Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_13.5008.849ON60260231160.0
YMR284W (YKU70)8.849ON60258726250.0
Skud_13.4578.849ON60260225930.0
Suva_13.4748.849ON60258725730.0
TDEL0B001808.849ON58256016770.0
NCAS0C003208.849ON60857716610.0
ZYRO0C14850g8.849ON59455716090.0
NDAI0K003608.849ON62057915560.0
Kwal_27.101998.849ON57256414950.0
KAFR0L019508.849ON58858014920.0
TPHA0I003108.849ON60857814770.0
SAKL0D01188g8.849ON58156114320.0
KLTH0C03586g8.849ON57856014200.0
Kpol_1068.18.849ON51447913860.0
KNAG0M02650singletonON57456713700.0
TBLA0B028908.849ON64862313750.0
CAGL0I02662g8.849ON60656713710.0
KLLA0C06226g8.849ON59257913540.0
AFR443CsingletonON57656910161e-130
Ecym_46208.849ON5975569331e-118
ABL117C8.849ON6025627108e-85
YMR106C (YKU80)2.444ON629146900.032
NCAS0F014802.444ON625198840.16
TBLA0B090202.444ON681159790.54
NCAS0H008206.20ON114637752.2
Ecym_24762.444ON611263742.3
NCAS0D023605.13ON55978733.1
YMR094W (CTF13)2.467ON478111724.2
ZYRO0B10934g5.183ON534273698.1
TPHA0G024602.444ON626147698.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_13.500
         (602 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_13.500 Chr13 (820721..822529) [1809 bp, 602 aa] {ON} YMR284...  1204   0.0  
YMR284W Chr13 (838187..839995) [1809 bp, 602 aa] {ON}  YKU70Subu...  1015   0.0  
Skud_13.457 Chr13 (811730..813538) [1809 bp, 602 aa] {ON} YMR284...  1003   0.0  
Suva_13.474 Chr13 (820105..821913) [1809 bp, 602 aa] {ON} YMR284...   995   0.0  
TDEL0B00180 Chr2 (35263..37011) [1749 bp, 582 aa] {ON} Anc_8.849...   650   0.0  
NCAS0C00320 Chr3 complement(44190..46016) [1827 bp, 608 aa] {ON}...   644   0.0  
ZYRO0C14850g Chr3 (1154196..1155980) [1785 bp, 594 aa] {ON} simi...   624   0.0  
NDAI0K00360 Chr11 (76452..78314) [1863 bp, 620 aa] {ON} Anc_8.849     603   0.0  
Kwal_27.10199 s27 (238096..239814) [1719 bp, 572 aa] {ON} YMR284...   580   0.0  
KAFR0L01950 Chr12 (368933..370699) [1767 bp, 588 aa] {ON} Anc_8....   579   0.0  
TPHA0I00310 Chr9 (59576..61402) [1827 bp, 608 aa] {ON} Anc_8.849...   573   0.0  
SAKL0D01188g Chr4 complement(87783..89528) [1746 bp, 581 aa] {ON...   556   0.0  
KLTH0C03586g Chr3 (311969..313705) [1737 bp, 578 aa] {ON} simila...   551   0.0  
Kpol_1068.1 s1068 complement(1..1542) [1542 bp, 514 aa] {ON} com...   538   0.0  
KNAG0M02650 Chr13 complement(490275..491999) [1725 bp, 574 aa] {...   532   0.0  
TBLA0B02890 Chr2 (666770..668716) [1947 bp, 648 aa] {ON} Anc_8.8...   534   0.0  
CAGL0I02662g Chr9 (237396..239216) [1821 bp, 606 aa] {ON} simila...   532   0.0  
KLLA0C06226g Chr3 (550683..552461) [1779 bp, 592 aa] {ON} simila...   526   0.0  
AFR443C Chr6 complement(1236336..1238066) [1731 bp, 576 aa] {ON}...   395   e-130
Ecym_4620 Chr4 complement(1213899..1215692) [1794 bp, 597 aa] {O...   363   e-118
ABL117C Chr2 complement(179060..180868) [1809 bp, 602 aa] {ON} S...   278   8e-85
YMR106C Chr13 complement(478301..480190) [1890 bp, 629 aa] {ON} ...    39   0.032
NCAS0F01480 Chr6 complement(295334..297211) [1878 bp, 625 aa] {O...    37   0.16 
TBLA0B09020 Chr2 complement(2138426..2140471) [2046 bp, 681 aa] ...    35   0.54 
NCAS0H00820 Chr8 (148184..151624) [3441 bp, 1146 aa] {ON} Anc_6....    33   2.2  
Ecym_2476 Chr2 complement(930107..931942) [1836 bp, 611 aa] {ON}...    33   2.3  
NCAS0D02360 Chr4 complement(442333..444012) [1680 bp, 559 aa] {O...    33   3.1  
YMR094W Chr13 (455825..457261) [1437 bp, 478 aa] {ON}  CTF13Subu...    32   4.2  
ZYRO0B10934g Chr2 complement(861789..863393) [1605 bp, 534 aa] {...    31   8.1  
TPHA0G02460 Chr7 (504893..506773) [1881 bp, 626 aa] {ON} Anc_2.4...    31   8.7  

>Smik_13.500 Chr13 (820721..822529) [1809 bp, 602 aa] {ON} YMR284W
           (REAL)
          Length = 602

 Score = 1204 bits (3116), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 590/602 (98%), Positives = 590/602 (98%)

Query: 1   MQSINNAFGSTDDFNNEMDEPGYRKFDMHEGILFCVELSETMFKESSELDYKSPLLEILE 60
           MQSINNAFGSTDDFNNEMDEPGYRKFDMHEGILFCVELSETMFKESSELDYKSPLLEILE
Sbjct: 1   MQSINNAFGSTDDFNNEMDEPGYRKFDMHEGILFCVELSETMFKESSELDYKSPLLEILE 60

Query: 61  SLNELMSQLVITRPGTAIGCYFYYCYRDDAKEGIYELFPLRDINVRFMKKLNDLLEDLSS 120
           SLNELMSQLVITRPGTAIGCYFYYCYRDDAKEGIYELFPLRDINVRFMKKLNDLLEDLSS
Sbjct: 61  SLNELMSQLVITRPGTAIGCYFYYCYRDDAKEGIYELFPLRDINVRFMKKLNDLLEDLSS 120

Query: 121 ERVTLYEYFNFQKTENQKQMPLASLFTFILDTFLQDSSGQKQLNNKRVFLFTDNDKPQEA 180
           ERVTLYEYFNFQKTENQKQMPLASLFTFILDTFLQDSSGQKQLNNKRVFLFTDNDKPQEA
Sbjct: 121 ERVTLYEYFNFQKTENQKQMPLASLFTFILDTFLQDSSGQKQLNNKRVFLFTDNDKPQEA 180

Query: 181 QNADDRARLRRLTVDLFDNKINFTTFFIGYVNNSFDNEFYSDILQLGSHKNKTIGLNSEF 240
           QNADDRARLRRLTVDLFDNKINFTTFFIGYVNNSFDNEFYSDILQLGSHKNKTIGLNSEF
Sbjct: 181 QNADDRARLRRLTVDLFDNKINFTTFFIGYVNNSFDNEFYSDILQLGSHKNKTIGLNSEF 240

Query: 241 DGPNTKPIDAKYIKSRILRKREVKRIMFQCQLIFDEKTDFIIGIKGYTMYSHEKAGVRYK 300
           DGPNTKPIDAKYIKSRILRKREVKRIMFQCQLIFDEKTDFIIGIKGYTMYSHEKAGVRYK
Sbjct: 241 DGPNTKPIDAKYIKSRILRKREVKRIMFQCQLIFDEKTDFIIGIKGYTMYSHEKAGVRYK 300

Query: 301 LVYEHEDIRQEAYSKRKFLNFMSGEDVTDNTVKVYPYGDLDINLSEHQDQIVMEAYTRKD 360
           LVYEHEDIRQEAYSKRKFLNFMSGEDVTDNTVKVYPYGDLDINLSEHQDQIVMEAYTRKD
Sbjct: 301 LVYEHEDIRQEAYSKRKFLNFMSGEDVTDNTVKVYPYGDLDINLSEHQDQIVMEAYTRKD 360

Query: 361 AFLKITGFRSSSISMHYFNNIEKSSFIVPDEEKYEGSIRALTSLLKILRKKDKIAILWGK 420
           AFLKITGFRSSSISMHYFNNIEKSSFIVPDEEKYEGSIRALTSLLKILRKKDKIAILWGK
Sbjct: 361 AFLKITGFRSSSISMHYFNNIEKSSFIVPDEEKYEGSIRALTSLLKILRKKDKIAILWGK 420

Query: 421 LKSNSHPSLFVLSPSNIKEYNEGFYLYRVPFLDEIRKFPSLLSYDDGSDHEIDYDNMKKV 480
           LKSNSHPSLFVLSPSNIKEYNEGFYLYRVPFLDEIRKFPSLLSYDDGSDHEIDYDNMKKV
Sbjct: 421 LKSNSHPSLFVLSPSNIKEYNEGFYLYRVPFLDEIRKFPSLLSYDDGSDHEIDYDNMKKV 480

Query: 481 TQSIIGYFNLRDGYNPSDFKNPLLQKHYKVLHDYLLQTETAFEENETSDTKMDRIVHEDD 540
           TQSIIGYFNLRDGYNPSDFKNPLLQKHYKVLHDYLLQTETAFEENETSDTKMDRIVHEDD
Sbjct: 481 TQSIIGYFNLRDGYNPSDFKNPLLQKHYKVLHDYLLQTETAFEENETSDTKMDRIVHEDD 540

Query: 541 SLRKLYHIRNKILESEKSEDPAIQRLNKYVKIWNMFYKKFNVDDISVXXXXXXXXXXXXF 600
           SLRKLYHIRNKILESEKSEDPAIQRLNKYVKIWNMFYKKFNVDDISV            F
Sbjct: 541 SLRKLYHIRNKILESEKSEDPAIQRLNKYVKIWNMFYKKFNVDDISVKKEKKSLDKKPKF 600

Query: 601 NI 602
           NI
Sbjct: 601 NI 602

>YMR284W Chr13 (838187..839995) [1809 bp, 602 aa] {ON}  YKU70Subunit
           of the telomeric Ku complex (Yku70p-Yku80p), involved in
           telomere length maintenance, structure and telomere
           position effect; relocates to sites of double-strand
           cleavage to promote nonhomologous end joining during DSB
           repair
          Length = 602

 Score = 1015 bits (2625), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 485/587 (82%), Positives = 545/587 (92%)

Query: 1   MQSINNAFGSTDDFNNEMDEPGYRKFDMHEGILFCVELSETMFKESSELDYKSPLLEILE 60
           M+S+ NAFG++ + N+++DE GYRKFD+HEGILFC+ELSETMFKESS+L+YKSPLLEILE
Sbjct: 1   MRSVTNAFGNSGELNDQVDETGYRKFDIHEGILFCIELSETMFKESSDLEYKSPLLEILE 60

Query: 61  SLNELMSQLVITRPGTAIGCYFYYCYRDDAKEGIYELFPLRDINVRFMKKLNDLLEDLSS 120
           SL+ELMSQLVITRPGTAIGCYFYYC R+DAKEGIYELFPLRDIN  FMKKLNDLLEDLSS
Sbjct: 61  SLDELMSQLVITRPGTAIGCYFYYCNREDAKEGIYELFPLRDINATFMKKLNDLLEDLSS 120

Query: 121 ERVTLYEYFNFQKTENQKQMPLASLFTFILDTFLQDSSGQKQLNNKRVFLFTDNDKPQEA 180
            R++LY+YF FQ+T ++KQ+ L+ LFTF+LDTFL++  GQKQL+NKRVFLFTD DKPQEA
Sbjct: 121 GRISLYDYFMFQQTGSEKQVRLSVLFTFMLDTFLEEIPGQKQLSNKRVFLFTDIDKPQEA 180

Query: 181 QNADDRARLRRLTVDLFDNKINFTTFFIGYVNNSFDNEFYSDILQLGSHKNKTIGLNSEF 240
           Q+ D+RARLRRLT+DLFDNK+NF TFFIGY +  FDNEFYSDILQLGSH N+  GL+SEF
Sbjct: 181 QDIDERARLRRLTIDLFDNKVNFATFFIGYADKPFDNEFYSDILQLGSHTNENTGLDSEF 240

Query: 241 DGPNTKPIDAKYIKSRILRKREVKRIMFQCQLIFDEKTDFIIGIKGYTMYSHEKAGVRYK 300
           DGP+TKPIDAKYIKSRILRK+EVKRIMFQC LI DEKT+FI+G+KGYTMY+HEKAGVRYK
Sbjct: 241 DGPSTKPIDAKYIKSRILRKKEVKRIMFQCPLILDEKTNFIVGVKGYTMYTHEKAGVRYK 300

Query: 301 LVYEHEDIRQEAYSKRKFLNFMSGEDVTDNTVKVYPYGDLDINLSEHQDQIVMEAYTRKD 360
           LVYEHEDIRQEAYSKRKFLN ++GEDVT  TVKVYPYGDLDINLS+ QDQIVMEAYT+KD
Sbjct: 301 LVYEHEDIRQEAYSKRKFLNPITGEDVTGKTVKVYPYGDLDINLSDSQDQIVMEAYTQKD 360

Query: 361 AFLKITGFRSSSISMHYFNNIEKSSFIVPDEEKYEGSIRALTSLLKILRKKDKIAILWGK 420
           AFLKI GFRSSS S+HYFNNI+KSSFIVPDE KYEGSIR L SLLKILRKKDKIAILWGK
Sbjct: 361 AFLKIIGFRSSSKSIHYFNNIDKSSFIVPDEAKYEGSIRTLASLLKILRKKDKIAILWGK 420

Query: 421 LKSNSHPSLFVLSPSNIKEYNEGFYLYRVPFLDEIRKFPSLLSYDDGSDHEIDYDNMKKV 480
           LKSNSHPSL+ LSPS++K+YNEGFYLYRVPFLDEIRKFPSLLSYDDGS+H++DYDNMKKV
Sbjct: 421 LKSNSHPSLYTLSPSSVKDYNEGFYLYRVPFLDEIRKFPSLLSYDDGSEHKLDYDNMKKV 480

Query: 481 TQSIIGYFNLRDGYNPSDFKNPLLQKHYKVLHDYLLQTETAFEENETSDTKMDRIVHEDD 540
           TQSI+GYFNLRDGYNPSDFKNPLLQKHYKVLHDYLLQ ET F+ENET +TK DR++ EDD
Sbjct: 481 TQSIMGYFNLRDGYNPSDFKNPLLQKHYKVLHDYLLQIETTFDENETPNTKKDRMMREDD 540

Query: 541 SLRKLYHIRNKILESEKSEDPAIQRLNKYVKIWNMFYKKFNVDDISV 587
           SLRKLY+IRNKILESEKSEDP IQRLNKYVKIWNMFYKKFN D+IS+
Sbjct: 541 SLRKLYYIRNKILESEKSEDPIIQRLNKYVKIWNMFYKKFNDDNISI 587

>Skud_13.457 Chr13 (811730..813538) [1809 bp, 602 aa] {ON} YMR284W
           (REAL)
          Length = 602

 Score = 1003 bits (2593), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 477/602 (79%), Positives = 536/602 (89%)

Query: 1   MQSINNAFGSTDDFNNEMDEPGYRKFDMHEGILFCVELSETMFKESSELDYKSPLLEILE 60
           MQ+ +NAFG   + N+ MD+ GYRKFD+HEGILFCVELSETMFKES ELDYKSPLLEILE
Sbjct: 1   MQASSNAFGGIGELNDVMDDAGYRKFDIHEGILFCVELSETMFKESQELDYKSPLLEILE 60

Query: 61  SLNELMSQLVITRPGTAIGCYFYYCYRDDAKEGIYELFPLRDINVRFMKKLNDLLEDLSS 120
           SLNELMSQLVITRPGTAIGCYFYYC RDDAK+GI+E  PLRDIN  FMK+LNDLLEDLSS
Sbjct: 61  SLNELMSQLVITRPGTAIGCYFYYCSRDDAKQGIFEFSPLRDINATFMKRLNDLLEDLSS 120

Query: 121 ERVTLYEYFNFQKTENQKQMPLASLFTFILDTFLQDSSGQKQLNNKRVFLFTDNDKPQEA 180
            R+TLYEYFNFQ TE Q+QMPL  LFTF+LDTFLQD  GQ+QL++K+VFLFTDND PQEA
Sbjct: 121 GRMTLYEYFNFQPTEKQRQMPLGVLFTFMLDTFLQDIPGQRQLSSKKVFLFTDNDIPQEA 180

Query: 181 QNADDRARLRRLTVDLFDNKINFTTFFIGYVNNSFDNEFYSDILQLGSHKNKTIGLNSEF 240
           Q+ DDRARLR LT+DLFDNK+NF+TFFIGY N SFDNEFYSDILQLGSH NK +GLNSEF
Sbjct: 181 QDTDDRARLRSLTIDLFDNKVNFSTFFIGYANKSFDNEFYSDILQLGSHTNKGVGLNSEF 240

Query: 241 DGPNTKPIDAKYIKSRILRKREVKRIMFQCQLIFDEKTDFIIGIKGYTMYSHEKAGVRYK 300
           DGPNTKPI+AKYIKS+ILRK+E+KRIMFQC L+F E  DF +G+KGYTMYSHEKAGVRYK
Sbjct: 241 DGPNTKPINAKYIKSKILRKKEIKRIMFQCPLMFGENEDFTVGVKGYTMYSHEKAGVRYK 300

Query: 301 LVYEHEDIRQEAYSKRKFLNFMSGEDVTDNTVKVYPYGDLDINLSEHQDQIVMEAYTRKD 360
           LVYEHED+R+EA+SKRKFLN M+GEDVT +TVKVYPYGDLDIN SE+Q+QIVMEAYT+KD
Sbjct: 301 LVYEHEDVRREAFSKRKFLNPMTGEDVTSSTVKVYPYGDLDINFSENQNQIVMEAYTQKD 360

Query: 361 AFLKITGFRSSSISMHYFNNIEKSSFIVPDEEKYEGSIRALTSLLKILRKKDKIAILWGK 420
           AFL+I GFRSSS ++HYFNNIEKS+FIVPDE KYEGS+R LTSL K LRKKDKIAILWGK
Sbjct: 361 AFLRIIGFRSSSKAIHYFNNIEKSAFIVPDEAKYEGSVRTLTSLFKTLRKKDKIAILWGK 420

Query: 421 LKSNSHPSLFVLSPSNIKEYNEGFYLYRVPFLDEIRKFPSLLSYDDGSDHEIDYDNMKKV 480
           LK+NSH SLFVLSPS+IKEYNEGFYLYRVPFLDEIRKFPSLLSYD+G  +++DY+NMKK+
Sbjct: 421 LKTNSHASLFVLSPSSIKEYNEGFYLYRVPFLDEIRKFPSLLSYDNGEKYKLDYENMKKI 480

Query: 481 TQSIIGYFNLRDGYNPSDFKNPLLQKHYKVLHDYLLQTETAFEENETSDTKMDRIVHEDD 540
           TQ+I+GYFNL+DGYNPSDF+NP LQKH+KVLHDYLLQ ET  E NET D K++RI+HEDD
Sbjct: 481 TQNIMGYFNLKDGYNPSDFRNPSLQKHFKVLHDYLLQIETTPEGNETPDAKLNRIIHEDD 540

Query: 541 SLRKLYHIRNKILESEKSEDPAIQRLNKYVKIWNMFYKKFNVDDISVXXXXXXXXXXXXF 600
           SLRKLYHIRNKIL+SEKSEDPAIQRLNKYVKIWN+FY KFN D ISV            F
Sbjct: 541 SLRKLYHIRNKILDSEKSEDPAIQRLNKYVKIWNVFYNKFNDDSISVKEEKKPLDKKPKF 600

Query: 601 NI 602
           NI
Sbjct: 601 NI 602

>Suva_13.474 Chr13 (820105..821913) [1809 bp, 602 aa] {ON} YMR284W
           (REAL)
          Length = 602

 Score =  995 bits (2573), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 470/587 (80%), Positives = 531/587 (90%)

Query: 1   MQSINNAFGSTDDFNNEMDEPGYRKFDMHEGILFCVELSETMFKESSELDYKSPLLEILE 60
           MQS  + F S   FN+  ++  YRKFD+HEGILFC+ELS +MFKES EL+YKSPLLEILE
Sbjct: 1   MQSPTHGFNSIGSFNDITEDASYRKFDIHEGILFCIELSASMFKESPELNYKSPLLEILE 60

Query: 61  SLNELMSQLVITRPGTAIGCYFYYCYRDDAKEGIYELFPLRDINVRFMKKLNDLLEDLSS 120
           SLNELMSQLVITRPGT+IGCYFYYC RDDAKEGIYELFPLRDIN +FMK LNDLLED+SS
Sbjct: 61  SLNELMSQLVITRPGTSIGCYFYYCGRDDAKEGIYELFPLRDINAKFMKILNDLLEDVSS 120

Query: 121 ERVTLYEYFNFQKTENQKQMPLASLFTFILDTFLQDSSGQKQLNNKRVFLFTDNDKPQEA 180
            R+TL+EYFNFQ +E Q QMPL  LFTF+LDTFLQD  GQKQL++K++FLFTDNDKPQE+
Sbjct: 121 GRITLFEYFNFQHSEKQMQMPLGKLFTFMLDTFLQDIPGQKQLSSKKIFLFTDNDKPQES 180

Query: 181 QNADDRARLRRLTVDLFDNKINFTTFFIGYVNNSFDNEFYSDILQLGSHKNKTIGLNSEF 240
           Q+AD+RARLRRLT+DLFDNK+NF TFFIGY NNSFDNEFYSDILQLGSHKNK + L+SEF
Sbjct: 181 QDADERARLRRLTIDLFDNKVNFATFFIGYGNNSFDNEFYSDILQLGSHKNKGVDLDSEF 240

Query: 241 DGPNTKPIDAKYIKSRILRKREVKRIMFQCQLIFDEKTDFIIGIKGYTMYSHEKAGVRYK 300
           DGPNTKPIDAKYIKS+ILRK+EVKRI FQC LIFDE T+FIIG+KGYTM+SHEKAGVRYK
Sbjct: 241 DGPNTKPIDAKYIKSKILRKKEVKRIAFQCPLIFDEDTNFIIGVKGYTMHSHEKAGVRYK 300

Query: 301 LVYEHEDIRQEAYSKRKFLNFMSGEDVTDNTVKVYPYGDLDINLSEHQDQIVMEAYTRKD 360
           LVYEHEDIRQEAYSKRKFLN  +G DVT +TVKVYPYGDLDINLSE Q+Q++MEAYT+KD
Sbjct: 301 LVYEHEDIRQEAYSKRKFLNPTTGADVTGSTVKVYPYGDLDINLSEKQNQVIMEAYTQKD 360

Query: 361 AFLKITGFRSSSISMHYFNNIEKSSFIVPDEEKYEGSIRALTSLLKILRKKDKIAILWGK 420
            FL+I GFRS + S+HYFNNIEKS+FIVPDE KYEGSIR L SLLK LRKKDK+AI+WGK
Sbjct: 361 GFLRIIGFRSPTSSIHYFNNIEKSTFIVPDEAKYEGSIRTLASLLKTLRKKDKVAIVWGK 420

Query: 421 LKSNSHPSLFVLSPSNIKEYNEGFYLYRVPFLDEIRKFPSLLSYDDGSDHEIDYDNMKKV 480
           LKSNSHPSLFVLSPS+I+EYNEGFYLYR+PFLDEIRKFPSLLSYD G  HE++YDNMK++
Sbjct: 421 LKSNSHPSLFVLSPSSIEEYNEGFYLYRIPFLDEIRKFPSLLSYDSGEKHELEYDNMKRI 480

Query: 481 TQSIIGYFNLRDGYNPSDFKNPLLQKHYKVLHDYLLQTETAFEENETSDTKMDRIVHEDD 540
           +QSI+GYFNLRDGYNPSDFKNP LQ+H+KVLHDYLLQ E   EENETS+ +++R++HEDD
Sbjct: 481 SQSIMGYFNLRDGYNPSDFKNPSLQRHFKVLHDYLLQIEVNIEENETSEARINRVIHEDD 540

Query: 541 SLRKLYHIRNKILESEKSEDPAIQRLNKYVKIWNMFYKKFNVDDISV 587
           SLRKLYHIRNKILESEKSEDPAIQRLNKYVKIWN FY KFN D+ISV
Sbjct: 541 SLRKLYHIRNKILESEKSEDPAIQRLNKYVKIWNTFYNKFNDDNISV 587

>TDEL0B00180 Chr2 (35263..37011) [1749 bp, 582 aa] {ON} Anc_8.849
           YMR284W
          Length = 582

 Score =  650 bits (1677), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/560 (56%), Positives = 413/560 (73%), Gaps = 13/560 (2%)

Query: 22  GYRKFDMHEGILFCVELSETMFKESSELDYKSPLLEILESLNELMSQLVITRPGTAIGCY 81
           GYR++D+HEGI+FC+ELS  MF E  EL+YK  L+EILE+L++LMSQLVITRP T IGCY
Sbjct: 15  GYRRYDIHEGIIFCIELSNGMFDELPELNYKIQLIEILETLDQLMSQLVITRPSTGIGCY 74

Query: 82  FYYCYRDDAKEGIYELFPLRDINVRFMKKLNDLLEDLSSERVTLYEYFNFQKTENQKQMP 141
           F+ C R DAK+GIY   PL+D+N + MKKL+DLLEDL  ER TL ++  +  +   K  P
Sbjct: 75  FFNCNRSDAKDGIYPFLPLKDVNAQTMKKLSDLLEDLQYERTTLRQFLPYDAS---KHTP 131

Query: 142 LASLFTFILDTFLQDSSGQKQLNNKRVFLFTDNDKPQEAQNADDRARLRRLTVDLFDNKI 201
           L SL   + + F++D   QK  NNK++F FTDND P EA + D ++RLR L  DL D  I
Sbjct: 132 LESLLELVREEFVKDVPDQKAFNNKKIFYFTDNDSPPEASDIDAKSRLRHLVNDLDDRFI 191

Query: 202 NFTTFFIGYVNNSFDNEFYSDILQLGSHKNKTIGLNSEFDGPNTKPIDAKYIKSRILRKR 261
           NFTTFFIG     FD  FYSDIL+LG+    T   + EFDGPNT PI A YIKSR+LRK+
Sbjct: 192 NFTTFFIGKPGLPFDEGFYSDILRLGA----TTKASDEFDGPNTTPISAAYIKSRVLRKQ 247

Query: 262 EVKRIMFQCQLIFDEKTDFIIGIKGYTMYSHEKAGVRYKLVYEHEDIRQEAYSKRKFLNF 321
           E+KRIMFQC LI +EK+ FI+G+KGYT+ SHEK GVRYKLVYE+EDIRQEA+S+RK+LN 
Sbjct: 248 EIKRIMFQCPLILEEKSKFIVGVKGYTIISHEKPGVRYKLVYENEDIRQEAFSRRKYLNA 307

Query: 322 MSGEDVTDNTVKVYPYGDLDINLSEHQDQIVMEAYTRKDAFLKITGFRSSSISMHYFNNI 381
            +GE++ D   KVYPYGDLDI LSE     +   Y  +++FLK+ GF+S+   +HY+NNI
Sbjct: 308 KTGEEIKDGLTKVYPYGDLDIELSESDIAEIRNDYAGEESFLKVIGFQSTETCLHYYNNI 367

Query: 382 EKSSFIVPDEEKYEGSIRALTSLLKILRKKDKIAILWGKLKSNSHPSLFVLSPSNIKEYN 441
           EK++F+VPDE +YEGSIR L+SL K LR+K+K+AI+WGKLKSNS+P++F   PS+    N
Sbjct: 368 EKATFVVPDEGRYEGSIRTLSSLFKNLRQKNKVAIVWGKLKSNSNPAIFFFVPSDEASPN 427

Query: 442 EGFYLYRVPFLDEIRKFPSLLSYDDGSDHEIDYDNMKKVTQSIIGYFNLRDGYNPSDFKN 501
           EGFYLYRVPFLDE+R+ P +L    G   + DY+N+K+ T+ +I +FNL++G+ PS+FKN
Sbjct: 428 EGFYLYRVPFLDELRRIPPML-ISHGEIQDDDYENLKEATKKLINHFNLKNGFEPSEFKN 486

Query: 502 PLLQKHYKVLHDYLLQTETAFEENETSDTKMDR--IVHEDDSLRKLYHIRNKILESEKSE 559
           P LQKH+K+LHDYLLQ E   EE E  D +  R  ++ EDDSLR++  IR+KI ES  S+
Sbjct: 487 PGLQKHFKILHDYLLQIE---EEPEKDDVEWQRSKLLEEDDSLRRISQIRDKIDESANSK 543

Query: 560 DPAIQRLNKYVKIWNMFYKK 579
           DP  Q+L+KY+ IWN  Y K
Sbjct: 544 DPNKQKLSKYLAIWNSLYDK 563

>NCAS0C00320 Chr3 complement(44190..46016) [1827 bp, 608 aa] {ON}
           Anc_8.849
          Length = 608

 Score =  644 bits (1661), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/577 (54%), Positives = 425/577 (73%), Gaps = 16/577 (2%)

Query: 19  DEPGYRKFDMHEGILFCVELSETMFKESSELDYKSPLLEILESLNELMSQLVITRPGTAI 78
           D P ++K+D+HEGI+FC+ELS++MF+E  EL+YK  LLEILESL+ELMSQLVI RP T I
Sbjct: 10  DHPSFKKYDIHEGIIFCIELSKSMFEEVPELNYKVQLLEILESLHELMSQLVIIRPSTGI 69

Query: 79  GCYFYYCYR--DDAKEGIYELFPLRDINVRFMKKLNDLLEDLSSERVTLYEYFNFQKT-- 134
           GCYF+YC R   D+K GIYE FPLRD+N R MKK++DL+EDL+ +R+TL EYFNF  T  
Sbjct: 70  GCYFHYCDRKNGDSKNGIYEFFPLRDVNARDMKKVSDLIEDLTLKRITLLEYFNFDPTLD 129

Query: 135 -ENQKQMPLASLFTFILDTFLQDSSGQKQLNNKRVFLFTDNDKPQEAQNADDRARLRRLT 193
            ++QK++PL +LF F+LD F + ++   + ++K++FLFTDND P E  + D   R+RR+ 
Sbjct: 130 NDSQKRVPLETLFNFLLDQFTKLTADSNKYHSKKIFLFTDNDSPHEVNDKDATLRIRRIV 189

Query: 194 VDLFDNKINFTTFFIGYVNNSFDNEFYSDILQLGSHKNK-----TIGLN----SEFDGPN 244
            D+ DN INF TFFIG     F N FYS+IL+LGS  NK     + G      SE+DGPN
Sbjct: 190 DDMNDNYINFVTFFIGREGKPFKNSFYSNILKLGSKVNKENLAQSDGTGDEEYSEYDGPN 249

Query: 245 TKPIDAKYIKSRILRKREVKRIMFQCQLIFDEKTDFIIGIKGYTMYSHEKAGVRYKLVYE 304
           T PI A YIKS+ILRK+E+KR MFQC LI  E+ +FI+ ++GY + + EK   RYKLVYE
Sbjct: 250 TTPIPASYIKSKILRKKEIKRTMFQCPLILKEENNFIVSVRGYAIVTQEKPATRYKLVYE 309

Query: 305 HEDIRQEAYSKRKFLNFMSGEDV-TDNTVKVYPYGDLDINLSEHQDQIVMEAYTRKDAFL 363
           HE+IR+EA S+RKFLN  +GE++  D   KV+PYGD DI L++ +   + + Y++ ++FL
Sbjct: 310 HENIRKEASSRRKFLNPNTGEEIKPDELCKVFPYGDQDIELNDKEVAKINDDYSKHESFL 369

Query: 364 KITGFRSSSISMHYFNNIEKSSFIVPDEEKYEGSIRALTSLLKILRKKDKIAILWGKLKS 423
           K+ GFRS+  S+ YFNNI+K+ F+VPDE +YEG+I+ + SL ++L+K+DK  I+WGK+KS
Sbjct: 370 KVIGFRSTKNSIRYFNNIDKALFVVPDESQYEGTIKTMASLFRVLKKRDKCMIVWGKVKS 429

Query: 424 NSHPSLFVLSPSNIKEYNEGFYLYRVPFLDEIRKFPSLLSYDDGSDHEIDYDNMKKVTQS 483
           NS+  L++LSP+   + NEGFYLYR+PFLDEIRKFP LL Y+  +  E DY N+ ++T++
Sbjct: 430 NSNLRLYILSPTTNIDRNEGFYLYRIPFLDEIRKFPKLLDYNHITTSE-DYLNLVRITEN 488

Query: 484 IIGYFNLRDGYNPSDFKNPLLQKHYKVLHDYLLQTETAFEENETSDTKMDRIVHEDDSLR 543
           IIGYFNL+ GY PSDFKNP LQ+HYK LHDYLLQ E    E+  SD +  R + EDD+L 
Sbjct: 489 IIGYFNLKKGYRPSDFKNPSLQRHYKTLHDYLLQVEQPVREDGDSDGQTSRFLKEDDTLN 548

Query: 544 KLYHIRNKILESEKSEDPAIQRLNKYVKIWNMFYKKF 580
           K+ HIR KI+ S++S+D   QRL+KYV +WN FY K 
Sbjct: 549 KILHIREKIIASKESDDVTQQRLSKYVSLWNTFYIKM 585

>ZYRO0C14850g Chr3 (1154196..1155980) [1785 bp, 594 aa] {ON} similar
           to uniprot|P32807 Saccharomyces cerevisiae YMR284W YKU70
           Forms heterodimer with Yku80p known as Ku binds
           chromosome ends and is involved in maintaining normal
           telomere length and structure in addition to
           participating in the formation of silent chromatin at
           telomere-proximal genes
          Length = 594

 Score =  624 bits (1609), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/557 (54%), Positives = 416/557 (74%), Gaps = 8/557 (1%)

Query: 22  GYRKFDMHEGILFCVELSETMFKESSELDYKSPLLEILESLNELMSQLVITRPGTAIGCY 81
            YRK+++HEGI+FC+ELS  MF+E SEL+YK  L+EILE+L +LMSQLVI RPGT IGCY
Sbjct: 23  SYRKYEVHEGIIFCIELSAGMFQELSELNYKVQLVEILETLEQLMSQLVIVRPGTGIGCY 82

Query: 82  FYYCYRDDAKEGIYELFPLRDINVRFMKKLNDLLEDLSSERVTLYEYFNFQKTENQKQMP 141
           FY C +DDAK  IYE FPLRDIN + MKKL+DLL+DL+++R+TL ++  + ++E   + P
Sbjct: 83  FYNCNKDDAKNHIYEFFPLRDINAKSMKKLSDLLDDLANDRITLQKFLPYDESE---RTP 139

Query: 142 LASLFTFILDTFLQDSSGQKQLNNKRVFLFTDNDKPQEAQNADDRARLRRLTVDLFDNKI 201
           L  L+ FI D FL++  GQK  NNK+VFLFTDND P EA++ + ++RLR L  D+ D+ I
Sbjct: 140 LDFLYGFIQDEFLKEVEGQKAFNNKKVFLFTDNDSPPEAEDNETKSRLRHLVDDMDDHFI 199

Query: 202 NFTTFFIGYVNNSFDNEFYSDILQLGSHKNKTIGLNSEFDGPNTKPIDAKYIKSRILRKR 261
           NFTTFFIG     FD+ FYSD+L+LG+        N+EFDGPNT PI A YIKSR+LRK+
Sbjct: 200 NFTTFFIGKEEAPFDDSFYSDVLKLGATAEDP---NTEFDGPNTTPISASYIKSRVLRKQ 256

Query: 262 EVKRIMFQCQLIFDEKTDFIIGIKGYTMYSHEKAGVRYKLVYEHEDIRQEAYSKRKFLNF 321
           EVKRIMFQC LI +E+  F++GIKGYT+   E+ G RY+LVYE +++R+EA SKRKFL+ 
Sbjct: 257 EVKRIMFQCCLILEERMQFMVGIKGYTIIIQERPGQRYRLVYEKDEVRKEANSKRKFLDS 316

Query: 322 MSGEDVTDNTVKVYPYGDLDINLSEHQDQIVMEAYTRKDAFLKITGFRSSSISMHYFNNI 381
            +GE + +   KV+PYGDLDI +++ +   V ++YT +++FLKI GFR  +  +HYFNNI
Sbjct: 317 NTGEVIEEGLTKVFPYGDLDITITDEELNEVRKSYTEEESFLKIIGFRDYNKCIHYFNNI 376

Query: 382 EKSSFIVPDEEKYEGSIRALTSLLKILRKKDKIAILWGKLKSNSHPSLFVLSPSNIKEYN 441
           +++ F+VPDE ++EGSIR L SL K LR K K+A++WGKLK+NSHP++FVLSPS  ++ N
Sbjct: 377 DRALFVVPDEFRFEGSIRTLASLFKNLRAKGKVAVVWGKLKTNSHPAVFVLSPSRNEDPN 436

Query: 442 EGFYLYRVPFLDEIRKFPSLLSYDDGSDHEIDYDNMKKVTQSIIGYFNLRDGYNPSDFKN 501
           EGFYLYR+PF +E+R+FP  L   +  D   +Y+ +K  T+SII +F    GY PS+F+N
Sbjct: 437 EGFYLYRIPFAEELRRFPQSLIRHNSYDTP-EYNQLKDTTKSIIDHFQFAKGYRPSEFRN 495

Query: 502 PLLQKHYKVLHDYLLQTETAFEENETSDTKMDRIVHEDDSLRKLYHIRNKILESEKSEDP 561
           P LQKH+K+LHDYLLQ E   EE+++ ++   R++ EDDSL KL  IR+KI++S +S DP
Sbjct: 496 PDLQKHFKILHDYLLQVEQE-EEDDSPESSKQRLLSEDDSLLKLAQIRDKIMDSAQSSDP 554

Query: 562 AIQRLNKYVKIWNMFYK 578
              +L++Y ++WN  Y+
Sbjct: 555 KKFQLDEYFQLWNRLYE 571

>NDAI0K00360 Chr11 (76452..78314) [1863 bp, 620 aa] {ON} Anc_8.849
          Length = 620

 Score =  603 bits (1556), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/579 (53%), Positives = 420/579 (72%), Gaps = 22/579 (3%)

Query: 22  GYRKFDMHEGILFCVELSETMFKESSELDYKSPLLEILESLNELMSQLVITRPGTAIGCY 81
            Y+K+D+HEGI+FC+ELS+ MF+E  EL+Y   LLEILESL ELMS LVI RP T +GCY
Sbjct: 24  SYKKYDIHEGIIFCIELSKEMFQEVPELNYTVQLLEILESLLELMSHLVIIRPSTGVGCY 83

Query: 82  FYYCYRDD-------AK--EGIYELFPLRDINVRFMKKLNDLLEDLSSERVTLYEYFNFQ 132
            +YC + D       AK  +GIYELFPLRD+N   MKKL+DL EDL  ER+TL +YF F 
Sbjct: 84  IHYCNKPDNNATEVNAKHIDGIYELFPLRDVNAHDMKKLSDLFEDLQHERITLMKYFQFD 143

Query: 133 KTEN-QKQMPLASLFTFILDTFLQDSSGQKQLNNKRVFLFTDNDKPQEAQNADDRARLRR 191
             EN +KQ+PL  LF F+LD F   +  +   +++++FLFTDND P E++  + + R+RR
Sbjct: 144 NDENFKKQVPLEKLFGFLLDKFTLANVDRNSYHSRKIFLFTDNDSPIESEEHEAKLRIRR 203

Query: 192 LTVDLFDNKINFTTFFIGYVNNSFDNEFYSDILQLGSHKNKTIGLN---------SEFDG 242
           L  D+ DN INFTTFFIG  +  FD+ FYSD+L+LG+   +T   +         SEFDG
Sbjct: 204 LVDDMNDNYINFTTFFIGTPDRPFDDSFYSDVLKLGAKTRETSDQDYIDAVDDEYSEFDG 263

Query: 243 PNTKPIDAKYIKSRILRKREVKRIMFQCQLIFDEKTDFIIGIKGYTMYSHEKAGVRYKLV 302
           PNTKPI AKYIKSRILRK+E+KRI FQ  LI +E  +FIIGI+GY +YSHEK   RYKLV
Sbjct: 264 PNTKPIPAKYIKSRILRKKEIKRITFQSPLILNEDAEFIIGIRGYMLYSHEKPNTRYKLV 323

Query: 303 YEHEDIRQEAYSKRKFLNFMSGEDV-TDNTVKVYPYGDLDINLSEHQDQIVMEAYTRKDA 361
           YE E++R+EA+S RK+LN  +GE++  D  VK++PYGD++I L++ +   V E  +  +A
Sbjct: 324 YEQENVRKEAFSSRKYLNPNTGEELQNDEYVKIFPYGDMNIELNDKEVYKVEEEISCPEA 383

Query: 362 FLKITGFRSSSISMHYFNNIEKSSFIVPDEEKYEGSIRALTSLLKILRKKDKIAILWGKL 421
           FLKI GFRS +  ++YFNNI  ++F+VPDE +YEGSIR + SL + L+KKDK+AI+WGK+
Sbjct: 384 FLKIIGFRSKNQCLYYFNNITATTFVVPDESQYEGSIRTMASLFRTLKKKDKVAIIWGKM 443

Query: 422 KSNSHPSLFVLSPSNIKEYNEGFYLYRVPFLDEIRKFPSLLSYDDGSDHEIDYDNMKKVT 481
           K+NS P L++L P++  + NEGFYLYR+PFL+EIRKFP LL Y D S +  DY N+ K+T
Sbjct: 444 KTNSKPCLYLLCPTSNSDRNEGFYLYRMPFLEEIRKFPKLLDYKDRSSNP-DYTNLIKIT 502

Query: 482 QSIIGYFNLRDGYNPSDFKNPLLQKHYKVLHDYLLQTETAFEENETSDTKMDRIVHEDDS 541
             I+ YF+LR+GY PS+F+NP LQ+ Y+VLHDYLLQ E +  E +    ++ +++ EDD+
Sbjct: 503 SKIVEYFHLRNGYIPSEFENPSLQRFYRVLHDYLLQVEQSMAEGDEQH-QIQKLLEEDDT 561

Query: 542 LRKLYHIRNKILESEKSEDPAIQRLNKYVKIWNMFYKKF 580
           LRK+  IR+KIL S+KS+DP  QRL+KY+ +WN +Y K 
Sbjct: 562 LRKISQIRDKILSSKKSDDPTQQRLDKYMNLWNTYYVKL 600

>Kwal_27.10199 s27 (238096..239814) [1719 bp, 572 aa] {ON} YMR284W
           (YKU70) - DNA binding protein [contig 39] FULL
          Length = 572

 Score =  580 bits (1495), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/564 (50%), Positives = 398/564 (70%), Gaps = 11/564 (1%)

Query: 23  YRKFDMHEGILFCVELSETMFKESSELDYKSPLLEILESLNELMSQLVITRPGTAIGCYF 82
           Y+KF++HEGI+FC+ELS+ MF++SS+++ K  L+EILE+L ELMSQ++I+ PGT IGCYF
Sbjct: 10  YQKFEVHEGIIFCIELSKGMFEKSSDMN-KVQLVEILETLLELMSQVIISLPGTGIGCYF 68

Query: 83  YYCYRDDAKEGIYELFPLRDINVRFMKKLNDLLEDLSSERVTLYEYFNFQKTENQKQMPL 142
           ++C  ++A  GIYEL PL D+N R MKKLNDLL+D+++   TL + F     + Q   PL
Sbjct: 69  FHCGHENATGGIYELLPLLDVNARSMKKLNDLLDDITAANTTLEKQFPL---DEQLSTPL 125

Query: 143 ASLFTFILDTFLQDSSGQKQLNNKRVFLFTDNDKPQEAQNADDRARLRRLTVDLFDNKIN 202
            ++F  + + FL    GQK  NNK++FLFTDND P+EA ++D R RLR++  DL D  IN
Sbjct: 126 ETVFILLQEQFLNQVPGQKAYNNKKIFLFTDNDSPKEAHDSDTRLRLRKVVDDLDDCHIN 185

Query: 203 FTTFFIGYVNNSFDNEFYSDILQLGSHKNKTIGLNSEFDGPNTKPIDAKYIKSRILRKRE 262
           FTTFFIG     FD  FYSDIL+LG+ K  + G  S F+GP+T PI+A  IK+R LRK+E
Sbjct: 186 FTTFFIGTEQKPFDQSFYSDILKLGAKKTASQG-GSTFNGPSTAPINANLIKARALRKKE 244

Query: 263 VKRIMFQCQLIFDEKTDFIIGIKGYTMYSHEKAGVRYKLVYEHEDIRQEAYSKRKFLNFM 322
           +KRI FQC L  +E TDF + IKGYT+ SHE+ G +YK VY+H  +R+E  S RK+LN  
Sbjct: 245 IKRIRFQCFLELNEATDFKVSIKGYTVVSHERTGTKYKQVYDHNGLRKEVISHRKYLNAN 304

Query: 323 SGEDVTDNTVKVYPYGDLDINLSEHQDQIVMEAYTRKDAFLKITGFRSSSISMHYFNNIE 382
           +GEDVTD+  +V+ + ++DI  SE +   + + Y+  D+FLK+ GFR +S  + +++NI 
Sbjct: 305 TGEDVTDSIARVFRFAEIDIEFSEEELAKISKDYSPNDSFLKLIGFRDTSKCLFFYDNIG 364

Query: 383 KSSFIVPDEEKYEGSIRALTSLLKILRKKDKIAILWGKLKSNSHPSLFVLSPSNIKEYNE 442
            SSF+VPDE   EGSI+ ++SL + L KK K A++WGKLKSNS+P++++LSPS  K+ NE
Sbjct: 365 NSSFVVPDESVLEGSIKTMSSLFRSLSKKQKSAVVWGKLKSNSNPAVYILSPSTSKDLNE 424

Query: 443 GFYLYRVPFLDEIRKFPSLLSYDDGSDHEIDYDNMKKVTQSIIGYFNLRDGYNPSDFKNP 502
           GFYL RVPF+DE+RKFP +  YD+    + +++ M K+T+++I YF+LR  Y PSDFKNP
Sbjct: 425 GFYLTRVPFVDEVRKFPPIPRYDEELGGK-NFEQMCKITETLISYFSLRRPYKPSDFKNP 483

Query: 503 LLQKHYKVLHDYLLQTETAFEENETSDTKMDRIVHEDDSLRKLYHIRNKILESEKSEDPA 562
            LQKH+K+L+DYLLQ E      + S   +D  +  DD+L KLY +R KI ES  S+DP 
Sbjct: 484 TLQKHFKLLYDYLLQVEV-----DCSSESVDGALKHDDTLLKLYQVRRKIQESLSSKDPE 538

Query: 563 IQRLNKYVKIWNMFYKKFNVDDIS 586
            +RL  YVK WN  Y K +  +++
Sbjct: 539 EERLGTYVKAWNSLYNKISNQELT 562

>KAFR0L01950 Chr12 (368933..370699) [1767 bp, 588 aa] {ON} Anc_8.849
           YMR284W
          Length = 588

 Score =  579 bits (1492), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/580 (49%), Positives = 407/580 (70%), Gaps = 11/580 (1%)

Query: 9   GSTDDFNNEMDEPGYRKFDMHEGILFCVELSETMFKESSELDYKSPLLEILESLNELMSQ 68
           G   + N +     Y+KF+ HE ++F VELS+ MF+   EL+ K  L+EILESL ELMSQ
Sbjct: 3   GVDSEVNEDDQNASYKKFESHEAMIFSVELSDGMFETVPELN-KIQLIEILESLEELMSQ 61

Query: 69  LVITRPGTAIGCYFYYCYRDDAKEGIYELFPLRDINVRFMKKLNDLLEDLSSERVTLYEY 128
           L++ RP  AIGCYF+YC ++    GIYE FPL DIN + MKKL+DLLEDL  +R+ L ++
Sbjct: 62  LIVVRPNAAIGCYFHYCGKEGNDYGIYEFFPLSDINAKNMKKLSDLLEDLRLDRINLIDF 121

Query: 129 FNFQKTENQKQMPLASLFTFILDTFLQDSSGQKQLNNKRVFLFTDNDKPQEAQNADDRAR 188
           F +    N K+  +  LFTF L+ F  + +GQ++   +R+FLFTDND P + ++ + ++ 
Sbjct: 122 FQYN---NAKKTSMEKLFTFYLNQFSMEVAGQRKYTFQRIFLFTDNDSPIDKEDKEAKSI 178

Query: 189 LRRLTVDLFDNKINFTTFFIGYVNNSFDNEFYSDILQLGSHKNKTIGLNSEFDGPNTKPI 248
           LR++  DL ++ +NF  FFIG  +  F++  YS+IL+LG+ K+ +    +E+DGPNT PI
Sbjct: 179 LRKIVDDLDESHVNFVPFFIGRPDAPFNSALYSEILKLGARKDSS----TEYDGPNTTPI 234

Query: 249 DAKYIKSRILRKREVKRIMFQCQLIFDEKTDFIIGIKGYTMYSHEKAGVRYKLVYEHEDI 308
            A YIKS++LRKRE+KR+ F+C LI +EK +FI+G++GY   SHEK   RYKLVYE+E++
Sbjct: 235 QASYIKSKVLRKREIKRVAFRCPLILNEKKNFIVGLRGYIFVSHEKVATRYKLVYEYENL 294

Query: 309 RQEAYSKRKFLNFMSGEDVTDNTV-KVYPYGDLDINLSEHQDQIVMEAYTRKDAFLKITG 367
           RQEA+S+RKFL+  + E++    + K++  GDLDI + E +   V +A     +FLK+ G
Sbjct: 295 RQEAFSRRKFLSSETAEEIKGKELTKIFTLGDLDIEVDERRFFEVEKADDDVRSFLKVVG 354

Query: 368 FRSSSISMHYFNNIEKSSFIVPDEEKYEGSIRALTSLLKILRKKDKIAILWGKLKSNSHP 427
           FRS    + Y NNI+K  F+VPDE +Y  SI+ LTSL K LR K K AI+WGKLK+NS+P
Sbjct: 355 FRSIKSCVKYINNIDKVMFVVPDEMQYVNSIKILTSLFKTLRTKGKAAIIWGKLKANSNP 414

Query: 428 SLFVLSPSNIKEYNEGFYLYRVPFLDEIRKFPSLLSYDDGSDHEIDYDNMKKVTQSIIGY 487
           SLFVL PS  K+ NEGFYL+RVPFLDEIRK P++++Y+ G +   DY+N+ KVT+ I+ Y
Sbjct: 415 SLFVLEPSGEKDPNEGFYLHRVPFLDEIRKLPTMITYECGENTS-DYENLIKVTEYIMAY 473

Query: 488 FNLRDGYNPSDFKNPLLQKHYKVLHDYLLQTETAFEENETSDTKMDRIVHEDDSLRKLYH 547
           FNL+ GYNP D KNP +QK++K+LHDYLLQ E     +E+S  +  R++ EDD+LRK+ H
Sbjct: 474 FNLKGGYNPMDLKNPCIQKYFKILHDYLLQIEDK-TSDESSTERKQRLLREDDTLRKVSH 532

Query: 548 IRNKILESEKSEDPAIQRLNKYVKIWNMFYKKFNVDDISV 587
           IR KI+ S +SED   Q+L+KY+K+WN FY K   + +S+
Sbjct: 533 IREKIISSSRSEDAGAQKLSKYIKVWNNFYAKIEKESVSL 572

>TPHA0I00310 Chr9 (59576..61402) [1827 bp, 608 aa] {ON} Anc_8.849
           YMR284W
          Length = 608

 Score =  573 bits (1477), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/578 (51%), Positives = 409/578 (70%), Gaps = 15/578 (2%)

Query: 18  MDEP--GYRKFDMHEGILFCVELSETMFKESSELDYKSPLLEILESLNELMSQLVITRPG 75
           +D P   YRK++ HEG +FC+ELSE MF E S+L+YK  L+E+LESL ELMSQLVITRP 
Sbjct: 28  IDNPKASYRKYESHEGYMFCIELSEHMFSEISQLNYKVQLIEVLESLMELMSQLVITRPS 87

Query: 76  TAIGCYFYYCYRDDAKEGIYELFPLRDINVRFMKKLNDLLEDLSSERVTLYEYFNFQKTE 135
           T +GC+F+ C   ++K+ IYE  PLRDINV  MKKL+DLL+D+  ER+++ + F F +  
Sbjct: 88  TGVGCFFFNCDNKESKKRIYEFLPLRDINVSDMKKLHDLLDDVKEERLSIRDAFKFDEI- 146

Query: 136 NQKQMPLASLFTFILDTFLQDSSGQKQLNNKRVFLFTDNDKPQEAQNADDRARLRRLTVD 195
           N K   L SLF  I D F  +  GQK   NK+VFLFTDNDKP+E+ + +   RLRRL  D
Sbjct: 147 NDKGNSLESLFLLIQDRFSNNIPGQKIYTNKKVFLFTDNDKPKESNDKEKTIRLRRLFDD 206

Query: 196 LFDNKINFTTFFIGYVNNS--FDNEFYSDILQLGSHKNKTIGLNSEFDGPNTKPIDAKYI 253
           + DN I F TFFI  +++S  FD+ FYSDIL+L +        + EFDGP+TKPI   YI
Sbjct: 207 ISDNYIQFVTFFINKIDSSDNFDDSFYSDILKLRNSN------SIEFDGPSTKPISVAYI 260

Query: 254 KSRILRKREVKRIMFQCQLIFDEKTDFIIGIKGYTMYSHEKAGVRYKLVYEHEDIRQEAY 313
           K+++LRK+E+KRIMFQC LI +  +DF + +KGYT+ SHEK G RYKLVYEHE+IR+EA+
Sbjct: 261 KNKVLRKKEIKRIMFQCPLILNADSDFQVNVKGYTIISHEKPGSRYKLVYEHENIRREAF 320

Query: 314 SKRKFLNFMSGEDVT-DNTVKVYPYGDLDINLSEHQDQIVMEAYTRKDAFLKITGFRSSS 372
           SKRK LN  +G  VT D+T K++  G+  IN  E++ +   +    ++ FLK+ GFRS  
Sbjct: 321 SKRKLLNGKTGTVVTKDDTEKIFQLGNFSINSFENEFEKGNDNPLPQEPFLKLIGFRSPE 380

Query: 373 ISMHYFNNIEKSSFIVPDEEKYEGSIRALTSLLKILRKKDKIAILWGKLKSNSHPSLFVL 432
            S+H FNNI K+ FIVPDE +  GSIR L+S+ + +R K++ AI+WGKLKSNS+P++++L
Sbjct: 381 NSLHLFNNIGKALFIVPDESRCVGSIRTLSSMYRTMRTKNRNAIVWGKLKSNSNPNIWIL 440

Query: 433 SPSN-IKEYNEGFYLYRVPFLDEIRKFPSLLSY--DDGSDHEIDYDNMKKVTQSIIGYFN 489
           SPS+  K+ NEGFYLY+VPFLDEIRK PS  ++   D      DY+N+K+VT++I+GYFN
Sbjct: 441 SPSDPTKDQNEGFYLYKVPFLDEIRKIPSQYTHFPSDELIRNKDYENLKRVTRNILGYFN 500

Query: 490 LRDGYNPSDFKNPLLQKHYKVLHDYLLQTETAFEENETSDTKMDRIVHEDDSLRKLYHIR 549
           L +GY+P +FKNPLLQK+YK+LHDYLLQ ET  E   + +    +I+ EDD++RK + IR
Sbjct: 501 LTNGYSPLEFKNPLLQKYYKLLHDYLLQVETVPETEMSKEQLKQKILEEDDTIRKTFSIR 560

Query: 550 NKILESEKSEDPAIQRLNKYVKIWNMFYKKFNVDDISV 587
           +KI++S  S +   QRL+    IWN  Y K   ++I+V
Sbjct: 561 DKIIKSASSTESHKQRLSANFNIWNDIYSKLEGNEIAV 598

>SAKL0D01188g Chr4 complement(87783..89528) [1746 bp, 581 aa] {ON}
           similar to uniprot|P32807 Saccharomyces cerevisiae
           YMR284W YKU70 Forms heterodimer with Yku80p known as Ku
           binds chromosome ends and is involved in maintaining
           normal telomere length and structure in addition to
           participating in the formation of silent chromatin at
           telomere-proximal genes
          Length = 581

 Score =  556 bits (1432), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/561 (49%), Positives = 394/561 (70%), Gaps = 11/561 (1%)

Query: 19  DEPGYRKFDMHEGILFCVELSETMFKESSELDYKSPLLEILESLNELMSQLVITRPGTAI 78
           D+  Y+K+++H GI+FC+EL+ TM+++ +EL++K  L+EILESL ELMSQL++T P T +
Sbjct: 15  DQTVYKKYEVHGGIVFCIELTSTMYRKVTELNHKIQLVEILESLAELMSQLIVTSPNTGV 74

Query: 79  GCYFYYCYRDDAKEGIYELFPLRDINVRFMKKLNDLLEDLSSERVTLYEYFNFQKTENQK 138
           GCYF+ C +D+++ GIYE  PL+D+N + MKKLNDLLEDL  +R TL E F F  + +  
Sbjct: 75  GCYFFQCNKDNSEHGIYEFLPLKDVNAKNMKKLNDLLEDLQFKRATLEEKFPFVPSLD-- 132

Query: 139 QMPLASLFTFILDTFLQDSSGQKQLNNKRVFLFTDNDKPQEAQNADDRARLRRLTVDLFD 198
            + L S+  F+ + F+++   +K  NN +VFLFTDN KP   +N + R+ LR++  DL D
Sbjct: 133 -VSLESVLVFLREQFIKELPNRKAYNNGKVFLFTDNGKPNGYENLESRSGLRKIVNDLND 191

Query: 199 NKINFTTFFIGYVNNSFDNEFYSDILQLGSHKNKTIGLNSEFDGPNTKPIDAKYIKSRIL 258
             INFT FFI      FD  FYSDIL+L +  +   G +  FDGPNT PI A YIKSR+ 
Sbjct: 192 CYINFTPFFIDTEEKPFDQSFYSDILKLRAKTDYVDG-SEMFDGPNTTPIPASYIKSRVS 250

Query: 259 RKREVKRIMFQCQLIFDEKTDFIIGIKGYTMYSHEKAGVRYKLVYEHEDIRQEAYSKRKF 318
           RK+E +R+ FQC LI D++ +F I IKGYT+ SHEK G RYKLVYE+E +R+EA+S R++
Sbjct: 251 RKKETRRVKFQCPLILDDRNNFTISIKGYTIISHEKPGTRYKLVYENEQLRKEAFSHRRY 310

Query: 319 LNFMSGEDVTDNTVKVYPYGDLDINLSEHQDQIVMEAYTRKDAFLKITGFRSSSISMHYF 378
           L+  +G DV+D   K++PYGD +I LS+     + +     ++FLKI GFRS+   + Y+
Sbjct: 311 LDASTGVDVSDKVAKIFPYGDENIELSQEDMAKLDKLDPNYNSFLKIIGFRSTDQCLFYY 370

Query: 379 NNIEKSSFIVPDEEKYEGSIRALTSLLKILRKKDKIAILWGKLKSNSHPSLFVLSPSNIK 438
           NN++K++F+VPDE  YEGSIRA+ SL + LR K K A++WGKLK NS+P +++++PS   
Sbjct: 371 NNVDKTAFVVPDEYTYEGSIRAMASLYRNLRTKGKSAVVWGKLKINSNPGIYLMTPSTEN 430

Query: 439 EYNEGFYLYRVPFLDEIRKFPSLLSYDDGSDHEIDYDNMKKVTQSIIGYFNLRDGYNPSD 498
           + NEGFYL R+PF+DEIR+FPS+  Y D    + DY +M + T++II YFNLR+GY PS+
Sbjct: 431 DPNEGFYLTRIPFIDEIRRFPSVPQYGDVLSSQ-DYGHMCQATETIIAYFNLRNGYKPSE 489

Query: 499 FKNPLLQKHYKVLHDYLLQTETAFEENETSDTKMDRIVHEDDSLRKLYHIRNKILESEKS 558
           FKNP LQ ++ +LHD LL+     +E  ++D + + +  +DD+L KL  IR+KI+ES KS
Sbjct: 490 FKNPGLQHYFSLLHDQLLEA----KEESSADEEQESL--KDDTLLKLSQIRDKIIESSKS 543

Query: 559 EDPAIQRLNKYVKIWNMFYKK 579
           ++P  QRL+KY K WN  Y K
Sbjct: 544 DEPGRQRLSKYFKGWNTLYNK 564

>KLTH0C03586g Chr3 (311969..313705) [1737 bp, 578 aa] {ON} similar
           to uniprot|P32807 Saccharomyces cerevisiae YMR284W YKU70
           Forms heterodimer with Yku80p known as Ku binds
           chromosome ends and is involved in maintaining normal
           telomere length and structure in addition to
           participating in the formation of silent chromatin at
           telomere-proximal genes
          Length = 578

 Score =  551 bits (1420), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/560 (50%), Positives = 395/560 (70%), Gaps = 11/560 (1%)

Query: 20  EPGYRKFDMHEGILFCVELSETMFKESSELDYKSPLLEILESLNELMSQLVITRPGTAIG 79
           E  Y+KF++HEGI+FCVELSE MFKE  +L+ K  LLEILE+L ELM+Q++I  PGT IG
Sbjct: 13  ESKYKKFEVHEGIIFCVELSEAMFKEPFDLN-KVQLLEILETLLELMTQVIIILPGTGIG 71

Query: 80  CYFYYCYRDDAKEGIYELFPLRDINVRFMKKLNDLLEDLSSERVTLYEYFNFQKTENQKQ 139
           C+F+ C  + AK GIYE  PL D+N R MKKLNDLL+DL     TL E F F   +N   
Sbjct: 72  CFFFQCSHEGAKGGIYEFLPLLDVNARSMKKLNDLLDDLKMNITTLNEQFPFNDKQN--- 128

Query: 140 MPLASLFTFILDTFLQDSSGQKQLNNKRVFLFTDNDKPQEAQNADDRARLRRLTVDLFDN 199
             L ++F  + + F +   GQK  NNK++FLFTDND+P+E+ + + + RLR++  DL D+
Sbjct: 129 TSLEAVFVLLQEQFSRSVQGQKAYNNKKIFLFTDNDRPKESDDREAKNRLRKVIDDLDDS 188

Query: 200 KINFTTFFIGYVNNSFDNEFYSDILQLGSHKNKTIGLNSEFDGPNTKPIDAKYIKSRILR 259
            IN   FF+G     FD  FYSDIL+LG+ K  + G   +++GPNT PI AK IKSR+LR
Sbjct: 189 FINIIPFFVGSEQRPFDQSFYSDILKLGAKKKASDG-PFKYEGPNTTPISAKLIKSRVLR 247

Query: 260 KREVKRIMFQCQLIFDEKTDFIIGIKGYTMYSHEKAGVRYKLVYEHEDIRQEAYSKRKFL 319
           K+E+KR+ FQC LI +E +DF + IKGYT  SHE+AG +YK VY+H+ +R+EA S RK+L
Sbjct: 248 KKEIKRVRFQCSLILNEASDFQVSIKGYTTISHERAGSKYKQVYDHDGLRKEALSHRKYL 307

Query: 320 NFMSGEDVTDNTVKVYPYGDLDINLSEHQDQIVMEAYTRKDAFLKITGFRSSSISMHYFN 379
           +  +GEDVT+  VKV+ + ++DI LSE +   +   Y+  D+FLK+ GFR ++  + YFN
Sbjct: 308 DANTGEDVTERVVKVFKFAEVDIELSEDEIAKMNRDYSSYDSFLKLVGFRDTNRCVFYFN 367

Query: 380 NIEKSSFIVPDEEKYEGSIRALTSLLKILRKKDKIAILWGKLKSNSHPSLFVLSPSNIKE 439
           NI  SSF+VPD+  ++GSI+ + SL + LR+K K A++WGKLKSNS+PSL+ L+PSN  +
Sbjct: 368 NISNSSFVVPDDSVFKGSIKTMASLFRKLREKQKSAVVWGKLKSNSNPSLYTLTPSNFND 427

Query: 440 YNEGFYLYRVPFLDEIRKFPSLLSYDDGSDHEIDYDNMKKVTQSIIGYFNLRDGYNPSDF 499
           +NEGFYL RVPF+DEIRKFP    + + S  +  ++ M K+T+++I YF+LR  Y PSDF
Sbjct: 428 HNEGFYLTRVPFIDEIRKFPPTAYHGNLSKTKT-FEQMCKITETLISYFSLRHSYRPSDF 486

Query: 500 KNPLLQKHYKVLHDYLLQTETAFEENETSDTKMDRIVHEDDSLRKLYHIRNKILESEKSE 559
           +NP LQKH+++LHDYLLQ E     + TS +K + ++ +DD+L KL+ +R KILES +S+
Sbjct: 487 ENPTLQKHFELLHDYLLQVEV----DPTSGSK-EHLLKKDDTLLKLHQVRAKILESAESD 541

Query: 560 DPAIQRLNKYVKIWNMFYKK 579
           DP   RL+ YVK WN  Y +
Sbjct: 542 DPVQARLSNYVKAWNSMYNR 561

>Kpol_1068.1 s1068 complement(1..1542) [1542 bp, 514 aa] {ON}
           complement(1..1542) [1542 nt, 514 aa]
          Length = 514

 Score =  538 bits (1386), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/479 (56%), Positives = 355/479 (74%), Gaps = 5/479 (1%)

Query: 21  PGYRKFDMHEGILFCVELSETMFKESSELDYKSPLLEILESLNELMSQLVITRPGTAIGC 80
           P YRK+D+HEGI+FCVELSE MF++  EL+YK  LLEILESL ELMSQLVITRPGT +GC
Sbjct: 39  PSYRKYDVHEGIMFCVELSEQMFQQLPELNYKVQLLEILESLLELMSQLVITRPGTGVGC 98

Query: 81  YFYYCYRDDAKEGIYELFPLRDINVRFMKKLNDLLEDLSSERVTLYEYFNFQKTENQKQM 140
           Y Y C++D++   I+   PL D+NV+ MKK+NDLL+DLS+ER TL +YF + KT+   + 
Sbjct: 99  YIYNCHKDNSNNNIFNFIPLEDVNVKAMKKVNDLLDDLSNERTTLTKYFPYDKTQ---RT 155

Query: 141 PLASLFTFILDTFLQDSSGQKQLNNKRVFLFTDNDKPQEAQNADDRARLRRLTVDLFDNK 200
           PL SL     D  +++ S  K  NNK+VFLFTDND P EA +   +ARLRRL  D  +N 
Sbjct: 156 PLESLLELTQDELVKNVSTPKPFNNKKVFLFTDNDSPTEASDKAGKARLRRLFDDNNENF 215

Query: 201 INFTTFFIGYVNNSFDNEFYSDILQLGSHKNKTIGLNSEFDGPNTKPIDAKYIKSRILRK 260
           I F  FFI   N  FD+ FYSDI +LG+ +N +     EFDGP+T+PI A YIKSR+LRK
Sbjct: 216 ITFVPFFINRENKPFDSSFYSDIFKLGNSENPSSDYEIEFDGPSTRPISASYIKSRVLRK 275

Query: 261 REVKRIMFQCQLIFDEKTDFIIGIKGYTMYSHEKAGVRYKLVYEHEDIRQEAYSKRKFLN 320
           +E+KR++FQC LI +++ +F + IKGY++ S EK G RYK+VYEHED+R+EA+SKRK LN
Sbjct: 276 QEIKRVLFQCSLILNKEMNFTVAIKGYSIVSQEKVGSRYKMVYEHEDVRKEAFSKRKILN 335

Query: 321 FMSGEDVTDNTVKVYPYGDLDINLSEHQDQIVMEAYTRKDAFLKITGFRSSSISMHYFNN 380
            ++ E+V +   KV+PYGDL+I LSE   + V EAY     FLK+ GFRS  IS+HY+NN
Sbjct: 336 CITAEEVKEGLTKVFPYGDLNIELSEEDIKKVKEAYLEDGPFLKLLGFRSLEISLHYYNN 395

Query: 381 IEKSSFIVPDEEKYEGSIRALTSLLKILRKKDKIAILWGKLKSNSHPSLFVLSPSNIKEY 440
           I K SF+VPDE K +GSIR L SL + +RKK+K+A+LWGKLK NSHP L+VLS SN  + 
Sbjct: 396 ITKPSFVVPDESKIDGSIRMLASLFRTMRKKNKVAVLWGKLKGNSHPGLWVLSASNASDP 455

Query: 441 NEGFYLYRVPFLDEIRKFPSLL--SYDDGSDHEIDYDNMKKVTQSIIGYFNLRDGYNPS 497
           NEGF+LYR+PFLDEIRKFP +   S+ + + + I+Y+N+K+ T++I+GYFNL+ GY PS
Sbjct: 456 NEGFFLYRIPFLDEIRKFPVITTSSFKENAMNTIEYENIKRTTENIVGYFNLKHGYIPS 514

>KNAG0M02650 Chr13 complement(490275..491999) [1725 bp, 574 aa] {ON}
           
          Length = 574

 Score =  532 bits (1370), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/567 (46%), Positives = 389/567 (68%), Gaps = 18/567 (3%)

Query: 20  EPGYRKFDMHEGILFCVELSETMFKESSELDYKSPLLEILESLNELMSQLVITRPGTAIG 79
           E GY+K+D HEGILFC+EL+ T+F+    L  +S LLEIL SL ELM QLVI RPG+++G
Sbjct: 13  EYGYKKYDTHEGILFCIELTGTLFEPVESLQGRSNLLEILYSLKELMYQLVIVRPGSSVG 72

Query: 80  CYFYYCYRDDAKEGIYELFPLRDINVRFMKKLNDLLEDLSSERVTLYEYFNFQKTENQKQ 139
           C F+Y   + A +G+YE  PLRD+N + MK L+D LED+  +R+ +++YF F   +  K 
Sbjct: 73  CIFHYTDINGAVDGVYEFLPLRDVNAKDMKTLSDFLEDIEEKRINIFQYFKF---DGSKH 129

Query: 140 MPLASLFTFILDTFLQDSSGQKQLNNKRVFLFTDNDKPQEAQNADDRARLRRLTVDLFDN 199
           + L  LF  I + + ++    K+  +KR FLFTDND P E+ + +   R+ ++  DL + 
Sbjct: 130 VSLERLFQLIGEKYSEEREDGKKFTHKRAFLFTDNDAPPESNDTEATRRISKIVDDLDET 189

Query: 200 KINFTTFFIGYVNNSFDNEFYSDILQLGSHKNKTIGLNSEFDGPNTKPIDAKYIKSRILR 259
            ++FTTFFIG     FDN FYS++L+LG+        +S++DGP+ +PI    IK+RILR
Sbjct: 190 AVSFTTFFIGSEEAPFDNRFYSNVLKLGAQLK-----HSDYDGPSVRPITGSDIKARILR 244

Query: 260 KREVKRIMFQCQLIFDEKTDFIIGIKGYTMYSHEKAGVRYKLVYEHEDIRQEAYSKRKFL 319
            +E+KR MFQC L  ++ ++FIIGI+GY + +HEK G RYKL YE EDIRQEA+SKRK+L
Sbjct: 245 GKEIKRTMFQCPLYLNKDSNFIIGIRGYAIVTHEKYGTRYKLTYEKEDIRQEAFSKRKYL 304

Query: 320 NFMSGEDVTDNTV-KVYPYGDLDINLSEHQDQIVMEAYTRKDAFLKITGFRSSSISMHYF 378
           N  +GE+V    + KV PYGD++I LS    Q +  +Y  +  F+K+ GFRS+ + + YF
Sbjct: 305 NSKTGEEVDPKDISKVIPYGDVNIELSAEALQQMRASYEEEGPFMKVLGFRSTDLCVKYF 364

Query: 379 NNIEKSSFIVPDEEKYEGSIRALTSLLKILRKKDKIAILWGKLKSNSHPSLFVLSPSNIK 438
           NNI+K SFIVPDE +YEGSI+ L SL + LR K+K AI+WGK KSNS+ +L+++ PS+ +
Sbjct: 365 NNIDKPSFIVPDELQYEGSIKTLASLFRTLRSKNKSAIIWGKPKSNSNSALYIMVPSHRE 424

Query: 439 EYNEGFYLYRVPFLDEIRKFPSLLSYDDGSDHEIDYDNMKKVTQSIIGYFNLRDGYNPSD 498
           + N+GFY++R+PFLDE+RK P  +  +D +  ++D D +  VT++I+ YFNLR GY PS+
Sbjct: 425 DRNDGFYMHRIPFLDELRKVPIKMVDNDWT--QLDND-LLTVTETILKYFNLRQGYIPSE 481

Query: 499 FKNPLLQKHYKVLHDYLLQTETAFEENETSDTKMDRIVHEDDSLRKLYHIRNKILESEKS 558
           FKNP +Q +YKVLHDY+LQ E    ++E  D   + ++ +DD+L+K+ HIR KI  S  S
Sbjct: 482 FKNPGIQNYYKVLHDYILQVEEI--KHEGWDFSQEELLRQDDTLKKISHIRGKIEASNDS 539

Query: 559 EDPAIQRLNKYVKIWNMFYKKFNVDDI 585
           +    + L+ Y+ +WN+FYK    +++
Sbjct: 540 D----KVLSGYMNMWNLFYKSLETNNV 562

>TBLA0B02890 Chr2 (666770..668716) [1947 bp, 648 aa] {ON} Anc_8.849
           YMR284W
          Length = 648

 Score =  534 bits (1375), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/623 (46%), Positives = 404/623 (64%), Gaps = 49/623 (7%)

Query: 5   NNAFGSTDDFNNEMDEPGYRKFDMHEGILFCVELSETMFKESSELDYKSPLLEILESLNE 64
           NN+    DD N+      Y+KF +HEGI+FCVELS  MF+   EL  KS LLEILESL++
Sbjct: 6   NNSNHLMDD-NDASRNASYKKFHIHEGIIFCVELSSEMFENLPELKGKSQLLEILESLSD 64

Query: 65  LMSQLVITRPGTAIGCYFYYCYRDDAKE---GIYELFPLRDINVRFMKKLNDLLEDLSSE 121
           L  QL+I+RP TAIG Y ++   D  ++   GIYE F L DINV+ MKK+ DLLEDLS +
Sbjct: 65  LFEQLIISRPNTAIGFYLFHHTSDSVEKNKFGIYEFFQLSDINVKTMKKVTDLLEDLSHD 124

Query: 122 RVTLYEYFNFQKTENQKQMPLASLFTFILDTFLQDSS--GQKQLNNKRVFLFTDNDKPQE 179
           R  L + F F   +N +   L  +F  + + FL   S    K  N K+VFLFT+NDKP E
Sbjct: 125 RKKLEDIFKF---DNSRPTKLEDIFNVVQEQFLNFDSLHHSKGFNIKKVFLFTNNDKPIE 181

Query: 180 AQNADDRARLRRLTVDLFDNKINFTTFFIGYVNNSFDNEFYSDILQL------------- 226
           ++N + R +LRR+  DL +++I F+TFFI   ++ FD+ FYSDIL+L             
Sbjct: 182 SENNETRKKLRRMVNDLNESEIFFSTFFINKPDSQFDDTFYSDILKLPINDDTSEIDVED 241

Query: 227 --------GSH-----------KNKTIGLN-----SEFDGPNTKPIDAKYIKSRILRKRE 262
                   G+H           K+KT           F  PNTKPI+A  IK RILRK+E
Sbjct: 242 YYDDAGENGNHYLLINDLKDTSKSKTTDRKINPSLRRFCRPNTKPIEASNIKQRILRKQE 301

Query: 263 VKRIMFQCQLIFDEKTDFIIGIKGYTMYSHEKAGVRYKLVYEHEDIRQEAYSKRKFLNFM 322
           ++R+ FQC LI DE ++FIIGI GY ++S EK G RYKLVYEHE++R+EA+S+RKFL+  
Sbjct: 302 IRRVRFQCPLILDEASNFIIGITGYNIFSIEKPGTRYKLVYEHENVRKEAFSRRKFLDPN 361

Query: 323 SGEDVTDNTV-KVYPYGDLDINLSEHQDQIVMEAYTRKDAFLKITGFRSSSISMHYFNNI 381
           +GE++ D    KVY YGD++I LS+   Q +   Y     F+K+ GFRS  IS+ Y+NNI
Sbjct: 362 TGEELKDEDFQKVYKYGDINIELSDEATQNIKNEYMENRPFMKLLGFRSKDISLKYYNNI 421

Query: 382 EKSSFIVPDEEKYEGSIRALTSLLKILRKKDKIAILWGKLKSNSHPSLFVLSPSNIKEYN 441
           +K+SF+VPDE  YEGSI+ + SL + L KK K+AI+WG   S  HP++ +LSPSN  E+N
Sbjct: 422 DKASFVVPDESSYEGSIKTMASLFRTLHKKKKVAIVWGVSSSGGHPTIHILSPSNENEHN 481

Query: 442 EGFYLYRVPFLDEIRKFPSLLSYDDGSDHEI-DYDNMKKVTQSIIGYFNLRDGYNPSDFK 500
           EG YL++VPFLDEIR+FP+L SY  G++  I +Y+ MKK+T+ I+G  +LR GY PS ++
Sbjct: 482 EGLYLFQVPFLDEIRRFPALTSYSPGTNKNISEYEKMKKLTEYILGTLDLRKGYRPSSYR 541

Query: 501 NPLLQKHYKVLHDYLLQTETAFEENETSDTKMDRIVHEDDSLRKLYHIRNKILESEKSED 560
           NP LQK+YK+LHDYLLQ E      +T    ++R V+EDD+L +L  +R +I++S ++ +
Sbjct: 542 NPALQKYYKILHDYLLQIEDT-SLTDTPQEVLEREVYEDDTLYRLDKLRKRIIQSSQAPE 600

Query: 561 PAIQRLNKYVKIWNMFYKKFNVD 583
              QRL+K+++ WN  +KK N D
Sbjct: 601 LYNQRLSKFIEHWNRVFKKINED 623

>CAGL0I02662g Chr9 (237396..239216) [1821 bp, 606 aa] {ON} similar
           to uniprot|P32807 Saccharomyces cerevisiae YMR284w HDF1
           high-affinity DNA-binding protein
          Length = 606

 Score =  532 bits (1371), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/567 (46%), Positives = 391/567 (68%), Gaps = 10/567 (1%)

Query: 20  EPGYRKFDMHEGILFCVELSETMFKESSELDYKSPLLEILESLNELMSQLVITRPGTAIG 79
           +  +++F++HEGI+FC+ELSE MF+   ELD KS +  IL SL+ELM  L++TRP TAIG
Sbjct: 28  QASFKRFEIHEGIMFCIELSEHMFEVQDELDGKSQIEVILTSLSELMELLIVTRPSTAIG 87

Query: 80  CYFYYCYRDDAKEGIYELFPLRDINVRFMKKLNDLLEDLSSERVTLYEYFNFQKTENQK- 138
           CYFY C R+D+KE I+E  PL D+NV++MKK+NDLLED+S++R+T  EY N+   +N+K 
Sbjct: 88  CYFYNCEREDSKESIFEFIPLVDLNVQWMKKVNDLLEDVSNQRITFKEYLNYNIDQNKKL 147

Query: 139 QMP--LASLFTFILDTFLQDSSGQKQLNNKRVFLFTDNDKPQEAQNADDRARLRRLTVDL 196
            +P  L  LF+ IL+TF ++  GQK+ N+K+VFLFTDND P           L+ +  D+
Sbjct: 148 NIPILLEKLFSLILETFNRNIEGQKEFNSKKVFLFTDNDLPNVESQQRSIDVLKGILKDI 207

Query: 197 FDNKINFTTFFIGYVNNSFDNEFYSDILQLGSHKNKTIGLNSEFDGPNTKPIDAKYIKSR 256
            DN INFT FFI   +  F+  FYS +L+     N ++G  + F GP+TKPI    IK R
Sbjct: 208 DDNMINFTNFFISKKDKPFNPAFYSKVLRNDRDYN-SLGSQAYF-GPSTKPIGVNDIKER 265

Query: 257 ILRKREVKRIMFQCQLIFDEKTDFIIGIKGYTMYSHEKAGVRYKLVYEHEDIRQEAYSKR 316
           I +++E++R++FQC L+ DE T+F+I IKGY++++HEK  VRYKLVYE+++IR+EA+SKR
Sbjct: 266 IFQRKEIRRVVFQCPLVLDEGTNFVISIKGYSIFNHEKGSVRYKLVYENQEIRKEAFSKR 325

Query: 317 KFLNFMSGEDVTDNTVKVYPYGDLDINLSEHQDQIVMEAYTRKDAFLKITGFRSSSISMH 376
           KF+N  +GEDV+  TVK+ PYG+ +I + +      +  Y    A L + GF +   S+ 
Sbjct: 326 KFINPKTGEDVSKQTVKIIPYGEKEIEMEDKNIANALNVYGNTSASLTVIGFLNEDNSLV 385

Query: 377 YFNNIEKSSFIVPDEEKYEGSIRALTSLLKILRKKDKIAILWGKLKSNSHPSLFVLSPSN 436
           ++NNI+K+ FI PDE   EGS  A  SL + L+K  K+ ++WG  KSNS PSL++L PS 
Sbjct: 386 FYNNIDKTLFITPDENVIEGSFTAFASLFRTLKKLKKVGVVWGSTKSNSSPSLYLLWPSK 445

Query: 437 IKEYNEGFYLYRVPFLDEIRKFPSLLSYDDGSDHEIDYDNMKKVTQSIIGYFNLRDGYNP 496
             + N+GFYL +VPF+DEIRK+P+L + +   + E +Y N+K++TQ II +FNL+ GY+ 
Sbjct: 446 DDDNNQGFYLTKVPFIDEIRKYPTLSNININEEWE-EYKNVKELTQGIISHFNLKSGYHA 504

Query: 497 SDFKNPLLQKHYKVLHDYLLQTETAFEENETSDTKMDRIVHEDDSLRKLYHIRNKILESE 556
            +F+NP L +HYK+LHDYLLQ E   ++N+      DR + EDD+L K+  IR +I++  
Sbjct: 505 EEFRNPALNRHYKLLHDYLLQVEIPQDDNDIR----DRYLREDDTLLKITKIRERIMKDT 560

Query: 557 KSEDPAIQRLNKYVKIWNMFYKKFNVD 583
             +D   +RL+KY+++WN++Y+KF  D
Sbjct: 561 TIDDVEKRRLSKYLEVWNIYYRKFKED 587

>KLLA0C06226g Chr3 (550683..552461) [1779 bp, 592 aa] {ON} similar
           to uniprot|P32807 Saccharomyces cerevisiae YMR284W YKU70
           Forms heterodimer with Yku80p known as Ku binds
           chromosome ends and is involved in maintaining normal
           telomere length and structure in addition to
           participating in the formation of silent chromatin at
           telomere-proximal genes
          Length = 592

 Score =  526 bits (1354), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/579 (44%), Positives = 388/579 (67%), Gaps = 14/579 (2%)

Query: 4   INNAFGSTDDFNNEMDEPGYRKFDMHEGILFCVELSETMFKESSELDYKSPLLEILESLN 63
           + +    T D + E D   +R+++ H+GI+FC++L+ TM+  + +L  K  LLEIL+SLN
Sbjct: 9   LKSQLTQTRDDDKESDHKKWRRYEAHDGIVFCIQLTPTMYLSNPDLGGKIQLLEILDSLN 68

Query: 64  ELMSQLVITRPGTAIGCYFYYCYRDDAKEGIYELFPLRDINVRFMKKLNDLLEDLSSERV 123
           +LMSQLV+  P TA+GCY Y C   +A++ +YEL PLRD+N + MK+++DLLED+  +R+
Sbjct: 69  DLMSQLVVVMPSTAVGCYIYNCSHPNAEDNVYELIPLRDVNYKNMKRVSDLLEDIEQDRI 128

Query: 124 TLYEYFNFQKTENQKQMPLASLFTFILDTFLQDSSGQKQLNNKRVFLFTDNDKPQEAQNA 183
            L +        N   + L+ +   + +TFLQ   GQKQL NK++F FTD+DKP E  N 
Sbjct: 129 LLKDEIPIADPNNP--IELSPVLIKVRETFLQPIEGQKQLTNKKIFFFTDDDKPAEFLNV 186

Query: 184 DDRARLRRLTVDLFDNKINFTTFFIGYVNNSFDNEFYSDILQLGSHKNKTIGLNSEFDGP 243
           D R+RLR++  DL+D  INF TFFIG  +  FD+  Y+DIL+ GS  N+     S   GP
Sbjct: 187 DSRSRLRKVVDDLYDYYINFVTFFIGSEDKPFDDSMYADILKWGSKINEAQSWLSSH-GP 245

Query: 244 NTKPIDAKYIKSRILRKREVKRIMFQCQLIFDEKTDFIIGIKGYTMYSHEKAGVRYKLVY 303
           +T PI+A YIKS++ R +E+KRI F+C L+ DE+ D ++ + GYT+ SHE  G +YKLVY
Sbjct: 246 STNPINASYIKSKVKRTKEIKRIKFRCPLMLDERADLVVSVNGYTIVSHEIPGSKYKLVY 305

Query: 304 EHEDIRQEAYSKRKFLNFMSGEDVTDNTV-KVYPYGDLDINLSEHQDQIVMEAYTRKDAF 362
            +  +R+EAYS R++L+  +GE V ++ + KVY +GD  I L+E ++  +   Y+  ++F
Sbjct: 306 ANGSVRREAYSHREYLDAETGEAVDNSQLSKVYTFGDEIIELTEDENLKIQSGYSEHESF 365

Query: 363 LKITGFRSSSISMHYFNNIEKSSFIVPDEEKYEGSIRALTSLLKILRKKDKIAILWGKLK 422
           LK+ GFRS+   +HY++NI+  +F+VP+EE Y GSI+ L SL + +  K K A++WGKL+
Sbjct: 366 LKLIGFRSTEQCLHYYDNIDVPAFVVPNEEDYAGSIKTLASLYRTMLFKKKSAMVWGKLR 425

Query: 423 SNSHPSLFVLSPSNIKEYNEGFYLYRVPFLDEIRKFPSLLSYDDGSDHEIDYDNMKKVTQ 482
            NS PS+FVL+PS+ K+YN+GFYLY+VPF++E+RK P  L++    + + DY  M KVT+
Sbjct: 426 PNSPPSMFVLTPSSKKDYNQGFYLYKVPFMEEVRKLPDFLNHSALIESD-DYKVMSKVTE 484

Query: 483 SIIGYFNLRDGYNPSDFKNPLLQKHYKVLHDYLLQTETAFEENETSDTKMDRIVHEDDSL 542
           ++I +FNL++GY PSDF NP LQKH+K+L +YLLQ E    + E            D++L
Sbjct: 485 TLINFFNLKNGYRPSDFHNPALQKHFKILREYLLQIEVDKSKPEDEG---------DETL 535

Query: 543 RKLYHIRNKILESEKSEDPAIQRLNKYVKIWNMFYKKFN 581
           +K+  I  +I  S KS+D   QRL KY+K+WN FY + +
Sbjct: 536 QKVKQIYARIASSAKSDDVKQQRLVKYLKLWNSFYNRLS 574

>AFR443C Chr6 complement(1236336..1238066) [1731 bp, 576 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR284W
           (YKU70)
          Length = 576

 Score =  395 bits (1016), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 228/569 (40%), Positives = 344/569 (60%), Gaps = 25/569 (4%)

Query: 12  DDFNNEMDEPGYRKFDMHEGILFCVELSETMFKESSELDYKSPLLEILESLNELMSQLVI 71
           D   ++ D+  + ++++HEGI+FCVELS  M+K S EL+ K  LLEILE+L ELM QLV 
Sbjct: 14  DSTADKEDDKRHLRYNVHEGIVFCVELSHNMYKPSPELEGKKQLLEILEALLELMEQLVA 73

Query: 72  TRPGTAIGCYFYYCYRDDAKEGIYELFPLRDINVRFMKKLNDLLEDLSSERVTLYEYFNF 131
             P T +GCYF+ C   +AK+GIYELFPLRD+NV  MKK+  LLE + + + +L E   +
Sbjct: 74  VMPDTGVGCYFFQCRHREAKQGIYELFPLRDVNVAHMKKVFLLLEGIRTGKRSLEEELPY 133

Query: 132 QKTENQKQMPLASLFTFILDTFLQDSSGQKQLNNKRVFLFTDNDKPQEAQNADDRARLRR 191
              + +    L  +FT I D FLQ+   Q+  NNK++FLFTDND P E ++   R RLR+
Sbjct: 134 ---DGRHPTSLDVVFTSIQDQFLQEVPEQRLYNNKKIFLFTDNDSPPEKESLGSRTRLRK 190

Query: 192 LTVDLFDNKINFTTFFIGYVNNSFDNEFYSDILQLGSHKNKTIGLNSEFDGPNTKPIDAK 251
           +  DL D  INF+TFFIG     FD  FYSDIL+LG+           +DGP+TKPI   
Sbjct: 191 VVDDLNDYYINFSTFFIGTEQRPFDESFYSDILKLGAQVAAEGSSKPLYDGPSTKPISVS 250

Query: 252 YIKSRILRKREVKRIMFQCQLIFDEKTDFIIGIKGYTMYSHEKAGVRYKLVYEHEDIRQE 311
           YI+SR+LRK+EV+R+ + C L  +E+   ++ +KGY   ++E+ G RY++VY+HED+++E
Sbjct: 251 YIRSRVLRKKEVRRLRYSCPLFLNEEQGLVVSVKGYAATTYERPGARYRMVYQHEDVQRE 310

Query: 312 AYSKRKFLNFMSGEDVTDNTVKVYPYGDLDINLSEHQDQIVME-AYTRKDAFLKITGFRS 370
           A+S R++L+  +GE+ T++  KVY  GD  ++L +  + ++   A    D+FL++ G R+
Sbjct: 311 AFSHRRYLDPDTGEEATEDLCKVYQIGDDCLDLPDDLENLITNFAAPTSDSFLRMLGSRT 370

Query: 371 SSISMHYFNNIEKSSFIVPDEEKYEGSIRALTSLLKILRKKDKIAILWGKLKSNSHPSLF 430
           +   + Y+NNI   +F+VPD+  Y GS   L SL + LR   +  +L+GKL++ S P+L+
Sbjct: 371 AVAVLPYYNNIHHVTFLVPDDSVYAGSAAVLASLHRTLRASQRAVVLYGKLRATSLPALY 430

Query: 431 VLSPSNIKEYNEGFYLYRVPFLDEIRKFPSLLSYDDGSDHEIDYDNMKKVTQSIIGYFNL 490
            L+P+     +  F L R+PF +E+RKFP+ LS    S    DY  ++K+T  II    L
Sbjct: 431 ALAPAAAPLPDAVFILARLPFQEEVRKFPA-LSPPQASLASPDYAVLQKITSRIIDLLVL 489

Query: 491 RDGYNPSDFKNPLLQKHYKVLHDYLLQTETAFEENETSDTKMDRIVHEDDSLRKLYHIRN 550
              Y P+DFKNP++  H+++L D+L +T    ++  T DT                 I  
Sbjct: 490 SSPYAPADFKNPVIATHFRLLSDHLFETA---QDPRTDDT-----------------IAR 529

Query: 551 KILESEKSEDPAIQRLNKYVKIWNMFYKK 579
            +    +  D    RL KY++ WN FY +
Sbjct: 530 LLRLRHRVLDDPESRLAKYLRHWNAFYAR 558

>Ecym_4620 Chr4 complement(1213899..1215692) [1794 bp, 597 aa] {ON}
           similar to Ashbya gossypii ABL117C
          Length = 597

 Score =  363 bits (933), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 200/556 (35%), Positives = 329/556 (59%), Gaps = 15/556 (2%)

Query: 25  KFDMHEGILFCVELSETMFKESSELDYKSPLLEILESLNELMSQLVITRPGTAIGCYFYY 84
           K +  + I+ C+ELS  ++ +SSE+  K+ L E+LE+L ELM QL +  P + + CY Y 
Sbjct: 17  KHERRQSIIVCIELSSRVY-QSSEISPKAQLAEMLEALLELMKQLAMLLPNSEVCCYVYQ 75

Query: 85  CYRDDAKEGIYELFPLRDINVRFMKKLNDLLEDLSSERVTLYEYFNFQKTENQKQMPLAS 144
           C R + K+GIYEL PL  +NV+ + K++ LL D+ ++++ L +   F++ +     PL+S
Sbjct: 76  CRRLNVKDGIYELLPLEMVNVQKIHKISQLLSDIKNKKMFLKDEIPFEEIDGS---PLSS 132

Query: 145 LFTFILDTFLQDSSGQKQLNNKRVFLFTDNDKPQEAQNADDRARLRRLTVDLFDNKINFT 204
           +   I       ++ + +  NKR+ L T ND P E  +A+ + + +     L+D+  +  
Sbjct: 133 VLAKIQHQLQGKTTDEWKFRNKRIILITANDMPAEYFDAELQKKFKNTINALYDDSFSIV 192

Query: 205 TFFIGYVNNSFDNEFYSDILQLGSHKNKTIGLNSEF-DGPNTKPIDAKYIKSRILRKREV 263
           TFFI      F++ FY+D+L+    + + +  N ++ DGPNTKPI+ K +K ++L+K+E 
Sbjct: 193 TFFIHSQTRPFNDTFYADLLK-PLRRPEDLDKNIQYYDGPNTKPIEIKELKGKLLQKKEG 251

Query: 264 KRIMFQCQLIFDEKTDFIIGIKGYTMYSHEKAGVRYKLVYEHEDIRQEAYSKRKFLNFMS 323
            +  F+C  I +++ DFII +KG+   + EKAG R+K +Y+     Q+A+S RKF N   
Sbjct: 252 NKFHFKCAFIINKQNDFIISLKGFFAITQEKAGERFKYIYQKGAKPQDAFSHRKFYNAND 311

Query: 324 GEDVTDNTVKVYPYGDLDINLSEHQDQIVMEAYTRKDAFLKITGFRSSSISMHYFNNIEK 383
           GE       KV+  G L+I  +E QDQ ++ +++  + FL++ GFRS      Y+NNI  
Sbjct: 312 GEAADSRLTKVFDIGGLNIEFTEEQDQKMINSFSEHETFLELIGFRSVDKVNFYYNNIST 371

Query: 384 SSFIVPDEEKYEGSIRALTSLLKILRKKDKIAILWGKLKSNSHPSLFVLSPSNIKEYNEG 443
           SS+++PD+  YEGS + L+ L   + KK K AI+WGKL   +HP LF++   + K  N+G
Sbjct: 372 SSYVIPDDNVYEGSSKTLSHLYASMTKKGKAAIVWGKLTRIAHPQLFLMVAMDRKNTNQG 431

Query: 444 FYLYRVPFLDEIRKFPSLLSYDDGSDHEIDYDNMKKVTQSIIGYFNLRDGYNPSDFKNPL 503
           FYL R+PF++EIR+FP  L  +   + + +Y  MKK+T +II +FNL+  Y  ++F +P+
Sbjct: 432 FYLVRLPFIEEIRRFPQTLQKNRSVNIQ-EYALMKKITGNIIAFFNLKSSYRAAEFPSPV 490

Query: 504 LQKHYKVLHDYLLQTETAFEENETSDTKMDRIVHEDDSLRKLYHIRNKILESEKSEDPAI 563
           L+  Y  L D LLQ      ++ +    M   +  D +L K+ H+R  I +S ++ +  I
Sbjct: 491 LKSFYTTLSDKLLQ------KSLSDQWGMGFKLSNDITLGKVQHLRELINKSSQNMEQPI 544

Query: 564 QRLNKYVKIWNMFYKK 579
             L KY+K WN +Y K
Sbjct: 545 --LAKYMKYWNTYYNK 558

>ABL117C Chr2 complement(179060..180868) [1809 bp, 602 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR284W
           (YKU70)
          Length = 602

 Score =  278 bits (710), Expect = 8e-85,   Method: Compositional matrix adjust.
 Identities = 163/562 (29%), Positives = 314/562 (55%), Gaps = 46/562 (8%)

Query: 26  FDMHEGILFCVELSETMFKESSELDYKSPLLEILESLNELMSQLVITRPGTAIGCYFYYC 85
            D ++ I+ C+ELS+T+   +  L   +P+LE++ +L  ++ +L+I +P +A+GC  +  
Sbjct: 24  IDRNQNIVLCIELSQTLCSPAGSLKGNAPILEVVRALLHMVEELIIVQPNSAVGCLTFRN 83

Query: 86  YRDDAKEGIYELFPLRDINVRFMKKLNDLLEDLSSERVTLYEYFNFQKTENQKQMPLASL 145
            R  A++GI E FPLR ++  +++ ++D + DL  E   + ++F F  T     +P ASL
Sbjct: 84  GRR-AEDGIVEAFPLRPLDANYVRNISDCVADLE-ETGMVGQHFPFTAT-----VP-ASL 135

Query: 146 FTFILDT---FLQDSSGQKQLNNKRVFLFTDNDKPQEAQNADDRARLRRLTVDLFDNKIN 202
              +  +   F +D+    Q  + R+FL TD D P E  +     +++   + L+  +I+
Sbjct: 136 DVMLAASDRYFTEDT----QNADNRIFLVTDVDTPVEFTDPIRLEKVQARLLSLYRRRID 191

Query: 203 FTTFFIGYVNNSFDNEFYSDILQLGSHKNKTIGLNSEFDGPNTKPIDAKYIKSRILRKRE 262
            TTFF+   + +F++  Y++IL     K +  G+       +T P+    ++ ++L +++
Sbjct: 192 ITTFFLHTEHAAFNDSSYAEIL-----KTREWGIPGAPQ--STSPLSICKLREKMLSQKD 244

Query: 263 VKRIMFQCQLIFDEKTDFIIGIKGYTMYSHEKAGVRYKLVYEHEDIRQEAYSKRKFLNFM 322
           + R  F C L+ ++  D ++ + GY   +HE+ G RYK + +H+   +  +  RK+    
Sbjct: 245 LNRAYFSCPLVINKTADLVVSVAGYVATTHERPGTRYKYIVKHDGRTKSVHQCRKYKTVD 304

Query: 323 SGEDVTD-NTVKVYPYGDLDINLSEHQDQIVMEAYTRKDAFLKITGFRSSSISMHYFNNI 381
           + + + D +   VY  G   I +++ + + +    ++ ++FL+I GFR+ + +  Y++NI
Sbjct: 305 NEKYIRDADRSSVYWIGGAGIEVTDAELRKMTRGCSKYESFLEILGFRAINTAAPYYSNI 364

Query: 382 EKSSFIVPDEEKYEGSIRALTSLLKILRKKDKIAILWGKLKSNSHPSLFVLSPSNIKEYN 441
            ++ +I+P E  + GS + L SL + + +K K AI+WG+LK+  HP+LF L PS+ +   
Sbjct: 365 GRAYYILPRELPFSGSAKVLASLNRSMFEKGKAAIVWGQLKAGFHPTLFALIPSDGETC- 423

Query: 442 EGFYLYRVPFLDEIRKFPSLLSYDDGSD---HEIDYDNMKKVTQSIIGYFNLRDGYNPSD 498
               L R+PF++E+R FP+L    DG D   H  +Y+ +K V+Q++I +F+LR  Y PSD
Sbjct: 424 -ALRLVRIPFIEEVRCFPTL----DGEDRLFHTREYELVKTVSQNLIRHFSLRTSYRPSD 478

Query: 499 FKNPLLQKHYKVLHDYLLQTETAFEENETSDTKMDRIVH---EDDSLRKLYHIRNKILES 555
            +NPLL+  Y  L+          E+++ +  KM  + +    D +L K+  +R++I  S
Sbjct: 479 IRNPLLRNFYSTLY---------HEQSQDAKRKMPELQYLPESDSTLHKVQLVRDRIENS 529

Query: 556 EKSEDPAIQRLNKYVKIWNMFY 577
              ++P I  +++Y+  WN++Y
Sbjct: 530 IIHDEPPI--ISEYINCWNIYY 549

>YMR106C Chr13 complement(478301..480190) [1890 bp, 629 aa] {ON}
           YKU80Subunit of the telomeric Ku complex
           (Yku70p-Yku80p), involved in telomere length
           maintenance, structure and telomere position effect;
           relocates to sites of double-strand cleavage to promote
           nonhomologous end joining during DSB repair
          Length = 629

 Score = 39.3 bits (90), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 68/146 (46%), Gaps = 17/146 (11%)

Query: 329 DNTVKVYPYG-DLDINLSEHQDQIVMEAYTRKDAFLKITGFRSSSISMHYFNNIEKSSFI 387
           D+  K Y YG D  +  S   DQ V E++      L + GF +      YF   E SSFI
Sbjct: 311 DSVTKAYRYGADYVVLPSVLVDQTVYESF----PGLDLRGFLNREALPRYFLTSE-SSFI 365

Query: 388 VPDEE-KYEGSIRALTSLLKILRKKDKIAILWGKLKSNSHPSLFVLSP-----SNI---K 438
             D     +  + A ++L+ ++ +  KIA+     K +S  ++  L P     SNI   K
Sbjct: 366 TADTRLGCQSDLMAFSALVDVMLENRKIAVARYVSKKDSEVNMCALCPVLIEHSNINSEK 425

Query: 439 EYNEGFYLYRVPFLDE--IRKFPSLL 462
           ++ +   L R+PF ++  +  FP LL
Sbjct: 426 KFVKSLTLCRLPFAEDERVTDFPKLL 451

>NCAS0F01480 Chr6 complement(295334..297211) [1878 bp, 625 aa] {ON}
           Anc_2.444 YMR106C
          Length = 625

 Score = 37.0 bits (84), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 54/198 (27%), Positives = 85/198 (42%), Gaps = 27/198 (13%)

Query: 284 IKGYTMYSHEKAGVRYKLVYEHEDIRQEAYSKRKFLNFMSGEDVT---DNTVKVYPYG-D 339
           IK  T  +H    +  K V E+E I  +  S+    +      VT   D+  K Y YG D
Sbjct: 262 IKTVTGENHSTKYIPVKSVIEYEVINPKESSQDAD-DKNDARPVTVSRDSITKAYRYGAD 320

Query: 340 LDINLSEHQDQIVMEAYTRKDAFLKITGFRSSSISMHYFNNIEKSSFIVPDEEKYEGSIR 399
             +  S  Q Q+V E +      L I GF    +   Y+ N E S+FI+ D  +  G   
Sbjct: 321 YVVLPSTLQSQLVYETF----PGLDIRGFMDMELLPRYYLNSE-STFIIADT-RLGGLAD 374

Query: 400 ALT--SLLKILRKKDKIAILWGKLKSNSHPSLFVLSPSNIKEYNEGF------------Y 445
           ++T   L+ +L    K+A+     K+NS   + VL P  +  +++ F             
Sbjct: 375 SVTFGVLVDVLLNNRKVAVARYVPKANSEVQMCVLVPLFVAHHDQSFSGEGEENFVRTLV 434

Query: 446 LYRVPFLDE--IRKFPSL 461
           L R+PF ++  +  FP L
Sbjct: 435 LNRLPFAEDERVSDFPRL 452

>TBLA0B09020 Chr2 complement(2138426..2140471) [2046 bp, 681 aa]
           {ON} Anc_2.444 YMR106C
          Length = 681

 Score = 35.0 bits (79), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 47/159 (29%), Positives = 70/159 (44%), Gaps = 38/159 (23%)

Query: 333 KVYPYG-DLDINLSEHQDQIVMEAYTRKDAFLKITGFR-SSSISMHYFNNIEKSSFIVPD 390
           KVY YG D  +  +   D +    Y      L ITGF    S+  HY   I +S+FIV D
Sbjct: 349 KVYRYGTDYVVLPTTLTDNLSFNTY----PGLDITGFMDEESLPRHYL--ISESTFIVAD 402

Query: 391 EEKYEGSIRALTS---LLKILRKKDKIAILWGKLKSNSHPSLFVLSP-----------SN 436
                GS   + S   L+ +L +  KIAI     K+N++  + +L P            +
Sbjct: 403 SRA--GSTADMMSFEILVDVLYENKKIAIARYVQKNNTNAQMVMLCPVLVDHSDILSEQD 460

Query: 437 IKEY-------NE-----GFYLYRVPFLDE--IRKFPSL 461
           I++Y       NE     G  L R+PF ++  + +FP L
Sbjct: 461 IQKYRSIHDDDNEEVNMRGLILSRLPFAEDERVSEFPKL 499

>NCAS0H00820 Chr8 (148184..151624) [3441 bp, 1146 aa] {ON} Anc_6.20
           YML002W
          Length = 1146

 Score = 33.5 bits (75), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 27/37 (72%), Gaps = 4/37 (10%)

Query: 385 SFIVPDEEKYEGSI----RALTSLLKILRKKDKIAIL 417
           +F +PD+E   G++    +A+ SLLK++RKK +I++L
Sbjct: 764 TFPLPDKENETGTVNIKVKAIISLLKVIRKKSQISLL 800

>Ecym_2476 Chr2 complement(930107..931942) [1836 bp, 611 aa] {ON}
           similar to Ashbya gossypii ABL030W
          Length = 611

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 62/263 (23%), Positives = 98/263 (37%), Gaps = 60/263 (22%)

Query: 329 DNTVKVYPYGDLDINLSEHQDQIVMEAYTRKDAFLKITGFRSS-SISMHYFNNIEKSSFI 387
           D+ VK + YG   I+L    D +  E   +    L I GF    ++   Y     +S +I
Sbjct: 290 DHIVKAFRYGADYISLP---DVLASERIYQTTPGLDIRGFIDLFNVPRQYLCG--ESVYI 344

Query: 388 VPD-EEKYEGSIRALTSLLKILRKKDKIAILWGKLKSNSHPSLFVLSP----SNIK---- 438
           + D  E  E    A ++L+  +    K+AI     K+NS   + VL P    SN+K    
Sbjct: 345 IADTREGSEADFMAFSALVDAMITSKKLAIARYVQKNNSEVQMVVLCPLLVGSNLKKRTS 404

Query: 439 -----EYNEGFYLYRVPFLDEIR---------KFPSLLSYDDGSDHEIDYDNMKK----- 479
                E      L R+PF ++ R         K+P     D   D  +D  +M       
Sbjct: 405 DNPEAEPKRALVLCRLPFAEDERACDFLPFTNKYPKDEDMDAKMDQLVDLMDMDSDATEH 464

Query: 480 ------VTQSIIGYF---------------NLRDGYNPSDFKNPLLQKHYKVLHDY---- 514
                  + S I  F               NL++  +P       + +  +VL DY    
Sbjct: 465 HSETSWCSNSSIQPFTSFMKDSSLPLPSDPNLQEVSDPICIPAIAIHRQKQVLLDYFHQR 524

Query: 515 -LLQTETAFEENETSDTKMDRIV 536
            +L  E AF     +D+ M++I 
Sbjct: 525 FILGQENAFSIGNMADSLMEQIA 547

>NCAS0D02360 Chr4 complement(442333..444012) [1680 bp, 559 aa] {ON}
           Anc_5.13
          Length = 559

 Score = 32.7 bits (73), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 36/78 (46%), Gaps = 7/78 (8%)

Query: 148 FILDTFLQDSSGQKQLNNKRVFLFTDNDKPQEAQNADDRAR----LRRLT--VDLFDNKI 201
           + ++T L  +     LN+  +++  D   P E+ N D  +     L R T  VDLF N  
Sbjct: 91  YAVNTSLDHTECMNALNDAGIYVIADLSSPTESINRDSPSWTLDLLDRYTSVVDLFSNYT 150

Query: 202 NFTTFFIGY-VNNSFDNE 218
           N   FF G  V N+F N 
Sbjct: 151 NVLGFFAGNEVTNNFTNA 168

>YMR094W Chr13 (455825..457261) [1437 bp, 478 aa] {ON}  CTF13Subunit
           of the CBF3 complex, which binds to the CDE III element
           of centromeres, bending the DNA upon binding, and may be
           involved in sister chromatid cohesion during mitosis
          Length = 478

 Score = 32.3 bits (72), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 53/111 (47%), Gaps = 15/111 (13%)

Query: 474 YDNMKKVTQSIIGYFNLRDGYNPSDFKNPLLQKHYKVLHDYLLQTETAFEENETSDTKMD 533
           +DN++K+  S + Y +L     P +FK+  +++  K+            EEN   + K+D
Sbjct: 331 WDNLQKLVLSRVAYIDLNSIVFPKNFKSLTMKRVSKI-------KWWNIEENILKELKVD 383

Query: 534 R------IVHEDDS-LRKLYHIRN-KILESEKSEDPAIQRLNKYVKIWNMF 576
           +       + EDDS   K +++R+ +I E +KSE   I  L     +W  F
Sbjct: 384 KRTFKSLYIKEDDSKFTKFFNLRHTRIKELDKSEINQITYLRCQAIVWLSF 434

>ZYRO0B10934g Chr2 complement(861789..863393) [1605 bp, 534 aa] {ON}
           similar to uniprot|P40992 Saccharomyces cerevisiae
           YJL025W RRN7 involved in the transcription of 35S rRNA
           genes by RNA polymerase I member of yeast Pol I core
           factor (CF) also composed of Rrn11p Rrn6p and
           TATA-binding protein
          Length = 534

 Score = 31.2 bits (69), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 59/273 (21%), Positives = 99/273 (36%), Gaps = 36/273 (13%)

Query: 158 SGQKQLNNKRVFLFTDNDKPQEAQNADDRARLRRLT--VDLFDNKINFTTFFIGYV-NNS 214
           S + QL N  + +      PQE Q     ARL   T  +  F++++N+       V +N 
Sbjct: 226 SWRVQLPNYYLGVLEGGKGPQEGQLFTHIARLCTKTDFIKEFNHRVNYECLIFKLVLSNV 285

Query: 215 FDNEFYSDILQLGSHKNKTIGLNSEFD-GPNTKPIDAKYIKSRILRKREVKRIMFQCQLI 273
              EFY   +QL     +T     +F+  P+TKP    +I  +I                
Sbjct: 286 LPPEFYLFAIQL----IRTTSEGHDFELNPDTKP--QSWIDLQI---------------- 323

Query: 274 FDEKTDFIIGIKGYTMYSHEKAGVRYKLVYEHEDIRQEAYSKRKFLNFMSGEDVTDNTVK 333
                 F++ I+   MY  E   VR+         RQE  +     N +        T K
Sbjct: 324 ---TAYFLLTIRWVLMYDTESYQVRWIHALIQRQKRQEVSTDTIDQNILKLSQTQKPTQK 380

Query: 334 VYPYGDLDINLSEHQDQIVMEAYTRKDAFLKITGFRSSSISMHYFNNIEKSSFIVPDEEK 393
           V+ + D ++       +       R D  LKI   R +   +H    +E  +F     + 
Sbjct: 381 VFEWTDEEMAQYLSWAEEAFLPLQRNDERLKIDQ-RIAKRKLHKLFPLESETFNTTSSQV 439

Query: 394 YEGSIRALTSLLKILRKKDKIAILWGKLKSNSH 426
           ++     L  L      +++ A   G+ +S  H
Sbjct: 440 FQSKPSFLNEL------QERYAFFQGQFESTDH 466

>TPHA0G02460 Chr7 (504893..506773) [1881 bp, 626 aa] {ON} Anc_2.444
           YMR106C
          Length = 626

 Score = 31.2 bits (69), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 45/147 (30%), Positives = 69/147 (46%), Gaps = 14/147 (9%)

Query: 326 DVTDNTV-KVYPYG-DLDINLSEHQDQIVMEAYTRKDAFLKITGFRSSSISMHYFNNIEK 383
           +V+ N+V K + YG D  I  +   DQ  M       A + I GF + +    YF N E 
Sbjct: 316 NVSPNSVSKAFRYGSDYVILPAVINDQRTM----NNKANIDIRGFMNETSLPRYFLNSE- 370

Query: 384 SSFIVPDEEKYEGS-IRALTSLLKILRKKDKIAILWGKLKSNSHPSLFVLSP--SNIKEY 440
           S FI  D      S + ++ +L+ +L +  KIAI+    K N    +  L P  S I + 
Sbjct: 371 SKFIFFDSRNGSKSDVYSMYALVDVLMENKKIAIVRYVQKHNGEVEMCALYPMVSKISDR 430

Query: 441 N--EGFYLYRVPFLDE--IRKFPSLLS 463
           N    F L R+PF ++  +  FP L++
Sbjct: 431 NIVRYFVLNRLPFAEDERVSDFPKLVN 457

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.138    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 70,395,443
Number of extensions: 3513031
Number of successful extensions: 12066
Number of sequences better than 10.0: 61
Number of HSP's gapped: 12414
Number of HSP's successfully gapped: 61
Length of query: 602
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 487
Effective length of database: 40,294,809
Effective search space: 19623571983
Effective search space used: 19623571983
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 69 (31.2 bits)