVVPMLPQAICHLSDLGKHGKRTKTISFSVDVKVGYQGC 638
           G S         R  + YL D  + MLP  +   +DL          +FSV  ++     
Sbjct: 583 GAS---------RGTSVYLVDKRIDMLPLLLG--TDLCSLKPYVDRYAFSVLWELDDNAN 631

Query: 639 GKSLEIMYDSFRIRKGFVSNFPKATYDDVDKILSAPDNESSPVKADLESLSMISKLLREQ 698
              +       R R+ F     +   DD         +++  +   + +L  +S  L+++
Sbjct: 632 IVDVNFTKSVIRSREAFSYEQAQIRIDD--------KSQTDELTQGMRALLKLSIKLKQK 683

Query: 699 RIKKNNAVIFGEGFNKGMVTLNANAEGEL---TEVSFSNQEET----PSTVLVSEMMILA 751
           R+            + G + L A+ E ++   +E S  N+ E      +  LV E M+LA
Sbjct: 684 RL------------DAGALNL-ASPEVKVHMDSETSDPNEVEIKKLLATNSLVEEFMLLA 730

Query: 752 NTLTGRYFAEN-------------------NIGGVFRCYKQLPLDLIAQQQY-DSM--IT 789
           N    R   E+                    +  +    KQ+ + L + +   DS+    
Sbjct: 731 NISVARKIFESFPQTAMLRRHGVPPSTNFETLNEMLHQRKQMTISLESSKALADSLDRCV 790

Query: 790 GTKKGLFPKLRDIVKLSSLLNSS-FYTG----RPFRHEMIGAKQYLTVTSPLRRFPDLIN 844
             K   F  L  I+    ++ +  FY+G      FRH  +    Y   TSP+RR+ D++ 
Sbjct: 791 DPKDPYFNTLIRIMSTRCMMAAQYFYSGAYSYSEFRHYGLAVDIYTHFTSPIRRYCDVVA 850

Query: 845 HLQIHRHLQKKPLCFT---QTQIDSLIWSIQSRADILKRASRDSSTYWTLNYLKKLAKSD 901
           H Q+   +  +PL  +   + ++D +  +I  R    + A R S  Y+    ++     +
Sbjct: 851 HRQLAGAIGYEPLDLSHRDKNKMDMICRNINKRHRNAQFAGRASIEYYVGQVMRNNESVE 910

Query: 902 PGRTYDVM----ITSVPQNGFAGCV 922
            G    V+    +  VP+ G  G +
Sbjct: 911 TGYVIKVLNNGIVVLVPRFGVEGLI 935

>SAKL0D10186g Chr4 (852303..855269) [2967 bp, 988 aa] {ON} highly
           similar to uniprot|Q08162 Saccharomyces cerevisiae
           YOL021C DIS3 Nucleolar exosome component involved in
           rRNA processing and RNA degradation binds Gsp1p/Ran and
           enhances the GEF activity of Srm1p implicated in mitotic
           control homologous to the E. coli RNase R of the RNase
           II family
          Length = 988

 Score = 55.5 bits (132), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 88/439 (20%), Positives = 167/439 (38%), Gaps = 68/439 (15%)

Query: 522 RYDFGDLRVFCIDSDTAHEIDDGVSVENHGK---DGMYTLHIHIADPTSMFPESTAIDSV 578
           R D  D  +  ID     +IDD +    H K   +G + + +HIAD T      T +D+ 
Sbjct: 518 RRDLRDKLICSIDPPGCVDIDDAL----HAKQLPNGNWEVGVHIADVTHFVKAGTPLDAE 573

Query: 579 GISTDILNIAFKRSFTTYLPDVVVPMLPQAICHLSDLGKHGKRTKTISFSVDVKVGYQGC 638
           G S         R  + YL D  + MLP  +   +DL          +FSV  ++  +  
Sbjct: 574 GAS---------RGTSVYLVDKRIDMLPMLLG--TDLCSLKPYVDRFAFSVIWELDQKAS 622

Query: 639 GKSLEIMYDSFRIRKGFVSNFPKATYDDVDKILSAPDNESSPVKADLESLSMISKLLREQ 698
             +++      R R+ F       +Y+     +  P N+   +   + +L  +S  L+++
Sbjct: 623 IVNVDFTKSVIRSREAF-------SYEQAQLRIDDP-NQKDELTQGMRALLNLSVKLKQK 674

Query: 699 RIKKNNAVIFGEGFNKGMVTLNANAEGELTEVSFSNQEETPST-VLVSEMMILANTLTGR 757
           R+            N     +  + + E ++      ++  +T  LV E M+LAN    +
Sbjct: 675 RLDAG-------ALNLASPEVKVHMDSETSDPGDVEIKKLLATNSLVEEFMLLANISVAK 727

Query: 758 YFAE-------------------NNIGGVFRCYKQLPLDLIAQQQYDSMITGTKKGLFPK 798
              E                     +  + +  K + + L + +     +        P 
Sbjct: 728 KIYEAFPQTAMLRRHAAPPSTNFETLNEMLQLRKSMSISLESSKALADSLDRCIDPQDPY 787

Query: 799 LRDIVKLSS----LLNSSFYTGR----PFRHEMIGAKQYLTVTSPLRRFPDLINHLQIHR 850
              +V++ S    +    FY+G      FRH  +    Y   TSP+RR+ D++ H Q+  
Sbjct: 788 FNTLVRIMSTRCMMAAQYFYSGAYSYADFRHYGLAVDIYTHFTSPIRRYCDVVAHRQLAG 847

Query: 851 HLQKKPLCFT---QTQIDSLIWSIQSRADILKRASRDSSTYWTLNYLKKLAKSDPGRTYD 907
            +  +PL  T   + +++ +  +I  R    + A R S  Y+    ++     + G    
Sbjct: 848 AIGYEPLDLTHRDKNKMEMICKNINKRHRNAQFAGRASIEYYVGQVMRNNESVETGYVIR 907

Query: 908 V----MITSVPQNGFAGCV 922
           V    ++  VP+ G  G +
Sbjct: 908 VFNNGIVVLVPKFGVEGLI 926

>Kpol_1043.42 s1043 (83527..86493) [2967 bp, 988 aa] {ON}
           (83527..86493) [2967 nt, 989 aa]
          Length = 988

 Score = 54.3 bits (129), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 91/439 (20%), Positives = 171/439 (38%), Gaps = 68/439 (15%)

Query: 522 RYDFGDLRVFCIDSDTAHEIDDGVSVENHGK---DGMYTLHIHIADPTSMFPESTAIDSV 578
           R D  D  +  ID     +IDD +    H K   +G + + +HIAD T      T +D+ 
Sbjct: 518 RVDLRDKLICSIDPPGCVDIDDAL----HAKKLPNGHFEVGVHIADVTHFVKAGTPLDAE 573

Query: 579 GISTDILNIAFKRSFTTYLPDVVVPMLPQAICHLSDLGKHGKRTKTISFSVDVKVGYQGC 638
           G S         R  + YL D  + MLP  +   +DL          +FSV  ++     
Sbjct: 574 GAS---------RGTSVYLVDKRIDMLPMLLG--TDLCSLKPYVDRFAFSVIWELDENAD 622

Query: 639 GKSLEIMYDSFRIRKGFVSNFPKATYDDVDKILSAPDNESSPVKADLESLSMISKLLREQ 698
              ++      R R+ F     +   DD         N++  +   + +L  +S  L+++
Sbjct: 623 IVKVDFSKSVIRSREAFSYEQAQLRIDD--------KNQTDELTLGMRALLDLSIKLKQK 674

Query: 699 RIKKNNAVIFGEGFNKGMVTLNAN-AEGELTEVSFSNQEETPSTVLVSEMMILANTLTGR 757
           R+      +        M +  ++  E E+ ++  +N        LV E M+LAN    R
Sbjct: 675 RLDAGALNLASPEVKVHMDSETSDPGEVEIKKLLATNS-------LVEEFMLLANISVAR 727

Query: 758 YFAEN-NIGGVFRCYKQLPL-------DLIAQQQYDSMITGTKKGLF-----------PK 798
              ++     + R +   P        +++ +++  S+   + K L            P 
Sbjct: 728 KIYDSFPQTAMLRRHAAPPSTNFEILNEMLQKRKGLSISLESSKALADSLDRCVDKKDPY 787

Query: 799 LRDIVKLSS----LLNSSFYTG----RPFRHEMIGAKQYLTVTSPLRRFPDLINHLQIHR 850
              +V++ S    +    FY+G      FRH  +    Y   TSP+RR+ D++ H Q+  
Sbjct: 788 FNTLVRIMSTRCMMAAQYFYSGAYSYSDFRHYGLAVDIYTHFTSPIRRYCDVVAHRQLAG 847

Query: 851 HLQKKPLCFT---QTQIDSLIWSIQSRADILKRASRDSSTYWTLNYLKKLAKSDPGRTYD 907
            +  +PL  +   + +++ +  +I  R    + A R S  Y+    ++     + G    
Sbjct: 848 AIGYEPLDLSHRDKNKMEMICKNINRRHRNAQFAGRASIEYYVGQVMRNNESVETGYVIK 907

Query: 908 VM----ITSVPQNGFAGCV 922
           V+    +  VP+ G  G +
Sbjct: 908 VLNNGIVVIVPKFGVEGLI 926

>KLTH0H13420g Chr8 (1172833..1175793) [2961 bp, 986 aa] {ON} highly
           similar to uniprot|Q08162 Saccharomyces cerevisiae
           YOL021C DIS3 Nucleolar exosome component involved in
           rRNA processing and RNA degradation binds Gsp1p/Ran and
           enhances the GEF activity of Srm1p implicated in mitotic
           control homologous to the E. coli RNase R of the RNase
           II family
          Length = 986

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 96/474 (20%), Positives = 177/474 (37%), Gaps = 78/474 (16%)

Query: 522 RYDFGDLRVFCIDSDTAHEIDDGVSVENHGK---DGMYTLHIHIADPTSMFPESTAIDSV 578
           R D  D  +  ID     +IDD +    H K   +G + + +HIAD T     +T +D+ 
Sbjct: 516 RRDLRDKLICSIDPPGCVDIDDAL----HAKKLPNGNWEVGVHIADVTHFVKANTPLDAE 571

Query: 579 GISTDILNIAFKRSFTTYLPDVVVPMLPQAI-CHLSDLGKHGKRTKTISFSVDVKVGYQG 637
           G S         R  + YL D  + MLP  +  +L  L  +  R    +FSV  ++    
Sbjct: 572 GAS---------RGTSVYLVDKRIDMLPMLLGTNLCSLKPYVDR---FAFSVLWELDENA 619

Query: 638 CGKSLEIMYDSFRIRKGFVSNFPKATYDDVDKILSAPDNESSPVKADLESLSMISKLLRE 697
              +++      + R+ F     +   DD        +++   +   + +L  +S  L++
Sbjct: 620 NIVNVDFTKSVIKSREAFSYEQAQLRIDD--------ESQKDELTQGMRALLQLSIKLKQ 671

Query: 698 QRIKKNNAVIFGEGFNKGMVTLNAN-AEGELTEVSFSNQEETPSTVLVSEMMILANTLTG 756
           +R+      +        M +  ++  E E+ ++  +N        LV E M+LAN    
Sbjct: 672 KRLDAGALNLASPEVKVHMDSETSDPGEVEIKKLLATNS-------LVEEFMLLANISVA 724

Query: 757 RYFAE-------------------NNIGGVFRCYKQLPLDLIAQQQYDSMITGTKKGLFP 797
           R   E                     +  + +  K + + L + +   + +        P
Sbjct: 725 RRIYEAFPQTAMLRRHAAPPATNFETLNEMLQLRKGMSISLESSKALANSLDRCVDLEDP 784

Query: 798 KLRDIVKLSS----LLNSSFYTGR----PFRHEMIGAKQYLTVTSPLRRFPDLINHLQIH 849
               +V++ S    +    FY G      FRH  +    Y   TSP+RR+ D++ H Q+ 
Sbjct: 785 YFNTLVRIMSTRCMMAAQYFYAGAYSYPDFRHYGLAVDIYTHFTSPIRRYCDVVAHRQLA 844

Query: 850 RHLQKKPLCFT---QTQIDSLIWSIQSRADILKRASRDSSTYWTLNYLKKLAKSDPGRTY 906
             +  +PL      + ++D +  +I  +    + A R S  Y+    ++     + G   
Sbjct: 845 AAIGYEPLDLNHRDKNKMDFMCRNINKKHRNAQFAGRASIEYYVGQVMRNNESVETGYVI 904

Query: 907 DV----MITSVPQNGFAGCVF--------PSLSFARGTLKLQPKAKYYPMIGDI 948
            V    ++  VP+ G  G +         PS  F     KL    K    I D+
Sbjct: 905 RVFHNGIVVLVPKFGVEGLIRLENLTDDEPSAQFKAEEFKLSFTPKGAEQIKDV 958

>KLLA0A10835g Chr1 (938712..941738) [3027 bp, 1008 aa] {ON} highly
           similar to uniprot|Q08162 Saccharomyces cerevisiae
           YOL021C DIS3 Nucleolar exosome component involved in
           rRNA processing and RNA degradation binds Gsp1p/Ran and
           enhances the GEF activity of Srm1p implicated in mitotic
           control homologous to the E. coli RNase R of the RNase
           II family
          Length = 1008

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 89/441 (20%), Positives = 164/441 (37%), Gaps = 72/441 (16%)

Query: 522 RYDFGDLRVFCIDSDTAHEIDDGVSVENHGK---DGMYTLHIHIADPTSMFPESTAIDSV 578
           R DF D  +  ID     +IDD +    H K   +G + + +HIAD T      TA+D+ 
Sbjct: 539 RKDFRDKLICSIDPPGCVDIDDAL----HAKQLPNGNWEVGVHIADVTHFVKPGTALDAE 594

Query: 579 GISTDILNIAFKRSFTTYLPDVVVPMLPQAICHLSDLGKHGKRTKTISFSVDVKVGYQGC 638
           G S         R  + YL D  + MLP  +   +DL          +FSV  ++     
Sbjct: 595 GAS---------RGTSVYLVDKRIDMLPMLLG--TDLCSLKPYVDRFAFSVVWELDNDAN 643

Query: 639 GKSLEIMYDSFRIRKGFVSNFPKATYDDVDKILSAPDNESSPVKADLESLSMISKLLREQ 698
              ++      R R+ F     +   DD        +     +   + +L  +SK L+++
Sbjct: 644 IVGVDFTKSVIRSREAFSYEKAQNRIDD--------ETAKDELTLGMRALLQLSKKLKQK 695

Query: 699 RIKKNNAVIFGEGFNKGMVTLNANAEGELT---EVSFSNQEETPSTVLVSEMMILANTLT 755
           R+            N     +  + + E +   EV      +T S  LV E M+LAN   
Sbjct: 696 RLDAG-------ALNLASPEVKVHMDSETSDPNEVEIKKLLDTNS--LVEEFMLLANISV 746

Query: 756 GRYFAE-------------------NNIGGVFRCYKQLPLDLIAQQQYDSMITGTKKGLF 796
            R   E                     +  + +  K + + L + +     +   +    
Sbjct: 747 ARKIYEAFPQTAMLRRHAAPPSTNFELLNEMLQVRKGMSISLESSKALADSLDRCEDPND 806

Query: 797 PKLRDIVKLSS----LLNSSFYTG----RPFRHEMIGAKQYLTVTSPLRRFPDLINHLQI 848
             L  ++++ S    +    F+ G      FRH  +    Y   TSP+RR+ D++ H Q+
Sbjct: 807 SYLNTLIRIMSTRCMMAAQYFHAGAFSYADFRHYGLAVDIYTHFTSPIRRYCDVVAHRQL 866

Query: 849 HRHLQKKPLCFT---QTQIDSLIWSIQSRADILKRASRDSSTYWTLNYLKKLAKSDPGRT 905
              +  + L  +   + +++ +  +I  +    + A R S  Y+    ++    ++ G  
Sbjct: 867 AGAIGYEALDLSHRDKQKMEMICRNINKKHRNAQFAGRASIEYYVGQVMRNNESTETGYV 926

Query: 906 YDV----MITSVPQNGFAGCV 922
             V    +   VP+ G  G +
Sbjct: 927 IKVFNNGIAVLVPKFGVEGLI 947

>Kwal_34.16245 s34 complement(260089..263049) [2961 bp, 986 aa] {ON}
           YOL021C (DIS3) - 3'-5' exoribonuclease complex subunit
           [contig 265] FULL
          Length = 986

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 90/440 (20%), Positives = 169/440 (38%), Gaps = 70/440 (15%)

Query: 522 RYDFGDLRVFCIDSDTAHEIDDGVSVENHGK---DGMYTLHIHIADPTSMFPESTAIDSV 578
           R D  D  +  ID     +IDD +    H K   +G + + +HIAD T     +T +D+ 
Sbjct: 516 RRDLRDKLICSIDPPGCVDIDDAL----HAKQLPNGNWEVGVHIADVTHFVKPNTPLDAE 571

Query: 579 GISTDILNIAFKRSFTTYLPDVVVPMLPQAI-CHLSDLGKHGKRTKTISFSVDVKVGYQG 637
           G S         R  + YL D  + MLP  +  +L  L  +  R    +FSV  ++    
Sbjct: 572 GAS---------RGTSVYLVDKRIDMLPMLLGTNLCSLKPYVDR---FAFSVLWELDQDA 619

Query: 638 CGKSLEIMYDSFRIRKGFVSNFPKATYDDVDKILSAPDNESSPVKADLESLSMISKLLRE 697
              +++      + R+ F     +   DD          ++  +   + +L  +S  L+E
Sbjct: 620 NIVNVDFTKSVIKSREAFSYEQAQLRIDD--------STQTDELTQGMRALLSLSIKLKE 671

Query: 698 QRIKKNNAVIFGEGFNKGMVTLNAN-AEGELTEVSFSNQEETPSTVLVSEMMILANTLTG 756
           +R+      +        M +  ++  E E+ ++  +N        LV E M+LAN    
Sbjct: 672 KRLNAGALNLASPEVKVHMDSETSDPGEVEIKKLLATNS-------LVEEFMLLANISVA 724

Query: 757 RYFAE-------------------NNIGGVFRCYKQLPLDLIAQQQY-DSM--ITGTKKG 794
           R   E                     +  + +  K + + L + +   DS+      K  
Sbjct: 725 RKIYEAFPQTAMLRRHAAPPATNFEALNEMLQLRKGMSISLESSKALADSLDRCVDPKDP 784

Query: 795 LFPKLRDIVKLSSLLNSS-FYTGR----PFRHEMIGAKQYLTVTSPLRRFPDLINHLQIH 849
            F  L  I+    ++ +  FY+G      FRH  +    Y   TSP+RR+ D++ H Q+ 
Sbjct: 785 YFNTLVRIMSTRCMMAAQYFYSGAYSYPDFRHYGLAVDIYTHFTSPIRRYCDVVAHRQLA 844

Query: 850 RHLQKKPLCFT---QTQIDSLIWSIQSRADILKRASRDSSTYWTLNYLKKLAKSDPGRTY 906
             +  + L      + +++ +  +I  +    + A R S  Y+    ++     + G   
Sbjct: 845 AAIGYEALDLNHRDKNKMEFMCRNINKKHRNAQFAGRASIEYYVGQVMRNNESEETGYVI 904

Query: 907 DV----MITSVPQNGFAGCV 922
            V    ++  VP+ G  G +
Sbjct: 905 RVFHNGIVVLVPKFGVEGLI 924

>Ecym_3186 Chr3 complement(354713..358438) [3726 bp, 1241 aa] {ON}
            similar to Ashbya gossypii AAL072C
          Length = 1241

 Score = 40.0 bits (92), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 76/336 (22%), Positives = 126/336 (37%), Gaps = 80/336 (23%)

Query: 553  DGMYTLHIHIADPTSMFPESTAIDSVGISTDILNIAFKRSFTTYLPDVVVPMLPQAICHL 612
            DG   L  H+ D T+   E +++D           A KRS   ++P   V +LPQA+   
Sbjct: 706  DGRIELGCHVIDVTAHIEEGSSLDRR---------ARKRSSAVFMPQKTVYLLPQAMNEF 756

Query: 613  SDLGKHGKRTKTIS--FSVDV-KVGYQGCGKSLEIMYDSFRIRKGFVSNFPKATYDDVDK 669
                + GK + TIS  +++D    G   C           RI +G V     +TYD ++K
Sbjct: 757  LTF-QPGKNSPTISVIYTLDANNFGVISC-----------RICEGLVLPHMVSTYDGLNK 804

Query: 670  -ILSAPDNESSPVKADLESLSMISKLLREQRIKKNNAVIFGEGFNKGMVTLNANAEGELT 728
             +L AP+  SS +   + S+++     R      NN++          + L    + E  
Sbjct: 805  ELLKAPEKRSSFINV-INSIAIKFYCERLNYEDDNNSITLS-----SKLALLDTLDDEKV 858

Query: 729  EVSFSNQEETPSTVLVSEMMILANTLTGRYFAENNIGGVFRCYKQLPLDLIAQQQYDSMI 788
            +V  +  ++TP+  ++ E+    N+               R Y +L      ++Q   + 
Sbjct: 859  KVDLNMLKKTPAAAVIGEIERKVNSTVAE-----------RTYIKLGASAFLRRQPSPI- 906

Query: 789  TGTKKGLFPKL-------RDIVKLSSLLNS-------------------------SFYTG 816
              TK  LF K         D+    SLL S                          F  G
Sbjct: 907  -STKLQLFKKKVQKFGCNVDVTTPESLLGSILSIKDYSTRLGIELLLFKTLNRARYFVAG 965

Query: 817  R----PFRHEMIGAKQYLTVTSPLRRFPDLINHLQI 848
            +     + H  +    Y   T+PLRR+ D + H Q+
Sbjct: 966  KVEPDQYGHFSLNMHLYTHFTAPLRRYADHVVHRQL 1001

>NDAI0C04050 Chr3 complement(921707..925489) [3783 bp, 1260 aa] {ON}
           Anc_5.307 YDR293C
          Length = 1260

 Score = 38.5 bits (88), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 61/127 (48%), Gaps = 23/127 (18%)

Query: 522 RYDFGDLRVFCI----DSDTAHEIDDGVSVENHGKDGMYTLHIHIADPTSMFPESTAIDS 577
           R DF D   + I    ++D+  E    + V+N+  DG + L  H+ D T+   E++++D 
Sbjct: 702 RTDFTDPSEYSILAIAENDSLSEF--ALHVKNNN-DGTFELGCHVVDATAHIEENSSLDR 758

Query: 578 VGISTDILNIAFKRSFTTYLPDVVVPMLPQAICHLSDLGKHGKRTKTISFSVDVKVGYQG 637
                     A KRS   ++P  VV +LP+A+     L K  K++ T+S      V Y  
Sbjct: 759 R---------ARKRSSGVFMPQKVVNLLPKALNESLSL-KKDKKSATLS------VIYTL 802

Query: 638 CGKSLEI 644
             ++LEI
Sbjct: 803 NAETLEI 809

>TDEL0E03200 Chr5 (603078..606851) [3774 bp, 1257 aa] {ON} Anc_5.307
           YDR293C
          Length = 1257

 Score = 38.5 bits (88), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 62/137 (45%), Gaps = 23/137 (16%)

Query: 509 EDLQRENSGNDSDRYDFGDLRVFCIDSDTAHEIDDGVSVENHGKD-GMYTLHIHIADPTS 567
           EDL+      D + YD     +  I +++A+  D  V ++N+  D G   L  H+ D T+
Sbjct: 690 EDLESRRQFTDQNTYD-----ILAI-TESANYCDFAVHIKNNTDDAGSIELGCHVVDATA 743

Query: 568 MFPESTAIDSVGISTDILNIAFKRSFTTYLPDVVVPMLPQAICHLSDLGKHGKRTKTISF 627
              E +++D           A KRS   ++P   V +LPQA+     L   GK +  IS 
Sbjct: 744 YIEEDSSLDRR---------ARKRSTAVFMPQKFVDLLPQALNKSLTLAP-GKESACIS- 792

Query: 628 SVDVKVGYQGCGKSLEI 644
                V Y   GK+L++
Sbjct: 793 -----VVYTLDGKTLKV 804

>AAL072C Chr1 complement(218958..222620) [3663 bp, 1220 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR293C
           (SSD1)
          Length = 1220

 Score = 37.7 bits (86), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 73/330 (22%), Positives = 129/330 (39%), Gaps = 61/330 (18%)

Query: 549 NHGKDGMYTLHIHIADPTSMFPESTAIDSVGISTDILNIAFKRSFTTYLPDVVVPMLPQA 608
           +H  +G   L  H+ D T+   E +++D           A KRS   ++P   + +LP+A
Sbjct: 682 SHLPNGSIELGCHVVDATAHIEEGSSLD---------RRARKRSSAVFMPQKTLYLLPEA 732

Query: 609 ICHLSDLGKHGKRTKTISFSVDVKVGYQGCGKSLEIMYDSFRIRKGFVSNFPKA--TYDD 666
           +     L + GKRT TIS      V Y    ++L +         G  S  PKA  T+D+
Sbjct: 733 LNKFLTL-EPGKRTCTIS------VVYTLAPETLAVT----SCWVGETSVSPKAVLTFDE 781

Query: 667 VDKILSAPDNESSPVKADLESLSMISKLLREQRIKKNNAVIFGEGFNKGMVTLNANAEGE 726
           +  +L       +     +E++S ++     +R+   N+V       K  + L  + + E
Sbjct: 782 ISDVLGKGTGHENTF---VETVSAVAASFYRERLGMKNSV---PNLLKTKLALLDSLDDE 835

Query: 727 LTEVSFSNQEETPSTVLVSEMMILAN-TLTGRYFAENNIGGVFRCYKQ------------ 773
             +V  +  +++P+  ++ E+    N T+  R + +       R   Q            
Sbjct: 836 KVKVDINILDKSPAAYVIGEIEHKVNSTIAERTYVKLGSSAFLRRQPQPISTKLQLFKKK 895

Query: 774 -----LPLDLIAQQQYDSMITGTKKGLFPKLRDIVKLSSLLNSSFYTGRPFRHEMIGAKQ 828
                  +D+   +   S I   +    P +R  V+L  LL  +    R F    +   Q
Sbjct: 896 IQKFGFEIDITTPESLLSSILAIED---PTVRLGVEL--LLFKTVNRARYFVAGKVEPDQ 950

Query: 829 ----------YLTVTSPLRRFPDLINHLQI 848
                     Y   TSPLRR+ D + H Q+
Sbjct: 951 YGHFSLNLHLYTHFTSPLRRYADHVVHRQL 980

>Skud_4.555 Chr4 complement(988201..991959) [3759 bp, 1252 aa] {ON}
           YDR293C (REAL)
          Length = 1252

 Score = 37.4 bits (85), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 40/83 (48%), Gaps = 11/83 (13%)

Query: 544 GVSVENHGKDGMYTLHIHIADPTSMFPESTAIDSVGISTDILNIAFKRSFTTYLPDVVVP 603
            + V+N+G DG   L  HI D TS   E +++D           A KRS   ++P  +V 
Sbjct: 715 ALHVKNNG-DGTLELGCHIVDVTSHIEEGSSVDRR---------ARKRSSAVFMPQKLVN 764

Query: 604 MLPQAICHLSDLGKHGKRTKTIS 626
           +LPQ+      L   GK + TIS
Sbjct: 765 LLPQSFNDELSLAP-GKESATIS 786

>Suva_2.459 Chr2 complement(810378..814154) [3777 bp, 1258 aa] {ON}
           YDR293C (REAL)
          Length = 1258

 Score = 37.4 bits (85), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 39/83 (46%), Gaps = 11/83 (13%)

Query: 544 GVSVENHGKDGMYTLHIHIADPTSMFPESTAIDSVGISTDILNIAFKRSFTTYLPDVVVP 603
            + V N+G DG   L  H+ D TS   E +++D           A KRS   ++P  +V 
Sbjct: 721 ALHVRNNG-DGTLELGCHVVDVTSHIEEGSSVDRR---------ARKRSSAVFMPQKLVS 770

Query: 604 MLPQAICHLSDLGKHGKRTKTIS 626
           +LPQ+      L   GK + TIS
Sbjct: 771 LLPQSFNDTLSLAP-GKESPTIS 792

>TBLA0C03280 Chr3 complement(794118..798059) [3942 bp, 1313 aa] {ON}
            Anc_5.307 YDR293C
          Length = 1313

 Score = 37.4 bits (85), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 81/360 (22%), Positives = 137/360 (38%), Gaps = 69/360 (19%)

Query: 521  DRYDFGDLRVFCI----DSDTAHEIDDGVSVENHGKDGMYTLHIHIADPTSMFPESTAID 576
            DR DF DL  + +     SD   E    V V+++  DG   L  H+ D T+   E  ++D
Sbjct: 717  DRVDFTDLNTYNVLAISTSDNLSEF--AVHVKDNS-DGTLELACHVIDITAHIEEGGSVD 773

Query: 577  SVGISTDILNIAFKRSFTTYLPDVVVPMLPQAICHLSDLGKHGKRTKTIS--FSVDVKVG 634
                       A +RS    +P   + +LP+A+     L K  K++ TIS  F +D K  
Sbjct: 774  RR---------ARRRSTGVIMPQEKMALLPKAVNDAVSLFK-DKKSATISIIFKLDSK-- 821

Query: 635  YQGCGKSLEIMYDSFRIRKGFV--SNFPKATYDDVDKILSAPDNESSPVKADLESLSMIS 692
                         SF++    +  S    +   DVD I+   D  S  V   L  L+ IS
Sbjct: 822  -------------SFKVISSTICESIIAPSLLLDVDDIVE--DLMSKEVNPYLSLLAEIS 866

Query: 693  KLLREQRIKKNNAVIFGEGFNKGMVTLNANAEGELTEVSFSNQEETPSTVLVSEMMILAN 752
            +    +R+   +  +        ++++ +  + E TEV+ +  E      +V+E+    N
Sbjct: 867  RCFYSERMHSPDIAL------DPLLSILSKLDDEDTEVNLNIFETNMGNFVVNELQRKCN 920

Query: 753  TLTGRYFAENNIGGVFRCYKQLP---------LDLIAQQQYDSMITG------------- 790
            ++       + IG      +QLP         +  + +  YD   T              
Sbjct: 921  SIIAESLLLH-IGDPAFLRRQLPPSPIKLKSFVKKVKRYGYDIDSTSPENIIKSILSIND 979

Query: 791  --TKKGLFPKLRDIVKLSSLLNSSFYTGRPFRHEMIGAKQYLTVTSPLRRFPDLINHLQI 848
              T+KG+       +  +     S      + H +     Y   TSPLRR+ D + H Q+
Sbjct: 980  PITRKGVEVLFYKTMSRAKYFIKSNVENNQYEHYLNNFPVYTHFTSPLRRYSDHVVHRQL 1039

>Kpol_1004.68 s1004 complement(143077..144804,144807..146831) [3753
           bp, 1250 aa] {ON}
           complement(143077..144804,144807..146831) [3753 nt, 1251
           aa]
          Length = 1250

 Score = 36.2 bits (82), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 42/83 (50%), Gaps = 12/83 (14%)

Query: 552 KDGMYTLHIHIADPTSMFPESTAIDSVGISTDILNIAFKRSFTTYLPDVVVPMLPQAICH 611
           KDG      HI D T+   E +++D           A KRS   +LP  VV +LP+AI +
Sbjct: 721 KDGTIEFACHIVDVTAHIEEGSSLD---------RRARKRSTAVFLPQRVVNLLPEAI-N 770

Query: 612 LSDLGKHGKRTKTIS--FSVDVK 632
            S   +  K++ TIS  +++D K
Sbjct: 771 KSLTFERSKKSATISVIYTLDSK 793

>NCAS0F02890 Chr6 (575888..577036) [1149 bp, 382 aa] {ON} Anc_5.356
           YDR321W
          Length = 382

 Score = 35.4 bits (80), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 42/129 (32%), Positives = 59/129 (45%), Gaps = 9/129 (6%)

Query: 533 IDSDTAHEIDDGVSVENHGKDGMYTLH-IHIADPTSMFPESTAIDSVGISTDILNIAFKR 591
           ID     +I  GVS      DG+   H       T+ F EST ID+  +   I+ +   R
Sbjct: 109 IDESLLFKIYKGVSESLQSFDGIVITHGTDTLSETAFFIEST-IDAGDVP--IVFVGSMR 165

Query: 592 SFTTYLPDVVVPM-LPQAICHLSDLGKHGKRTKTISFSVDVKVGYQGCGKSLEIMYDSFR 650
             T+   D   PM L QAIC  SD    G R+  +S +  +  GY    K+     DSF 
Sbjct: 166 PSTSVSADG--PMNLYQAICIASDPKSRG-RSVLVSLNDQISAGYY-ITKTNANSLDSFN 221

Query: 651 IRKGFVSNF 659
           +R+G++ NF
Sbjct: 222 VRQGYLGNF 230

>TPHA0D02090 Chr4 (428969..430117) [1149 bp, 382 aa] {ON} Anc_5.356
           YDR321W
          Length = 382

 Score = 35.0 bits (79), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 60/129 (46%), Gaps = 9/129 (6%)

Query: 533 IDSDTAHEIDDGVSVENHGKDGMYTLH-IHIADPTSMFPESTAIDSVGISTDILNIAFKR 591
           ID    ++I   VS    G DG+  +H       T+ F EST ID+  +   I+ +   R
Sbjct: 109 IDESILYKIYKAVSESLQGFDGIVIIHGTDTLSETAFFIEST-IDTGDVP--IVFVGSMR 165

Query: 592 SFTTYLPDVVVPM-LPQAICHLSDLGKHGKRTKTISFSVDVKVGYQGCGKSLEIMYDSFR 650
             T+   D   PM L QAIC  +     G R+  +S +  +  GY    K+     DSF 
Sbjct: 166 PSTSISADG--PMNLYQAICIAASPKSRG-RSVLVSLNDQISAGYY-ITKTNANSLDSFN 221

Query: 651 IRKGFVSNF 659
           +R+G++ NF
Sbjct: 222 VRQGYLGNF 230

>Smik_4.581 Chr4 (1035189..1036334) [1146 bp, 381 aa] {ON} YDR321W
           (REAL)
          Length = 381

 Score = 34.7 bits (78), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 41/129 (31%), Positives = 61/129 (47%), Gaps = 9/129 (6%)

Query: 533 IDSDTAHEIDDGVSVENHGKDGMYTLH-IHIADPTSMFPESTAIDSVGISTDILNIAFKR 591
           I+ D  ++I  GVS      DG+   H       T+ F EST ID+  +   I+ +   R
Sbjct: 113 INQDILYKIYKGVSESLQTFDGIVITHGTDTLSETAFFIEST-IDAGDVP--IVFVGSMR 169

Query: 592 SFTTYLPDVVVPM-LPQAICHLSDLGKHGKRTKTISFSVDVKVGYQGCGKSLEIMYDSFR 650
             T+   D   PM L QAIC  S+    G R+  +S +  +  GY    K+     DSF 
Sbjct: 170 PSTSVSADG--PMNLYQAICIASNPKSRG-RSVLVSLNDQISSGYY-ITKTNANSLDSFN 225

Query: 651 IRKGFVSNF 659
           +R+G++ NF
Sbjct: 226 VRQGYLGNF 234

>YDR321W Chr4 (1108702..1109847) [1146 bp, 381 aa] {ON}
           ASP1Cytosolic L-asparaginase, involved in asparagine
           catabolism; catalyzes hydrolysis of L-asparagine to
           aspartic acid and ammonia, has an important role in
           therapy of acute lymphoblastic leukemia; synthesized
           constitutively
          Length = 381

 Score = 34.7 bits (78), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 41/129 (31%), Positives = 60/129 (46%), Gaps = 9/129 (6%)

Query: 533 IDSDTAHEIDDGVSVENHGKDGMYTLH-IHIADPTSMFPESTAIDSVGISTDILNIAFKR 591
           I+ D  ++I  GVS      DG+   H       T+ F EST ID+  +   I+ +   R
Sbjct: 113 INEDILYKIYKGVSESLQAFDGIVITHGTDTLSETAFFIEST-IDAGDVP--IVFVGSMR 169

Query: 592 SFTTYLPDVVVPM-LPQAICHLSDLGKHGKRTKTISFSVDVKVGYQGCGKSLEIMYDSFR 650
             T+   D   PM L QAIC  S+    G R   +S +  +  GY    K+     DSF 
Sbjct: 170 PSTSVSADG--PMNLYQAICIASNPKSRG-RGVLVSLNDQISSGYY-ITKTNANSLDSFN 225

Query: 651 IRKGFVSNF 659
           +R+G++ NF
Sbjct: 226 VRQGYLGNF 234

>Skud_4.588 Chr4 (1044915..1046060) [1146 bp, 381 aa] {ON} YDR321W
           (REAL)
          Length = 381

 Score = 34.7 bits (78), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 41/129 (31%), Positives = 61/129 (47%), Gaps = 9/129 (6%)

Query: 533 IDSDTAHEIDDGVSVENHGKDGMYTLH-IHIADPTSMFPESTAIDSVGISTDILNIAFKR 591
           I+ D  ++I  GVS      DG+   H       T+ F EST ID+  +   I+ +   R
Sbjct: 113 INQDILYKIYRGVSESLQTFDGIVITHGTDTLSETAFFIEST-IDAGDVP--IVFVGSMR 169

Query: 592 SFTTYLPDVVVPM-LPQAICHLSDLGKHGKRTKTISFSVDVKVGYQGCGKSLEIMYDSFR 650
             T+   D   PM L QAIC  S+    G R+  +S +  +  GY    K+     DSF 
Sbjct: 170 PSTSVSADG--PMNLYQAICIASNPKSRG-RSVLVSLNDQISSGYY-ITKTNANSLDSFN 225

Query: 651 IRKGFVSNF 659
           +R+G++ NF
Sbjct: 226 VRQGYLGNF 234

>Kpol_1051.7 s1051 (12463..13590) [1128 bp, 375 aa] {ON}
           (12463..13590) [1128 nt, 376 aa]
          Length = 375

 Score = 34.3 bits (77), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 41/129 (31%), Positives = 58/129 (44%), Gaps = 9/129 (6%)

Query: 533 IDSDTAHEIDDGVSVENHGKDGMYTLH-IHIADPTSMFPESTAIDSVGISTDILNIAFKR 591
           ID    ++I  G+S      DG+   H       T+ F EST IDS  +   I+ +   R
Sbjct: 104 IDESLLYKIYKGISDSLQSFDGIVITHGTDTLAETAFFIEST-IDSGDVP--IVFVGSMR 160

Query: 592 SFTTYLPDVVVPM-LPQAICHLSDLGKHGKRTKTISFSVDVKVGYQGCGKSLEIMYDSFR 650
             T+   D   PM L QAIC  S     G R   +S +  +  GY    K+     DSF 
Sbjct: 161 PSTSISADG--PMNLYQAICIASSTKSRG-RGALVSLNDQISAGYY-ITKTNANSLDSFN 216

Query: 651 IRKGFVSNF 659
           +R+G++ NF
Sbjct: 217 VRQGYLGNF 225

>KNAG0C05470 Chr3 complement(1067393..1068547) [1155 bp, 384 aa]
           {ON} Anc_5.356 YDR321W
          Length = 384

 Score = 34.3 bits (77), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 60/129 (46%), Gaps = 9/129 (6%)

Query: 533 IDSDTAHEIDDGVSVENHGKDGMYTLH-IHIADPTSMFPESTAIDSVGISTDILNIAFKR 591
           ID    ++I  G+S      DG+   H       T+ F EST ID+  +   I+ +   R
Sbjct: 108 IDEPLLYKIYQGISQSLQSFDGIVITHGTDTLSETAFFIEST-IDTGDVP--IVFVGSMR 164

Query: 592 SFTTYLPDVVVPM-LPQAICHLSDLGKHGKRTKTISFSVDVKVGYQGCGKSLEIMYDSFR 650
             T+   D   PM L QAIC  S+    G R+  +S +  +  GY    K+     DSF 
Sbjct: 165 PSTSVSADG--PMNLYQAICIASNRESRG-RSVLVSLNDQISAGYY-ITKTNANSLDSFN 220

Query: 651 IRKGFVSNF 659
           +R+G++ NF
Sbjct: 221 VRQGYLGNF 229

>NCAS0A13730 Chr1 (2698652..2699080) [429 bp, 142 aa] {ON} Anc_7.282
          Length = 142

 Score = 32.7 bits (73), Expect = 1.7,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 32/57 (56%), Gaps = 6/57 (10%)

Query: 796 FPKLRDIVKLSSLLNSSFY-----TGRPFRHEMIGAKQYLTVTSPLRRFPDLINHLQ 847
           FP +  +++ S + +S F+     T   F   M+ A  Y+TVTSPLRR P+LI   Q
Sbjct: 21  FPPVAVLLR-SGVCSSDFWLNVVLTCLGFMPGMVHAFYYITVTSPLRRDPELIYFYQ 76

>TBLA0A03150 Chr1 (750581..751762) [1182 bp, 393 aa] {ON} Anc_5.356
           YDR321W
          Length = 393

 Score = 33.9 bits (76), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 58/129 (44%), Gaps = 9/129 (6%)

Query: 533 IDSDTAHEIDDGVSVENHGKDGMYTLH-IHIADPTSMFPESTAIDSVGISTDILNIAFKR 591
           ID    ++I +GV+      DG+   H       T+ F EST    VG    ++ +   R
Sbjct: 118 IDESILYKIYNGVAKSLQSFDGVVITHGTDTMAETAFFIESTL--DVG-EVPVVFVGSMR 174

Query: 592 SFTTYLPDVVVPM-LPQAICHLSDLGKHGKRTKTISFSVDVKVGYQGCGKSLEIMYDSFR 650
             T+   D   PM L QAIC  S     G R+  +S +  +  GY    KS     DSF 
Sbjct: 175 PSTSVSADG--PMNLYQAICIASSPKSRG-RSVMVSLNDQISAGYY-ITKSNANSLDSFN 230

Query: 651 IRKGFVSNF 659
           +R+G++ NF
Sbjct: 231 VRQGYLGNF 239

>KAFR0C01820 Chr3 complement(367009..368169) [1161 bp, 386 aa] {ON}
           Anc_5.356 YDR321W
          Length = 386

 Score = 33.9 bits (76), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 40/118 (33%), Positives = 55/118 (46%), Gaps = 17/118 (14%)

Query: 543 DGVSVENHGKDGMYTLHIHIADPTSMFPESTAIDSVGISTDILNIAFKRSFTTYLPDVVV 602
           DG+ V  HG D +          T+ F EST IDS  +   I+ +   R  T+   D   
Sbjct: 125 DGI-VITHGTDTL--------SETAFFVEST-IDSGEVP--IVFVGSMRPSTSVSADG-- 170

Query: 603 PM-LPQAICHLSDLGKHGKRTKTISFSVDVKVGYQGCGKSLEIMYDSFRIRKGFVSNF 659
           PM L QAIC  SD    G R   +S +  +  GY    K+     DSF +R+G++ NF
Sbjct: 171 PMNLYQAICIASDSKSRG-RGVLVSLNDQISAGYY-ITKTNANSLDSFNVRQGYLGNF 226

>Kwal_27.12324 s27 (1177349..1178506) [1158 bp, 385 aa] {ON} YDR321W
           (ASP1) - Asparaginase I, intracellular isozyme [contig
           20] FULL
          Length = 385

 Score = 33.9 bits (76), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 41/129 (31%), Positives = 59/129 (45%), Gaps = 9/129 (6%)

Query: 533 IDSDTAHEIDDGVSVENHGKDGMYTLH-IHIADPTSMFPESTAIDSVGISTDILNIAFKR 591
           ID +   +I  GVS      DG+   H       T+ F EST IDS  +   I+ +   R
Sbjct: 111 IDEEALLKIYSGVSKALQTFDGIVITHGTDTLAETTFFIEST-IDSGDVP--IVFVGSMR 167

Query: 592 SFTTYLPDVVVPM-LPQAICHLSDLGKHGKRTKTISFSVDVKVGYQGCGKSLEIMYDSFR 650
             T+   D   PM L QAIC  ++    G R   +S +  +  GY    K+     DSF 
Sbjct: 168 PSTSISADG--PMNLYQAICIAANRQSRG-RGVLVSLNDQISAGYY-ITKTNANTLDSFN 223

Query: 651 IRKGFVSNF 659
           +R+G++ NF
Sbjct: 224 VRQGYLGNF 232

>YDR293C Chr4 complement(1045640..1049392) [3753 bp, 1250 aa] {ON}
           SSD1Translational repressor with a role in polar growth
           and wall integrity; regulated by Cbk1p phosphorylation
           to effect bud-specific translational control and
           localization of specific mRNAs; interacts with TOR
           pathway components; contains a functional N-terminal
           nuclear localization sequence and nucleocytoplasmic
           shuttling appears to be critical to Ssd1p function
          Length = 1250

 Score = 33.9 bits (76), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 47/103 (45%), Gaps = 12/103 (11%)

Query: 524 DFGDLRVFCIDSDTAHEIDDGVSVENHGKDGMYTLHIHIADPTSMFPESTAIDSVGISTD 583
           D  +  +F I S+     +  + V N+G +G   L  H+ D TS   E +++D       
Sbjct: 694 DTNEYNIFAI-SELGWVSEFALHVRNNG-NGTLELGCHVVDVTSHIEEGSSVDRR----- 746

Query: 584 ILNIAFKRSFTTYLPDVVVPMLPQAICHLSDLGKHGKRTKTIS 626
               A KRS   ++P  +V +LPQ+      L   GK + T+S
Sbjct: 747 ----ARKRSSAVFMPQKLVNLLPQSFNDELSLAP-GKESATLS 784

>KLTH0G06248g Chr7 (494464..498141) [3678 bp, 1225 aa] {ON} similar
           to uniprot|P24276 Saccharomyces cerevisiae YDR293C SSD1
           Protein with a role in maintenance of cellular integrity
           interacts with components of the TOR pathway ssd1 mutant
           of a clinical S. cerevisiae strain displays elevated
           virulence
          Length = 1225

 Score = 33.9 bits (76), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 35/74 (47%), Gaps = 10/74 (13%)

Query: 553 DGMYTLHIHIADPTSMFPESTAIDSVGISTDILNIAFKRSFTTYLPDVVVPMLPQAICHL 612
           DG   +  HI D T+   E +++D           A KRS   ++P  VV +LPQ +   
Sbjct: 697 DGSLEVGCHILDVTAHIEEGSSLD---------RRARKRSSGVFIPQKVVHLLPQTLNDA 747

Query: 613 SDLGKHGKRTKTIS 626
             L K GK + TIS
Sbjct: 748 LTL-KEGKTSATIS 760

>Suva_2.491 Chr2 (866068..867213) [1146 bp, 381 aa] {ON} YDR321W
           (REAL)
          Length = 381

 Score = 33.5 bits (75), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 60/129 (46%), Gaps = 9/129 (6%)

Query: 533 IDSDTAHEIDDGVSVENHGKDGMYTLH-IHIADPTSMFPESTAIDSVGISTDILNIAFKR 591
           I+ D  + I  GVS      DG+   H       T+ F EST ID+  +   I+ +   R
Sbjct: 113 INQDILYRIYKGVSESLQTFDGIVITHGTDTLSETAFFIEST-IDAGDVP--IVFVGSMR 169

Query: 592 SFTTYLPDVVVPM-LPQAICHLSDLGKHGKRTKTISFSVDVKVGYQGCGKSLEIMYDSFR 650
             T+   D   PM L QAIC  S+    G R+  +S +  +  GY    K+     D+F 
Sbjct: 170 PSTSVSADG--PMNLYQAICIASNPKSRG-RSVLVSLNDQISSGYY-ITKTNANSLDTFN 225

Query: 651 IRKGFVSNF 659
           +R+G++ NF
Sbjct: 226 VRQGYLGNF 234

>NDAI0D01920 Chr4 (451715..457948) [6234 bp, 2077 aa] {ON} Anc_5.190
            YGR184C
          Length = 2077

 Score = 33.5 bits (75), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 47/96 (48%), Gaps = 7/96 (7%)

Query: 385  YYAQVIEKLEANSYKEVNTFVKLVNER--KYRDISNLYPSVIQLLKDFAAGNFHNN---- 438
            ++A  I  LE +S  +VNT    + +R  KY+ + N+   ++ + K F + NF N+    
Sbjct: 1484 HWANTISMLEISSRADVNTNATFLKDREQKYQTLKNVLIFILLVFKSFGSPNFTNDFYKN 1543

Query: 439  -GIIVTLISKIFRKIVRYKDYDITRDVCQDLINEIV 473
                V   +++F+ IVR   Y  T    +D I E V
Sbjct: 1544 VNNTVWNQNQVFQVIVRNILYPKTTRSVRDSIGEAV 1579

>KAFR0F00280 Chr6 (69827..71473) [1647 bp, 548 aa] {ON} Anc_2.51
           YDL225W
          Length = 548

 Score = 32.7 bits (73), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 21/32 (65%), Gaps = 1/32 (3%)

Query: 224 LIQPEGHH-KHLPIGTLKNISNQTNILPIVTR 254
            I+P GH  K L I  +K +S  TN+LPI+T+
Sbjct: 189 FIEPTGHGLKELDIELMKKVSRYTNVLPIITK 220

>ZYRO0A06138g Chr1 complement(490489..491241) [753 bp, 250 aa] {ON}
           similar to uniprot|P06174 Saccharomyces cerevisiae
           YOR278W HEM4 Uroporphyrinogen III synthase catalyzes the
           conversion of hydroxymethylbilane to uroporphyrinogen
           III the fourth step in the heme biosynthetic pathway
          Length = 250

 Score = 32.3 bits (72), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 23/36 (63%), Gaps = 1/36 (2%)

Query: 53  EQVIESGANGSVGTEKDIESINKDFLQRTKGLEPDI 88
           E++IES  NGS      I    ++FLQR KGLEPD+
Sbjct: 199 EEIIESIKNGSNHRVASIGPTTEEFLQR-KGLEPDV 233

>CAGL0H07051g Chr8 complement(698202..699338) [1137 bp, 378 aa] {ON}
           highly similar to uniprot|P38986 Saccharomyces
           cerevisiae YDR321w ASP1
          Length = 378

 Score = 32.3 bits (72), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 59/129 (45%), Gaps = 9/129 (6%)

Query: 533 IDSDTAHEIDDGVSVENHGKDGMYTLH-IHIADPTSMFPESTAIDSVGISTDILNIAFKR 591
           ID     +I  G+S      DG+   H       T+ F EST ID+  +   I+ +   R
Sbjct: 104 IDEALLFKIYKGISDSLQSFDGIVITHGTDTLAETAFFIEST-IDAGDVP--IVLVGSMR 160

Query: 592 SFTTYLPDVVVPM-LPQAICHLSDLGKHGKRTKTISFSVDVKVGYQGCGKSLEIMYDSFR 650
             T+   D   PM L QAIC  SD    G R+  +S +  +  GY    K+     D+F 
Sbjct: 161 PSTSVSADG--PMNLYQAICIASDKKSRG-RSVLVSLNDQISAGYY-ITKTNANSLDTFN 216

Query: 651 IRKGFVSNF 659
           +R+G++ NF
Sbjct: 217 VRQGYLGNF 225

>KLTH0H14960g Chr8 (1295363..1296490) [1128 bp, 375 aa] {ON} highly
           similar to uniprot|P38986 Saccharomyces cerevisiae
           YDR321W ASP1 Cytosolic L-asparaginase involved in
           asparagine catabolism
          Length = 375

 Score = 32.3 bits (72), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 55/118 (46%), Gaps = 17/118 (14%)

Query: 543 DGVSVENHGKDGMYTLHIHIADPTSMFPESTAIDSVGISTDILNIAFKRSFTTYLPDVVV 602
           DG+ +  HG D +          T+ F EST IDS  +   I+ +   R  T+   D   
Sbjct: 121 DGIVI-THGTDTLAE--------TTFFIEST-IDSGDVP--IVFVGSMRPSTSISADG-- 166

Query: 603 PM-LPQAICHLSDLGKHGKRTKTISFSVDVKVGYQGCGKSLEIMYDSFRIRKGFVSNF 659
           PM L QAIC  +D    G R   +S +  +  GY    K+     DSF +R+G++ NF
Sbjct: 167 PMNLYQAICIAADKQSRG-RGVLVSLNDQISAGYY-ITKTNANTLDSFNVRQGYLGNF 222

>NDAI0C04340 Chr3 (987226..988404) [1179 bp, 392 aa] {ON} Anc_5.356
          Length = 392

 Score = 32.3 bits (72), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 39/122 (31%), Positives = 57/122 (46%), Gaps = 9/122 (7%)

Query: 540 EIDDGVSVENHGKDGMYTLH-IHIADPTSMFPESTAIDSVGISTDILNIAFKRSFTTYLP 598
           +I   VS    G DG+   H       T+ F EST ID+  +   I+ +   R  T+   
Sbjct: 127 KIYKAVSEALQGFDGIVITHGTDTLSETAFFIEST-IDAGDVP--IVFVGSMRPSTSVSA 183

Query: 599 DVVVPM-LPQAICHLSDLGKHGKRTKTISFSVDVKVGYQGCGKSLEIMYDSFRIRKGFVS 657
           D   PM L QAIC  S+    G R+  +S +  +  GY    K+     DSF +R+G++ 
Sbjct: 184 DG--PMNLYQAICIASNPKSRG-RSVLVSLNDQISAGYY-ITKTNANSLDSFNVRQGYLG 239

Query: 658 NF 659
           NF
Sbjct: 240 NF 241

>ZYRO0G16852g Chr7 complement(1381740..1385561) [3822 bp, 1273 aa]
           {ON} similar to uniprot|P24276 Saccharomyces cerevisiae
           YDR293C SSD1 Protein with a role in maintenance of
           cellular integrity interacts with components of the TOR
           pathway ssd1 mutant of a clinical S. cerevisiae strain
           displays elevated virulence
          Length = 1273

 Score = 32.7 bits (73), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 44/88 (50%), Gaps = 14/88 (15%)

Query: 550 HGKDGMYTLHI--HIADPTSMFPESTAIDSVGISTDILNIAFKRSFTTYLPDVVVPMLPQ 607
           H K G  T+ +  H+ D T+   E +++D           A KRS   ++P  VV +LPQ
Sbjct: 741 HIKRGPDTIELGCHVVDATAHIEEGSSLDRR---------ARKRSTAVFMPQKVVDLLPQ 791

Query: 608 AICHLSDLGKHGKRTKTIS--FSVDVKV 633
           A+     L + GK + T+S  +++D + 
Sbjct: 792 ALNKSLTL-EAGKTSATLSVVYTLDART 818

>YDL225W Chr4 (52445..54100) [1656 bp, 551 aa] {ON}  SHS1Component
           of the septin ring that is required for cytokinesis;
           septins are GTP-binding proteins that assemble into
           rod-like hetero-oligomers that can associate with other
           rods to form filaments; septin rings at the mother-bud
           neck act as scaffolds for recruiting cell division
           factors and as barriers to prevent diffusion of specific
           proteins between mother and daughter cells; undergoes
           sumoylation and phosphorylation during mitosis
          Length = 551

 Score = 32.0 bits (71), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 22/32 (68%), Gaps = 1/32 (3%)

Query: 224 LIQPEGHH-KHLPIGTLKNISNQTNILPIVTR 254
            I+P GH  + + +  +K+IS  TN+LPI+TR
Sbjct: 187 FIEPTGHGLREVDVELMKSISKYTNVLPIITR 218

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 100,177,163
Number of extensions: 4435743
Number of successful extensions: 13652
Number of sequences better than 10.0: 88
Number of HSP's gapped: 13862
Number of HSP's successfully gapped: 103
Length of query: 969
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 850
Effective length of database: 39,836,145
Effective search space: 33860723250
Effective search space used: 33860723250
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 71 (32.0 bits)