Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_13.4968.848ON49449426440.0
YMR283C (RIT1)8.848ON51349422640.0
Skud_13.4558.848ON49449421850.0
Suva_13.4728.848ON51049621760.0
Kpol_1068.28.848ON49148914860.0
TPHA0I003008.848ON49349414740.0
KNAG0J002208.848ON49949614570.0
NDAI0K003508.848ON50450514500.0
NCAS0C003508.848ON48650314350.0
TDEL0A079708.848ON48949413790.0
SAKL0D01276g8.848ON50249613720.0
ZYRO0G14344g8.848ON47249613251e-180
KAFR0B039808.848ON48349013231e-179
Kwal_27.102198.848ON50049512951e-175
KLTH0C03696g8.848ON47448412821e-173
Ecym_46238.848ON48049412691e-171
KLLA0D01386g8.848ON48950212571e-169
AFR451C8.848ON4084269721e-127
ZYRO0A01100g2.224ON30994741.3
CAGL0K06303g5.576ON3247117732.4
TPHA0G014508.716ON66892714.7
Smik_16.2168.71ON834127696.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_13.496
         (494 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_13.496 Chr13 complement(818336..819820) [1485 bp, 494 aa] {...  1023   0.0  
YMR283C Chr13 complement(835326..836867) [1542 bp, 513 aa] {ON} ...   876   0.0  
Skud_13.455 Chr13 complement(808556..810040) [1485 bp, 494 aa] {...   846   0.0  
Suva_13.472 Chr13 complement(818023..819555) [1533 bp, 510 aa] {...   842   0.0  
Kpol_1068.2 s1068 (2343..3818) [1476 bp, 491 aa] {ON} (2343..381...   577   0.0  
TPHA0I00300 Chr9 complement(57211..58692) [1482 bp, 493 aa] {ON}...   572   0.0  
KNAG0J00220 Chr10 (29017..30516) [1500 bp, 499 aa] {ON} Anc_8.84...   565   0.0  
NDAI0K00350 Chr11 complement(66993..68507) [1515 bp, 504 aa] {ON...   563   0.0  
NCAS0C00350 Chr3 (51842..53302) [1461 bp, 486 aa] {ON} Anc_8.848...   557   0.0  
TDEL0A07970 Chr1 (1391841..1393310) [1470 bp, 489 aa] {ON} Anc_8...   535   0.0  
SAKL0D01276g Chr4 (96411..97919) [1509 bp, 502 aa] {ON} similar ...   533   0.0  
ZYRO0G14344g Chr7 complement(1148368..1149786) [1419 bp, 472 aa]...   514   e-180
KAFR0B03980 Chr2 complement(832133..833584) [1452 bp, 483 aa] {O...   514   e-179
Kwal_27.10219 s27 (246213..247715) [1503 bp, 500 aa] {ON} YMR283...   503   e-175
KLTH0C03696g Chr3 (320129..321553) [1425 bp, 474 aa] {ON} simila...   498   e-173
Ecym_4623 Chr4 (1219438..1220880) [1443 bp, 480 aa] {ON} similar...   493   e-171
KLLA0D01386g Chr4 (118965..120434) [1470 bp, 489 aa] {ON} simila...   488   e-169
AFR451C Chr6 complement(1248648..1249874) [1227 bp, 408 aa] {ON}...   379   e-127
ZYRO0A01100g Chr1 (79473..80402) [930 bp, 309 aa] {ON} similar t...    33   1.3  
CAGL0K06303g Chr11 (611434..621177) [9744 bp, 3247 aa] {ON} simi...    33   2.4  
TPHA0G01450 Chr7 (297855..299861) [2007 bp, 668 aa] {ON}               32   4.7  
Smik_16.216 Chr16 complement(391489..393993) [2505 bp, 834 aa] {...    31   6.8  

>Smik_13.496 Chr13 complement(818336..819820) [1485 bp, 494 aa] {ON}
           YMR283C (REAL)
          Length = 494

 Score = 1023 bits (2644), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 494/494 (100%), Positives = 494/494 (100%)

Query: 1   MDEEICLSLTKINRDVRKENKSVRNRLQSILLDNKFLQDRVIPVFPYFPLVPNERCGIWY 60
           MDEEICLSLTKINRDVRKENKSVRNRLQSILLDNKFLQDRVIPVFPYFPLVPNERCGIWY
Sbjct: 1   MDEEICLSLTKINRDVRKENKSVRNRLQSILLDNKFLQDRVIPVFPYFPLVPNERCGIWY 60

Query: 61  CKPSTYKQTSYFKSTDGHVNQWDFSTRRLNFHLLETIRDNKGIIIVDSTRRGKKIPDALS 120
           CKPSTYKQTSYFKSTDGHVNQWDFSTRRLNFHLLETIRDNKGIIIVDSTRRGKKIPDALS
Sbjct: 61  CKPSTYKQTSYFKSTDGHVNQWDFSTRRLNFHLLETIRDNKGIIIVDSTRRGKKIPDALS 120

Query: 121 KTVPIWCAVLNTIMLQETEENFDIDKALYLPPETVPKSEYDMIKRKIPELVTKLRKLNII 180
           KTVPIWCAVLNTIMLQETEENFDIDKALYLPPETVPKSEYDMIKRKIPELVTKLRKLNII
Sbjct: 121 KTVPIWCAVLNTIMLQETEENFDIDKALYLPPETVPKSEYDMIKRKIPELVTKLRKLNII 180

Query: 181 DSKKLNELFMGKILRPIWVHPGSSLLNHSVDYFTGEIQQHETWETPEDQNIIPIILCTVS 240
           DSKKLNELFMGKILRPIWVHPGSSLLNHSVDYFTGEIQQHETWETPEDQNIIPIILCTVS
Sbjct: 181 DSKKLNELFMGKILRPIWVHPGSSLLNHSVDYFTGEIQQHETWETPEDQNIIPIILCTVS 240

Query: 241 YQAQDGMDKRYGFTYVQGAADDHELWSFGLDSKMFWAHVEFLCDKNNSDDQLHDYITDLV 300
           YQAQDGMDKRYGFTYVQGAADDHELWSFGLDSKMFWAHVEFLCDKNNSDDQLHDYITDLV
Sbjct: 241 YQAQDGMDKRYGFTYVQGAADDHELWSFGLDSKMFWAHVEFLCDKNNSDDQLHDYITDLV 300

Query: 301 AKKLKSQMYIQDKGGLDEIFGKVDKITDEISLGKVVQGLFINEKLKEELKSEYGKVLILS 360
           AKKLKSQMYIQDKGGLDEIFGKVDKITDEISLGKVVQGLFINEKLKEELKSEYGKVLILS
Sbjct: 301 AKKLKSQMYIQDKGGLDEIFGKVDKITDEISLGKVVQGLFINEKLKEELKSEYGKVLILS 360

Query: 361 DSVTVAEDAGVVEATKSNPFITVYKLQSGDKKSSKALRSILPKIHEEVELAFANRAEEMR 420
           DSVTVAEDAGVVEATKSNPFITVYKLQSGDKKSSKALRSILPKIHEEVELAFANRAEEMR
Sbjct: 361 DSVTVAEDAGVVEATKSNPFITVYKLQSGDKKSSKALRSILPKIHEEVELAFANRAEEMR 420

Query: 421 PMLVCCNTGTDMSIGVILSILCTKYTEEWMLTQELPEVNKIIIRKHLTKLISHLHGRNVN 480
           PMLVCCNTGTDMSIGVILSILCTKYTEEWMLTQELPEVNKIIIRKHLTKLISHLHGRNVN
Sbjct: 421 PMLVCCNTGTDMSIGVILSILCTKYTEEWMLTQELPEVNKIIIRKHLTKLISHLHGRNVN 480

Query: 481 PSRATLNSVNSFLM 494
           PSRATLNSVNSFLM
Sbjct: 481 PSRATLNSVNSFLM 494

>YMR283C Chr13 complement(835326..836867) [1542 bp, 513 aa] {ON}
           RIT12'-O-ribosyl phosphate transferase, modifies the
           initiator methionine tRNA at position 64 to distinguish
           it from elongator methionine tRNA
          Length = 513

 Score =  876 bits (2264), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/494 (82%), Positives = 456/494 (92%)

Query: 1   MDEEICLSLTKINRDVRKENKSVRNRLQSILLDNKFLQDRVIPVFPYFPLVPNERCGIWY 60
           MDE I LSL++IN+D+RKENKSVRNRLQSILLDNKFLQDRVIP+FP++PL+PNERCG+WY
Sbjct: 20  MDENIYLSLSQINKDIRKENKSVRNRLQSILLDNKFLQDRVIPIFPHYPLIPNERCGLWY 79

Query: 61  CKPSTYKQTSYFKSTDGHVNQWDFSTRRLNFHLLETIRDNKGIIIVDSTRRGKKIPDALS 120
           C PS++KQTSYFKSTDGHVNQWDFSTRRLNFHLLETIRDNKGIIIVDSTRRGKKIPDALS
Sbjct: 80  CNPSSFKQTSYFKSTDGHVNQWDFSTRRLNFHLLETIRDNKGIIIVDSTRRGKKIPDALS 139

Query: 121 KTVPIWCAVLNTIMLQETEENFDIDKALYLPPETVPKSEYDMIKRKIPELVTKLRKLNII 180
           KTVPIWCAVLNT+MLQETE+N  IDK LYLPPETVPKSEYDMIKRKIPELV KL+KLNII
Sbjct: 140 KTVPIWCAVLNTLMLQETEKNVAIDKVLYLPPETVPKSEYDMIKRKIPELVAKLQKLNII 199

Query: 181 DSKKLNELFMGKILRPIWVHPGSSLLNHSVDYFTGEIQQHETWETPEDQNIIPIILCTVS 240
           DSKKLNELFMGK+LRPIWVHPGSSLL+HSVDYFTGE+Q++E WETPEDQNIIPIILCTVS
Sbjct: 200 DSKKLNELFMGKLLRPIWVHPGSSLLDHSVDYFTGEVQEYEAWETPEDQNIIPIILCTVS 259

Query: 241 YQAQDGMDKRYGFTYVQGAADDHELWSFGLDSKMFWAHVEFLCDKNNSDDQLHDYITDLV 300
           YQAQDGMDKRYGFTYVQGAADDHELWSFGLDS MFWAH+E+L D + SDDQLHDYI DL 
Sbjct: 260 YQAQDGMDKRYGFTYVQGAADDHELWSFGLDSNMFWAHIEYLGDASYSDDQLHDYIMDLA 319

Query: 301 AKKLKSQMYIQDKGGLDEIFGKVDKITDEISLGKVVQGLFINEKLKEELKSEYGKVLILS 360
           A KL++Q YIQDKG LDE+FG +DKIT+EISLGKV  GL IN+ LK++LKSEYGKV+I S
Sbjct: 320 AAKLRNQCYIQDKGSLDEVFGNIDKITNEISLGKVSSGLTINKNLKQKLKSEYGKVIIFS 379

Query: 361 DSVTVAEDAGVVEATKSNPFITVYKLQSGDKKSSKALRSILPKIHEEVELAFANRAEEMR 420
           +SVTVAED    E + ++PFI++YKLQSGDKKSSKALRS  P+IH E++  F NR E+++
Sbjct: 380 NSVTVAEDTDDEEESGTDPFISIYKLQSGDKKSSKALRSTFPRIHGEIQSLFTNRDEKIK 439

Query: 421 PMLVCCNTGTDMSIGVILSILCTKYTEEWMLTQELPEVNKIIIRKHLTKLISHLHGRNVN 480
           PML+CCNTGTDMSIGVILSILCTKYTEEWMLT ELP+++K+I+RKHLTKLISHL GRNVN
Sbjct: 440 PMLICCNTGTDMSIGVILSILCTKYTEEWMLTSELPDISKLIVRKHLTKLISHLKGRNVN 499

Query: 481 PSRATLNSVNSFLM 494
           PSRATLNSVNSFLM
Sbjct: 500 PSRATLNSVNSFLM 513

>Skud_13.455 Chr13 complement(808556..810040) [1485 bp, 494 aa] {ON}
           YMR283C (REAL)
          Length = 494

 Score =  846 bits (2185), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/494 (79%), Positives = 452/494 (91%)

Query: 1   MDEEICLSLTKINRDVRKENKSVRNRLQSILLDNKFLQDRVIPVFPYFPLVPNERCGIWY 60
           MD+EI LSL++IN+DVR+ENKSVRNRLQSILLDNKFLQ+RV+ +FP+FP+VPNERCG+WY
Sbjct: 1   MDKEILLSLSQINKDVRRENKSVRNRLQSILLDNKFLQERVVSIFPHFPIVPNERCGLWY 60

Query: 61  CKPSTYKQTSYFKSTDGHVNQWDFSTRRLNFHLLETIRDNKGIIIVDSTRRGKKIPDALS 120
           C+PST+K+TSYFKSTDGHVNQWDFSTRRLNFHLLETIRD KGIII+DSTRRGKKIPD+LS
Sbjct: 61  CEPSTFKRTSYFKSTDGHVNQWDFSTRRLNFHLLETIRDKKGIIIIDSTRRGKKIPDSLS 120

Query: 121 KTVPIWCAVLNTIMLQETEENFDIDKALYLPPETVPKSEYDMIKRKIPELVTKLRKLNII 180
           KTVPIWCAVLNTIMLQ+ +E+ DIDK LY+PPETVPKSEYDMIKRKIPELV KL+KLN++
Sbjct: 121 KTVPIWCAVLNTIMLQKEKEDVDIDKVLYVPPETVPKSEYDMIKRKIPELVAKLKKLNVV 180

Query: 181 DSKKLNELFMGKILRPIWVHPGSSLLNHSVDYFTGEIQQHETWETPEDQNIIPIILCTVS 240
           DS+KLN+LFMGKILRPIWVHPGSSLLNHSVDYFTGE+++ ETWE P+DQNIIPIILCTVS
Sbjct: 181 DSEKLNDLFMGKILRPIWVHPGSSLLNHSVDYFTGELKEQETWEAPKDQNIIPIILCTVS 240

Query: 241 YQAQDGMDKRYGFTYVQGAADDHELWSFGLDSKMFWAHVEFLCDKNNSDDQLHDYITDLV 300
           YQAQDGMDKRYGFTYVQGAADDHELWSFGLDS+MFW+HV++L D + SDDQLHDYITDLV
Sbjct: 241 YQAQDGMDKRYGFTYVQGAADDHELWSFGLDSEMFWSHVDYLGDTDKSDDQLHDYITDLV 300

Query: 301 AKKLKSQMYIQDKGGLDEIFGKVDKITDEISLGKVVQGLFINEKLKEELKSEYGKVLILS 360
           AKKL++Q+ I+DKG LDEIFG +D IT+EISLGKV+QGL I+ KLK+ELK  Y KV++ S
Sbjct: 301 AKKLENQLSIKDKGSLDEIFGNIDIITNEISLGKVIQGLTISVKLKQELKLRYDKVIVFS 360

Query: 361 DSVTVAEDAGVVEATKSNPFITVYKLQSGDKKSSKALRSILPKIHEEVELAFANRAEEMR 420
           DSV + ED    E +  N FI+V+KLQSGDKKSSK LR+I P+IHEE++ AFANR    +
Sbjct: 361 DSVAITEDTDHEEESSPNSFISVFKLQSGDKKSSKTLRTIFPRIHEELQSAFANRDGGTK 420

Query: 421 PMLVCCNTGTDMSIGVILSILCTKYTEEWMLTQELPEVNKIIIRKHLTKLISHLHGRNVN 480
           P+L+CCNTGTDMSIGVILSILCTKYTE+W LT ELPEVNKIIIR+HLTKLISHL GRNVN
Sbjct: 421 PILICCNTGTDMSIGVILSILCTKYTEDWKLTPELPEVNKIIIRRHLTKLISHLRGRNVN 480

Query: 481 PSRATLNSVNSFLM 494
           PSRATLNSVNSFLM
Sbjct: 481 PSRATLNSVNSFLM 494

>Suva_13.472 Chr13 complement(818023..819555) [1533 bp, 510 aa] {ON}
           YMR283C (REAL)
          Length = 510

 Score =  842 bits (2176), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/496 (80%), Positives = 449/496 (90%), Gaps = 2/496 (0%)

Query: 1   MDEEI--CLSLTKINRDVRKENKSVRNRLQSILLDNKFLQDRVIPVFPYFPLVPNERCGI 58
           MDEEI   LSL++IN+DVRKENKSVRNRLQSILLDN+FL+DRV+P+FP FP+VPNERCG+
Sbjct: 15  MDEEILLSLSLSQINKDVRKENKSVRNRLQSILLDNRFLRDRVLPIFPRFPIVPNERCGL 74

Query: 59  WYCKPSTYKQTSYFKSTDGHVNQWDFSTRRLNFHLLETIRDNKGIIIVDSTRRGKKIPDA 118
           WYC+PS+++QTSYFKSTDGHVNQWDFSTRRLNFHLLE I++NKGIIIVDSTRRGKKIPDA
Sbjct: 75  WYCEPSSFEQTSYFKSTDGHVNQWDFSTRRLNFHLLEIIQENKGIIIVDSTRRGKKIPDA 134

Query: 119 LSKTVPIWCAVLNTIMLQETEENFDIDKALYLPPETVPKSEYDMIKRKIPELVTKLRKLN 178
           LSKTVPIWCAVLNTIMLQETEEN DIDK LY+PPETVPKSEYDMIKRKIPELV KL+KLN
Sbjct: 135 LSKTVPIWCAVLNTIMLQETEENVDIDKVLYVPPETVPKSEYDMIKRKIPELVDKLQKLN 194

Query: 179 IIDSKKLNELFMGKILRPIWVHPGSSLLNHSVDYFTGEIQQHETWETPEDQNIIPIILCT 238
            IDSK LN+LF GKILRPIWVHPGSSLLNHSVD FTGEI++ E WE+PEDQNIIPIILCT
Sbjct: 195 AIDSKTLNKLFKGKILRPIWVHPGSSLLNHSVDCFTGEIEEQEIWESPEDQNIIPIILCT 254

Query: 239 VSYQAQDGMDKRYGFTYVQGAADDHELWSFGLDSKMFWAHVEFLCDKNNSDDQLHDYITD 298
           VSYQAQDGMDKRYGFTYVQGAADDHELWSFGLDSKMFW+H+++L D NNSDDQL  YITD
Sbjct: 255 VSYQAQDGMDKRYGFTYVQGAADDHELWSFGLDSKMFWSHIDYLGDTNNSDDQLCAYITD 314

Query: 299 LVAKKLKSQMYIQDKGGLDEIFGKVDKITDEISLGKVVQGLFINEKLKEELKSEYGKVLI 358
           L+ KKL+ Q+ IQDKG LD+IF  +DKIT+EISLGKV+QGL INEKL++ELK  Y KV+I
Sbjct: 315 LIGKKLEYQLSIQDKGNLDDIFENIDKITNEISLGKVIQGLTINEKLEKELKVHYEKVII 374

Query: 359 LSDSVTVAEDAGVVEATKSNPFITVYKLQSGDKKSSKALRSILPKIHEEVELAFANRAEE 418
            S+SV +A  A  VE ++++ FI+VYKLQSGDKKSSKALRS  P IH+EV+  FAN A+ 
Sbjct: 375 FSNSVAIAAHADSVEESRTDSFISVYKLQSGDKKSSKALRSTFPMIHQEVQPVFANPAKG 434

Query: 419 MRPMLVCCNTGTDMSIGVILSILCTKYTEEWMLTQELPEVNKIIIRKHLTKLISHLHGRN 478
           M+P+LVCCNTGTDMSIGVILSILC KY EEW+LT ELP VNKIIIRKHLTKLISHLHGRN
Sbjct: 435 MKPILVCCNTGTDMSIGVILSILCAKYNEEWILTSELPVVNKIIIRKHLTKLISHLHGRN 494

Query: 479 VNPSRATLNSVNSFLM 494
           VNPSRATLNSVNSFLM
Sbjct: 495 VNPSRATLNSVNSFLM 510

>Kpol_1068.2 s1068 (2343..3818) [1476 bp, 491 aa] {ON} (2343..3818)
           [1476 nt, 492 aa]
          Length = 491

 Score =  577 bits (1486), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/489 (58%), Positives = 364/489 (74%), Gaps = 11/489 (2%)

Query: 8   SLTKINRDVRKENKSVRNRLQSILLDNKFLQDRVIPVFPYFPLVPNERCGIWYCKPSTYK 67
           S+ +I++D++KE KS++NR+QSILLD +FL+D VIP FP FP++PNERCG+WYC P  ++
Sbjct: 10  SINQIHKDIKKEYKSLKNRIQSILLDARFLEDTVIPFFPEFPVIPNERCGLWYCNPKLFE 69

Query: 68  QTSYFKSTDGHVNQWDFSTRRLNFHLLETIRDNKGIIIVDSTRRGKKIPDALSKTVPIWC 127
           QTSYFKSTDGH+NQWDFSTRRLNFHLL T+  N GI+IVDSTRRGKKIPDALSKTVPIWC
Sbjct: 70  QTSYFKSTDGHINQWDFSTRRLNFHLLPTLAQNGGIVIVDSTRRGKKIPDALSKTVPIWC 129

Query: 128 AVLNTIMLQETEE-NFDIDKALYLPPETVPKSEYDMIKRKIPELVTKLRKLNIIDSKKLN 186
           AVLN++ML+  ++ N D  K L++PP TVP SEY  I +K+P L+ +L KL IID   L 
Sbjct: 130 AVLNSLMLESVDQLNDDYSKVLFVPPSTVPNSEYQRILKKLPLLIERLNKLAIIDGSDLY 189

Query: 187 ELFMGKILRPIWVHPGSSLLNHSVDYFTGEIQQHETWETPEDQNIIPIILCTVSYQAQDG 246
           + F GK+LRPIW+HPGSSLL  + D FTGE   ++ WETPED+ IIPIILCTVSY+AQDG
Sbjct: 190 KQFNGKLLRPIWIHPGSSLLQSTTDIFTGE-STNDVWETPEDEEIIPIILCTVSYRAQDG 248

Query: 247 MDKRYGFTYVQGAADDHELWSFGLDSKMFWAHVEFLCDKNNSDDQLHDYITDLVAKKLKS 306
           +DKR+GFTYVQGAADDHELWS GL+  MFW ++E   D + S+D L   + DL+A K   
Sbjct: 249 VDKRHGFTYVQGAADDHELWSHGLNPDMFWDNIEQFNDLDRSEDLLQSTVEDLLAAK--- 305

Query: 307 QMYIQDKGGLDEIFGKVDKITDEISLGKVVQGLFINEKLKEELKSEYGKVLILSDSVTVA 366
           Q  + +   L E F  +D IT +I LGK+  GL I + L  EL S++  V++ S+S  ++
Sbjct: 306 QKEVSETETL-EAFNPLDMITTDIFLGKIADGLIIGDSLTSELLSKFSMVIVFSESCKLS 364

Query: 367 EDAGVVEATKSNPFITVYKLQSGDKKSSKALRSILPKIHEEVELAFA-NRAEEMRPMLVC 425
                 + T+    I + +LQSG KKSSKALR  LP++H  +E  F+ ++A+   P+L+C
Sbjct: 365 VSKNEEKITQR---IVINQLQSGSKKSSKALRKTLPELHSRIEPFFSTDKAKSELPILIC 421

Query: 426 CNTGTDMSIGVILSILCTKYTEEWMLTQELPEVNKIIIRKHLTKLISHLHGRNVNPSRAT 485
           CN+GTDMSI ++L +LC  Y  +W  T +  EVNKIIIRKHLTKLISHL GRNVNPSRAT
Sbjct: 422 CNSGTDMSIALVLMLLCKHYDLDWN-TSKPNEVNKIIIRKHLTKLISHLKGRNVNPSRAT 480

Query: 486 LNSVNSFLM 494
           LNSVN +LM
Sbjct: 481 LNSVNEYLM 489

>TPHA0I00300 Chr9 complement(57211..58692) [1482 bp, 493 aa] {ON}
           Anc_8.848 YMR283C
          Length = 493

 Score =  572 bits (1474), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/494 (58%), Positives = 363/494 (73%), Gaps = 13/494 (2%)

Query: 8   SLTKINRDVRKENKSVRNRLQSILLDNKFLQDRVIPVFPYFPLVPNERCGIWYCKPSTYK 67
           S+ +I +D+RKENKS++NR+ SILLD+KFL ++VIP FPY PLVPNERCG+WYCK + + 
Sbjct: 6   SVNQITKDIRKENKSLKNRIHSILLDSKFLDEKVIPFFPY-PLVPNERCGLWYCKRANFT 64

Query: 68  QTSYFKSTDGHVNQWDFSTRRLNFHLLETIRDNKGIIIVDSTRRGKKIPDALSKTVPIWC 127
            TSYFKSTDGH+NQWDFSTRRLNFHL+  I + KGIII+DSTRRGKKIPDALSKTVPIWC
Sbjct: 65  TTSYFKSTDGHINQWDFSTRRLNFHLIPLIEEQKGIIIIDSTRRGKKIPDALSKTVPIWC 124

Query: 128 AVLNTIMLQETEENFDIDK-ALYLPPETVPKSEYDMIKRKIPELVTKLRKLNIIDSKKLN 186
           AVLNT++LQ  E   D  +  L++PP TV KSEY+ IK KIPELV KL KL++ID KKL 
Sbjct: 125 AVLNTMILQHCENEEDKSREVLFVPPATVSKSEYERIKNKIPELVEKLCKLDVIDGKKLY 184

Query: 187 ELFMGKILRPIWVHPGSSLLNHSVDYFTGEIQQHETWETP-EDQNIIPIILCTVSYQAQD 245
           E F G +LRPIW+HPGSS+L    D FTGEI  + +WE P +++ IIPI+LCTVSYQ QD
Sbjct: 185 EQFEGNLLRPIWIHPGSSILQSQFDPFTGEIVSNSSWEEPSKEEKIIPIVLCTVSYQVQD 244

Query: 246 GMDKRYGFTYVQGAADDHELWSFGLDSKMFWAHVEFLCDKNNSDDQLHDYITDLVAKKLK 305
           G+D R GFTYVQGAADDHELWS GL  ++FW ++E L +   S++ L DY+ +++   L 
Sbjct: 245 GVDVRDGFTYVQGAADDHELWSHGLSPQLFWDNIELLNNLELSEEMLEDYVEEIL---LS 301

Query: 306 SQMYIQDKGGLDEIFGKVDKITDEISLGKVVQGLFINEKLKEELKSEYGKVLILSDSVTV 365
             M I +   +D +F  +DKIT+E+ LG +V GL I + L E     Y  V+ILS+S+ +
Sbjct: 302 ESMKITNL-EVDGVFKSIDKITEELYLGNIVDGLEIKQNLMEMFNKSYSLVIILSNSIKL 360

Query: 366 AED-----AGVVEATKSNPFITVYKLQSGDKKSSKALRSILPKIHEEVELAFANRAEEMR 420
           A D     +   + +K+N  I +++LQSG KKSSK LRS LP+I + +    ++     +
Sbjct: 361 ASDEQNEQSANAKTSKTN-IIKLFRLQSGSKKSSKELRSCLPEICDLLTDELSSSGSTKK 419

Query: 421 PMLVCCNTGTDMSIGVILSILCTKYTEEWMLTQELPEVNKIIIRKHLTKLISHLHGRNVN 480
           P+LVCCN G+DMSI VIL  L   YT+EW  T E  E+NKI IRKHLTK+ISHL GRNVN
Sbjct: 420 PILVCCNNGSDMSIAVILVTLSKFYTQEWRRTSEHTEINKITIRKHLTKVISHLGGRNVN 479

Query: 481 PSRATLNSVNSFLM 494
           PSRATLNSVN FLM
Sbjct: 480 PSRATLNSVNDFLM 493

>KNAG0J00220 Chr10 (29017..30516) [1500 bp, 499 aa] {ON} Anc_8.848
           YMR283C
          Length = 499

 Score =  565 bits (1457), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/496 (53%), Positives = 368/496 (74%), Gaps = 10/496 (2%)

Query: 1   MDEEICLSLTKINRDVRKENKSVRNRLQSILLDNKFLQDRVIPVFPYFPLVPNERCGIWY 60
           MD  +  SL +I+++++++++S+RNR+QSILLDN+FL+ RV   FP FPL+PNERCG+WY
Sbjct: 12  MDRNLLTSLPQISKELKRDDRSLRNRVQSILLDNEFLETRVHTAFPDFPLIPNERCGLWY 71

Query: 61  CKPSTYKQTSYFKSTDGHVNQWDFSTRRLNFHLLETIRDNKGIIIVDSTRRGKKIPDALS 120
           C PS + QTSYFKSTDGH NQWDFSTRRLNFHLL T+++  G++IVDSTRRGKKIPDALS
Sbjct: 72  CNPSHFAQTSYFKSTDGHANQWDFSTRRLNFHLLPTLQEAGGVVIVDSTRRGKKIPDALS 131

Query: 121 KTVPIWCAVLNTIMLQETEENFDIDKALYLPPETVPKSEYDMIKRKIPELVTKLRKLNII 180
           KTVP+WCAVLN++ML+   + F+++  L++PPETVP+SE D + +K+P+LV KL+ LN+ 
Sbjct: 132 KTVPLWCAVLNSLMLESVGKKFNVNDVLFVPPETVPESERDQMAKKLPDLVEKLKILNVF 191

Query: 181 DSKKLNELFMGKILRPIWVHPGSSLLNHSVDYFTGEIQQHETWETPEDQNIIPIILCTVS 240
           D  K + +  GK+LRP WV PGSSLL    D FTGE Q    WE   D+NI+PIILCTVS
Sbjct: 192 DGTKTSRMLDGKLLRPFWVFPGSSLLQSCTDIFTGE-QIQNKWEVSRDENIVPIILCTVS 250

Query: 241 YQAQDGMDKRYGFTYVQGAADDHELWSFGLDSKMFWAHVEFLCDKNNSDDQLHDYITDLV 300
           YQAQDG+DKR GFTYVQGAADDHELWS GL++ +FW++++   + +  D +L++ +  +V
Sbjct: 251 YQAQDGIDKRNGFTYVQGAADDHELWSHGLEANIFWSNIDKFKNLSGGDSELYEIVDKMV 310

Query: 301 AKKLKSQMYIQDKGGLDEIFGKVDKITDEISLGKVVQGLFINEKLKEELKSEYGKVLILS 360
            ++  +       G LD+I   +DK+T  +SLG++   + ++ +   +L+  Y  V++LS
Sbjct: 311 TQQNNNMQRSAQAGSLDKIMTGIDKVTSLLSLGEIHDNVTLSSEAIADLEKCYSTVIVLS 370

Query: 361 DSVTVAEDAGVVEATKSNPFITVYKLQSGDKKSSKALRSILPKIHEEVELAFANRAEEMR 420
           ++V + +D     A++ N  + +++L SG KKSSK LR++LP I + +  A     + ++
Sbjct: 371 ETVHLDKD-----ASQDNEMVKIFRLTSGSKKSSKNLRAMLPDISKTINNAII--LQPIK 423

Query: 421 PMLVCCNTGTDMSIGVILSILCTKYTEEWMLTQE--LPEVNKIIIRKHLTKLISHLHGRN 478
           P+L+CCNTG DMSIGV+L++LC  Y E W L  E   P V+KI+IR+HLTKLI+HL+GRN
Sbjct: 424 PLLICCNTGKDMSIGVLLAVLCQNYDEVWDLLPEDVKPSVSKIVIRRHLTKLIAHLNGRN 483

Query: 479 VNPSRATLNSVNSFLM 494
           VNPSRATLNS+NSFLM
Sbjct: 484 VNPSRATLNSINSFLM 499

>NDAI0K00350 Chr11 complement(66993..68507) [1515 bp, 504 aa] {ON}
           Anc_8.848 YMR283C
          Length = 504

 Score =  563 bits (1450), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/505 (57%), Positives = 365/505 (72%), Gaps = 27/505 (5%)

Query: 8   SLTKINRDVRKENKSVRNRLQSILLDNKFLQDRVIPVFPYFPLVPNERCGIWYCKPSTYK 67
           SL++IN+D++KE KS+RNRLQSILLDN+FL D +I  FP +P++PNERCG+WY  PS Y 
Sbjct: 9   SLSQINKDIKKEYKSLRNRLQSILLDNEFLNDEIIATFPNYPIIPNERCGLWYVSPSQYN 68

Query: 68  QTSYFKSTDGHVNQWDFSTRRLNFHLLETIRDNKGIIIVDSTRRGKKIPDALSKTVPIWC 127
           QTSYFKSTDGH NQWDFSTRRLNFHLLETI  +KGI I+DSTRRGKKIPDALSKT+PIWC
Sbjct: 69  QTSYFKSTDGHTNQWDFSTRRLNFHLLETIAKSKGITIIDSTRRGKKIPDALSKTIPIWC 128

Query: 128 AVLNTIMLQETEENFDIDK---ALYLPPETVPKSEYDMIKRKIPELVTKLRKLNIIDSKK 184
           AVLN IML+E +   DI K    L++PP TVPKSEYD I +KIP LV KL KL II++ +
Sbjct: 129 AVLNYIMLRELKGGNDIVKVEDCLFVPPATVPKSEYDCILQKIPTLVEKLDKLEIINANE 188

Query: 185 LNELFMGKILRPIWVHPGSSLLNHSVDYFTGEIQQHETWETPEDQNIIPIILCTVSYQAQ 244
           L   F GK+LRP+W++PGSS+L+ S D FTGE  +   WE PE  NIIPI+LCT+SYQAQ
Sbjct: 189 LISTFHGKLLRPLWIYPGSSILHSSRDVFTGEKTKALAWEAPE--NIIPIVLCTISYQAQ 246

Query: 245 DGMDKRYGFTYVQGAADDHELWSFGLDSKMFWAHVEFLCDKNNSDDQLHDYITDLVAKKL 304
           DG+DKRYGFTYVQGAADDHELWS GL  ++FW+H+ +L +  +SDD+L +Y+  ++  K+
Sbjct: 247 DGVDKRYGFTYVQGAADDHELWSCGLTPELFWSHINYLGNPTHSDDELMEYVRHMIEMKI 306

Query: 305 KSQMYIQDKGGLDEIF-GKVDKITDEISLGKVVQGLFINEKLKEELKSEYGKVLILSDSV 363
           K       +  +D IF   VD IT EISLGK+   + I + +  E K  +  V+ILS++V
Sbjct: 307 KDSAAKTVELTMDAIFPNGVDPITPEISLGKIDNNIKITKSMLHEFKKGFSLVVILSETV 366

Query: 364 TVAEDAGVVEATKSNPFITVYKLQSGDKKSSKALRSILPKIHEEVELAFANRAEEMRPML 423
           T+  D    + + S   + +YKL SG KKSSK LR+ +PKI+E +     N     +P+L
Sbjct: 367 TLNSDDKDEQQSDS---VKIYKLTSGSKKSSKRLRTEIPKIYEVMRENLTNG----KPIL 419

Query: 424 VCCNTGTDMSIGVILSILCTKY------TEEWM-LTQELPEVN-------KIIIRKHLTK 469
           +CCNTGTD+SIG+IL+ILC  Y       + W+ L +E  + N       K IIRK+LT 
Sbjct: 420 ICCNTGTDISIGIILTILCKNYKLDPDNKKAWLRLEKETQDSNVPVKRLDKTIIRKNLTT 479

Query: 470 LISHLHGRNVNPSRATLNSVNSFLM 494
           LISHL GRNVNPSRATLNSVN +LM
Sbjct: 480 LISHLEGRNVNPSRATLNSVNDYLM 504

>NCAS0C00350 Chr3 (51842..53302) [1461 bp, 486 aa] {ON} Anc_8.848
           YMR283C
          Length = 486

 Score =  557 bits (1435), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/503 (55%), Positives = 364/503 (72%), Gaps = 26/503 (5%)

Query: 1   MDEEICLSLTKINRDVRKENKSVRNRLQSILLDNKFLQDRVIPVFPYFPLVPNERCGIWY 60
           MD  +  SL +IN+D+RKENKS+RNRLQSILLDNKFL D V+P FP FP++PNERCG+WY
Sbjct: 1   MDPLLLESLGQINKDIRKENKSIRNRLQSILLDNKFLNDEVLPCFPDFPIIPNERCGLWY 60

Query: 61  CKPSTYKQTSYFKSTDGHVNQWDFSTRRLNFHLLETIRDNKGIIIVDSTRRGKKIPDALS 120
             P  +KQTSYFKSTDGH NQWDFSTRRLNFHL  T+R + GIIIVDSTRRGKKIPDALS
Sbjct: 61  VPPEDFKQTSYFKSTDGHTNQWDFSTRRLNFHLFPTLRSSGGIIIVDSTRRGKKIPDALS 120

Query: 121 KTVPIWCAVLNTIML--QETEENFDIDKALYLPPETVPKSEYDMIKRKIPELVTKLRKLN 178
           KT+PIWCAVLN IML  Q   ++ DI   L+ PPET+ K+EYDMI R+IP+LV KL KL+
Sbjct: 121 KTIPIWCAVLNYIMLLSQRGSDDIDITDVLFTPPETISKTEYDMIARRIPDLVGKLVKLD 180

Query: 179 IIDSKKLNELFMGKILRPIWVHPGSSLLNHSVDYFTGEIQQHETWETPEDQNIIPIILCT 238
           I+D  +L  L  GK+LRP WV+PGSSLL  S D FTGEI   ++W  P+  NIIPIILCT
Sbjct: 181 IVDGNELFILLQGKLLRPFWVYPGSSLLQSSRDVFTGEI-TGDSWNVPQHANIIPIILCT 239

Query: 239 VSYQAQDGMDKRYGFTYVQGAADDHELWSFGLDSKMFWAHVEFLCDKNNSDDQLHDYITD 298
           +SY+AQDG DKR+GFTYVQGAADDHELWS GL   +FW+H+ F  + N++++Q++ ++  
Sbjct: 240 ISYRAQDGHDKRHGFTYVQGAADDHELWSEGLTPTLFWSHINFFRNMNHTEEQINQFVET 299

Query: 299 LVAKKLKSQMYIQDKGG----LDEIFGKVDKITDEISLGKVVQGLFINEKLKEELKSEYG 354
           LV +        QD  G    +++ F  +D +T ++ LGK+   + I + L+E+L   + 
Sbjct: 300 LVQE--------QDDAGEQSDINDAFDYIDNVTPQLELGKIKDNVVIGKVLREKLSDRFA 351

Query: 355 KVLILSDSVTV--AEDAGVVEATKSNPFITVYKLQSGDKKSSKALRSILPKIHEEVELAF 412
             +ILS++V +   ++  +  +T       ++KLQSG KKSSK LR+ + +I   VE   
Sbjct: 352 LSIILSENVELDPVDNENLPISTH------IFKLQSGSKKSSKLLRNKIEEIIGLVESQM 405

Query: 413 ANRAEEMRPMLVCCNTGTDMSIGVILSILCTKYTEEWMLTQ-ELPEVNKIIIRKHLTKLI 471
            N     +P+L+CCNTGTDMSIG++L++LC  Y+E W+L + E   ++KI+IRK LT+LI
Sbjct: 406 NNALN--KPILICCNTGTDMSIGILLALLCRNYSERWVLGEVEAKRLDKIMIRKQLTRLI 463

Query: 472 SHLHGRNVNPSRATLNSVNSFLM 494
           SHL GR +N SRATLNSVN++LM
Sbjct: 464 SHLEGRTINTSRATLNSVNNYLM 486

>TDEL0A07970 Chr1 (1391841..1393310) [1470 bp, 489 aa] {ON}
           Anc_8.848 YMR283C
          Length = 489

 Score =  535 bits (1379), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/494 (53%), Positives = 356/494 (72%), Gaps = 10/494 (2%)

Query: 1   MDEEICLSLTKINRDVRKENKSVRNRLQSILLDNKFLQDRVIPVFPYFPLVPNERCGIWY 60
           MD     SL  IN+D++KE KS+RNRLQSILLD  FL   V+P FP +PLVPNERCG+WY
Sbjct: 6   MDNNFIDSLRCINKDIKKEYKSLRNRLQSILLDYTFLCTEVLPCFPEYPLVPNERCGLWY 65

Query: 61  CKPSTYKQTSYFKSTDGHVNQWDFSTRRLNFHLLETIRDNKGIIIVDSTRRGKKIPDALS 120
           C P  + QTSYFKSTDGH NQWDFS+RRLNFH++ TI  + GIIIVDSTRRGKK+PDALS
Sbjct: 66  CNPKDFTQTSYFKSTDGHTNQWDFSSRRLNFHIIPTIAKSNGIIIVDSTRRGKKVPDALS 125

Query: 121 KTVPIWCAVLNTIMLQETEENFDIDKALYLPPETVPKSEYDMIKRKIPELVTKLRKLNII 180
           KT+PIWCAVLN +ML E++      + LY+PPETV +SE+  IK +IPELV KL+ L +I
Sbjct: 126 KTIPIWCAVLNHLML-ESQGGSVKQETLYVPPETVSESEFYSIKSRIPELVEKLKSLEVI 184

Query: 181 DSKKLNELFMGKILRPIWVHPGSSLLNHSVDYFTGEIQQHETWETPEDQNIIPIILCTVS 240
           + K+L++   GK+LRP W++PGSS+L  + D FTGE+   + W  P D +IIPIILCTVS
Sbjct: 185 NGKELHKQLGGKLLRPFWIYPGSSILQSTTDIFTGEVTS-DKW-IPVDNSIIPIILCTVS 242

Query: 241 YQAQDGMDKRYGFTYVQGAADDHELWSFGLDSKMFWAHVEFLCDKNNSDDQLHDYITDLV 300
           YQAQDG+DKR GFTYVQGAADDHELWS GL++K+FW++++ L ++ +S+++L  +++ L 
Sbjct: 243 YQAQDGVDKRRGFTYVQGAADDHELWSHGLNAKIFWSNIDILGNQESSEEELERFVSQLS 302

Query: 301 AKKLKSQMYIQDKGGLDEIFGKVDKITDEISLGKVVQGLFINEKLKEELKSEYGKVLILS 360
            +       IQ      + F ++D +T E+SLG V+  L  N KL  E++  +  V++LS
Sbjct: 303 LRGCDLSKEIQ----FSDAFPQIDLVTPELSLGLVIDNLEFNPKLIGEIRQAHSLVIVLS 358

Query: 361 DSVTVAEDAGVVEATKSNPFITVYKLQSGDKKSSKALRSILPKIHEEVELAFANRAEEMR 420
            SV   +   V E   ++ FI+++KLQSG K SS+ L++ L KI   +E    +  ++ +
Sbjct: 359 QSVNFPQK--VAEMENASEFISIHKLQSGSKVSSRNLKTELLKIVPLIEKHILDLDKQRK 416

Query: 421 PMLVCCNTGTDMSIGVILSILCTKYTEEWMLTQELPEVNKIIIRKHLTKLISHLHGRNVN 480
           P+L+CCN+GTDMSIG++L +LC  Y  +W L      V+KI+++KHL KLISHL GRNVN
Sbjct: 417 PVLICCNSGTDMSIGLLLVVLCRNYNMDWQLNTPT-SVSKIVVKKHLAKLISHLKGRNVN 475

Query: 481 PSRATLNSVNSFLM 494
           P RATLNSVNS+LM
Sbjct: 476 PPRATLNSVNSYLM 489

>SAKL0D01276g Chr4 (96411..97919) [1509 bp, 502 aa] {ON} similar to
           uniprot|P23796 Saccharomyces cerevisiae YMR283C RIT1
           Modifies initiator methionine tRNA to distinguish it
           from elongator methionine tRNA Initiator methionine tRNA
           2'-O-ribosyl phosphate transferase
          Length = 502

 Score =  533 bits (1372), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/496 (54%), Positives = 354/496 (71%), Gaps = 21/496 (4%)

Query: 1   MDEEICLSLTKINRDVRKENKSVRNRLQSILLDNKFLQDRVIPVFPYFPLVPNERCGIWY 60
           MD E   SL  I ++++KE KS+RNRLQSI+ D++FL   VIP FP +PLVPNERCG+WY
Sbjct: 26  MDTETLKSLNLIKKEIKKEYKSLRNRLQSIIWDHQFLTTYVIPTFPDYPLVPNERCGLWY 85

Query: 61  CKPSTYKQTSYFKSTDGHVNQWDFSTRRLNFHLLETIRDNKGIIIVDSTRRGKKIPDALS 120
           C P ++ Q SYFKSTDGH+NQWDFSTRRLNFHLL +I  + GI+I+DSTRRGKKIPDALS
Sbjct: 86  CNPESFSQMSYFKSTDGHINQWDFSTRRLNFHLLPSIAQHGGIVIIDSTRRGKKIPDALS 145

Query: 121 KTVPIWCAVLNTIMLQETEENFDIDKALYLPPETVPKSEYDMIKRKIPELVTKLRKLNII 180
           KT+PIWCAV+NT++L+ +  +   ++ L+ PP TVP+SEYD IK +IP LV KL+ L I+
Sbjct: 146 KTIPIWCAVINTLILEASNRS---EEVLFCPPGTVPQSEYDRIKNRIPSLVEKLKNLGIV 202

Query: 181 DSKKLNELFMGKILRPIWVHPGSSLLNHSVDYFTGEIQQHETWETPEDQNIIPIILCTVS 240
              +L + F GKILRP+WV+PGSSL + S D FTG+  + + WE PEDQ+ +P+ILCT S
Sbjct: 203 SGDELLKQFGGKILRPLWVYPGSSLFSSSTDIFTGKQTRSQKWEKPEDQDFLPVILCTAS 262

Query: 241 YQAQDGMDKRYGFTYVQGAADDHELWSFGLDSKMFWAHVEFLCDKNNSDDQLHDYITDLV 300
           YQ QDG+DKRYGFTYVQGAADDHELW+ GL   MFW +  FL D+  S+ +L +Y+    
Sbjct: 263 YQCQDGVDKRYGFTYVQGAADDHELWAEGLTPDMFWDNKNFLGDETKSEQELIEYVN--- 319

Query: 301 AKKLKSQMYIQDKGG--LDEIFGKVDKITDEISLGKVVQGLFINEKLKEELKSEYGKVLI 358
            +K ++    ++  G  L++ F  VD IT E+ LG VV GL +NEKL  +L S Y   ++
Sbjct: 320 KQKREATERTKEASGNDLNQCFS-VDAITKELHLGTVVDGLELNEKLLSQLDSRYALTVV 378

Query: 359 LSDSVTVAEDAGVVEATKSNPFITVYKLQSGDKKSSKALRSILPKIHEEVELAFANRAEE 418
           LS+SV +A       + + NP   ++ L SG+KKSSK LRS L +I   ++ +  +    
Sbjct: 379 LSESVKIA-------SIQENPNTKIFPLTSGNKKSSKELRSKLIEICPLIQASLNSPL-- 429

Query: 419 MRPMLVCCNTGTDMSIGVILSILCTKYTEEWMLTQELPEVNKIIIRKHLTKLISHLHGRN 478
             P+L+CCNTG DMS+GV+L+ LC  Y E+W +       NK IIRKHLT+LISHL GRN
Sbjct: 430 --PILICCNTGKDMSVGVLLATLCQNYDEDWCIGSP-NSFNKTIIRKHLTRLISHLKGRN 486

Query: 479 VNPSRATLNSVNSFLM 494
           VNPSRATLNSVN++LM
Sbjct: 487 VNPSRATLNSVNAYLM 502

>ZYRO0G14344g Chr7 complement(1148368..1149786) [1419 bp, 472 aa]
           {ON} similar to uniprot|P23796 Saccharomyces cerevisiae
           YMR283C RIT1 Modifies initiator methionine tRNA to
           distinguish it from elongator methionine tRNA Initiator
           methionine tRNA 2'-O-ribosyl phosphate transferase
          Length = 472

 Score =  514 bits (1325), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 258/496 (52%), Positives = 342/496 (68%), Gaps = 26/496 (5%)

Query: 1   MDEEICLSLTKINRDVRKENKSVRNRLQSILLDNKFLQDRVIPVFPYFPLVPNERCGIWY 60
           MD ++  SL +INRD++KE  S+RNR+QSIL DN F+  RVIP FP +PL+PNERCG+WY
Sbjct: 1   MDPDLAFSLNQINRDIKKEYTSLRNRIQSILFDNAFIAQRVIPRFPNYPLIPNERCGLWY 60

Query: 61  CKPSTYKQTSYFKSTDGHVNQWDFSTRRLNFHLLETIRDNKGIIIVDSTRRGKKIPDALS 120
           C P  + QTSYFKSTDGH NQWDFSTRRLN HLL  +++  GIIIVDSTRRGK +PDALS
Sbjct: 61  CDPKDFDQTSYFKSTDGHTNQWDFSTRRLNLHLLPILQEKNGIIIVDSTRRGKLMPDALS 120

Query: 121 KTVPIWCAVLNTIMLQETEENFDIDKALYLPPETVPKSEYDMIKRKIPELVTKLRKLNII 180
           KT+PIWCAVLN++M  +  E       L+ PP+ V +SE+D IK +IP LV +L KL+I+
Sbjct: 121 KTIPIWCAVLNSLMQPDKSE------VLFTPPKCVSQSEHDSIKTRIPSLVDRLEKLDIL 174

Query: 181 DSKKLNELFMGKILRPIWVHPGSSLLNHSVDYFTGEIQQHETWETPEDQNIIPIILCTVS 240
           D++ L   F GKILRP WV+PGS +L  S D FTGEI + + WE   ++ IIPIILCT S
Sbjct: 175 DAQDLRNKFQGKILRPFWVYPGSDMLRSSTDPFTGEIIEIQ-WEPGPNEQIIPIILCTAS 233

Query: 241 YQAQDGMDKRYGFTYVQGAADDHELWSFGLDSKMFWAHVEFLCDKNNSDDQLHDYITDLV 300
           Y+AQDG+DKR+GFTYVQGAADDHELWS GLD K+ W +  +  D + +D +L  ++  L+
Sbjct: 234 YRAQDGVDKRHGFTYVQGAADDHELWSCGLDPKLLWNNWHYFHDLDRNDKELESHVKTLI 293

Query: 301 --AKKLKSQMYIQDKGGLDEIFGKVDKITDEISLGKVVQGLFINEKLKEELKSEYGKVLI 358
             A+    + ++ D         ++D IT E+SLGK+     I   +  EL S++  V+I
Sbjct: 294 ELAETTDHRNHLAD-------IVEMDPITKELSLGKLKDHTAITPNIARELDSQFSLVII 346

Query: 359 LSDSVTVAEDAGVVEATKSNPFITVYKLQSGDKKSSKALRSILPKIHEEVELAFANRAEE 418
           LS SVT++         K   FI  Y LQSG K+SSK LR+ L +I   V         +
Sbjct: 347 LSQSVTLS---------KPFDFIKTYNLQSGSKRSSKDLRAALIEIDHIVSAHLNKDVVK 397

Query: 419 MRPMLVCCNTGTDMSIGVILSILCTKYTEEWMLTQELPEVNKIIIRKHLTKLISHLHGRN 478
            +P++VCCN+GTD+S+GVIL ILC  Y+++W+L +    VNK +IR+HL ++I+ +  RN
Sbjct: 398 RKPIMVCCNSGTDISVGVILMILCKYYSQDWLLGKP-DSVNKFVIRRHLVQIINKIKRRN 456

Query: 479 VNPSRATLNSVNSFLM 494
           VNPSRATLNS+NSFLM
Sbjct: 457 VNPSRATLNSINSFLM 472

>KAFR0B03980 Chr2 complement(832133..833584) [1452 bp, 483 aa] {ON}
           Anc_8.848 YMR283C
          Length = 483

 Score =  514 bits (1323), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 264/490 (53%), Positives = 354/490 (72%), Gaps = 12/490 (2%)

Query: 8   SLTKINRDVRKENKSVRNRLQSILLDNKFLQDRVIPVFPYFPLVPNERCGIWYCKPSTYK 67
           SL+ I +D++ E +S++NRLQSI+LDN FL++ V+P FP +P++PNERCG+WYC P  ++
Sbjct: 3   SLSHIKKDIKNEYRSLKNRLQSIILDNSFLENEVVPCFPNYPIIPNERCGLWYCDPKHFE 62

Query: 68  QTSYFKSTDGHVNQWDFSTRRLNFHLLETIRDNKGIIIVDSTRRGKKIPDALSKTVPIWC 127
           QTSYFKSTDGH+NQWDFSTRRLNFHLL  +  + GIIIVDSTRRGKKIPDALSKT+PIWC
Sbjct: 63  QTSYFKSTDGHINQWDFSTRRLNFHLLPILAKSNGIIIVDSTRRGKKIPDALSKTIPIWC 122

Query: 128 AVLNTIMLQE-TEENFDIDKALYLPPETVPKSEYDMIKRKIPELVTKLRKLNIIDSKKLN 186
           AVLN ++L+  + E  D +K L++PP TV  SEY  I  KI ELV KL+ L ++  K+L 
Sbjct: 123 AVLNCLILEHASNEPIDYEKVLFVPPATVSNSEYHRILEKIEELVWKLKALEVLKPKELY 182

Query: 187 ELFMGKILRPIWVHPGSSLLNHSVDYFTGEIQQHETWETPEDQNIIPIILCTVSYQAQDG 246
            +  GK++RP WV+PGSSLL+  VD FTGE    E W  PE++NIIPIILCTVSYQAQDG
Sbjct: 183 NMTNGKLIRPFWVYPGSSLLHTIVDPFTGE-PTGERWSVPENENIIPIILCTVSYQAQDG 241

Query: 247 MDKRYGFTYVQGAADDHELWSFGLDSKMFWAHVEFLCDKNNSDDQLHDYITDLVAKKLKS 306
           +DKR GF YVQGAADDHELWS GL+ K FW ++++L D   +D  L +++  L    L+ 
Sbjct: 242 VDKRRGFIYVQGAADDHELWSCGLEPKTFWENIDYLNDIGKTDAVLKEFVDTLT---LEE 298

Query: 307 QMYIQDKGGLDEIFGKVDKITDEISLGKVVQGLFINEKLKEELKSEYGKVLILSDSVTVA 366
               +    + +IF  ++++T EISLGK++    I+ KL  EL  ++  V+ILS+++ + 
Sbjct: 299 NHEKKASSSIIDIFESLNRVTPEISLGKIIDNCVIDSKLGGELSGKFSLVIILSETIEIT 358

Query: 367 EDAGVVEATKSNPFITVYKLQSGDKKSSKALRSILPKIHEEVELAFANRAE-EMRPMLVC 425
           +   + EAT     I ++KLQSG KKSSK+LR  LP+I + +   F + +    +P+L+C
Sbjct: 359 K---LEEATTK--IIKLFKLQSGSKKSSKSLRLQLPEIFDTINPYFQDASNLAKKPILIC 413

Query: 426 CNTGTDMSIGVILSILCTKYTEEWML-TQELPEVNKIIIRKHLTKLISHLHGRNVNPSRA 484
           CN+G DMS+ VIL+IL  KY+E W L T +   ++K +IRKHL KLIS L GRNVNPSRA
Sbjct: 414 CNSGNDMSVAVILTILSKKYSEGWQLETSDDLLISKTVIRKHLAKLISSLQGRNVNPSRA 473

Query: 485 TLNSVNSFLM 494
           TLNS+NS+LM
Sbjct: 474 TLNSINSYLM 483

>Kwal_27.10219 s27 (246213..247715) [1503 bp, 500 aa] {ON} YMR283C
           (RIT1) - Initiator methionine tRNA 2'-O-ribosyl
           phosphate transferase [contig 39] FULL
          Length = 500

 Score =  503 bits (1295), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 250/495 (50%), Positives = 347/495 (70%), Gaps = 22/495 (4%)

Query: 1   MDEEICLSLTKINRDVRKENKSVRNRLQSILLDNKFLQDRVIPVFPYFPLVPNERCGIWY 60
           MD     +L  +N++++KENK++RNRLQSIL D++FL+++V+ +FP +PL+PNERCG+WY
Sbjct: 27  MDLTFDQTLNSLNKEIKKENKALRNRLQSILFDHRFLEEQVLALFPNYPLIPNERCGLWY 86

Query: 61  CKPSTYKQTSYFKSTDGHVNQWDFSTRRLNFHLLETIRDNKGIIIVDSTRRGKKIPDALS 120
           C P  Y QTSYFKSTDGH NQWDFS RRLN HLL TI    GI+IVDSTRRGK++PDALS
Sbjct: 87  CDPERYSQTSYFKSTDGHSNQWDFSLRRLNVHLLPTITQKGGIVIVDSTRRGKRMPDALS 146

Query: 121 KTVPIWCAVLNTIMLQETEENFDIDKALYLPPETVPKSEYDMIKRKIPELVTKLRKLNII 180
           KTVPIWCAVLN+IML+  +     ++ L+ PP TV  SE++ IK +IP LV + ++L + 
Sbjct: 147 KTVPIWCAVLNSIMLEGRQSE---EEVLFCPPNTVSGSEFERIKSRIPSLVARFKELGLF 203

Query: 181 DSKKLNELFMGKILRPIWVHPGSSLLNHSVDYFTGEIQQHETWETPEDQNIIPIILCTVS 240
            S +L ++  GKILRPIWV+PG+SLLN   D FTG+I    TWE  +++N +P++LCTVS
Sbjct: 204 TSDELFKILDGKILRPIWVYPGASLLNSHRDPFTGDIVT-PTWEA-QNENFMPVVLCTVS 261

Query: 241 YQAQDGMDKRYGFTYVQGAADDHELWSFGLDSKMFWAHVEFLCDKNNSDDQLHDYITDLV 300
           YQ QDG+DKR+GFTYVQGAADDHELW+ GL +++FW H+E   D   SD +L  Y+ +LV
Sbjct: 262 YQCQDGVDKRHGFTYVQGAADDHELWAEGLTAELFWQHIEIFKDTALSDQELSTYVNNLV 321

Query: 301 AKKLKSQMYIQDKGGLDEIFGKVDKITDEISLGKVVQGLFINEKLKEELKSEYGKVLILS 360
                +   +     LD++    +++T E+ LG+V + + +++ L ++LK +Y  V++LS
Sbjct: 322 TSG-DANNKLTKSLRLDDMLN-ANELTRELHLGQVAENIELDKNLVDQLKLKYSLVVLLS 379

Query: 361 DSVTVAEDAGVVEATKSNPFITVYKLQSGDKKSSKALRSILPKIHEEVELAFANRAEEMR 420
            S++V E+A           I ++KLQSG KKSS+ALR+ L +I   +E    N      
Sbjct: 380 TSISVYEEA---------ENIRIFKLQSGSKKSSRALRAALTQICPLIEANLQNSL---- 426

Query: 421 PMLVCCNTGTDMSIGVILSILCTKY-TEEWMLTQELPEVNKIIIRKHLTKLISHLHGRNV 479
           P+L+CCN G DMS+ V+LS+LC  +  E W L Q  P V+K II+KHL K+I+ L GRN+
Sbjct: 427 PVLICCNNGKDMSVCVVLSVLCRNFNVESWQLEQR-PSVHKSIIKKHLAKMITKLDGRNL 485

Query: 480 NPSRATLNSVNSFLM 494
           NP R +LNSVN +LM
Sbjct: 486 NPPRVSLNSVNDYLM 500

>KLTH0C03696g Chr3 (320129..321553) [1425 bp, 474 aa] {ON} similar
           to uniprot|P23796 Saccharomyces cerevisiae YMR283C RIT1
           Modifies initiator methionine tRNA to distinguish it
           from elongator methionine tRNA Initiator methionine tRNA
           2'-O-ribosyl phosphate transferase
          Length = 474

 Score =  498 bits (1282), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 249/484 (51%), Positives = 341/484 (70%), Gaps = 22/484 (4%)

Query: 12  INRDVRKENKSVRNRLQSILLDNKFLQDRVIPVFPYFPLVPNERCGIWYCKPSTYKQTSY 71
           +NR+++KE +S+RNRLQSI+ D+KFL ++V  VFP +P++PNERCG+WYC P  Y QTSY
Sbjct: 12  LNREIKKEYRSLRNRLQSIVFDHKFLDEQVKAVFPDYPIIPNERCGVWYCDPKDYLQTSY 71

Query: 72  FKSTDGHVNQWDFSTRRLNFHLLETIRDNKGIIIVDSTRRGKKIPDALSKTVPIWCAVLN 131
           FKSTDGH NQWDFS RRLNFHLL  +  + GI++VDSTRRGK++PDALSKTVPIWCAVLN
Sbjct: 72  FKSTDGHTNQWDFSLRRLNFHLLPALAASGGIVVVDSTRRGKRMPDALSKTVPIWCAVLN 131

Query: 132 TIMLQETEENFDIDKALYLPPETVPKSEYDMIKRKIPELVTKLRKLNIIDSKKLNELFMG 191
           +++L+      ++   L+ PP+TV + E++ IK +IP+LV K +K+NI+    ++ LF G
Sbjct: 132 SLLLEYQGLEGEV---LFCPPQTVSEFEFERIKSRIPDLVAKFKKMNILTGADIDRLFKG 188

Query: 192 KILRPIWVHPGSSLLNHSVDYFTGEIQQHETWETPEDQNIIPIILCTVSYQAQDGMDKRY 251
           KILRP+WV PG+SLL+   D FTGE+   + W T E +N IP++LCTVSYQ QDG+DKR+
Sbjct: 189 KILRPLWVFPGASLLSSQRDPFTGEVLS-QKWHTAELENFIPVVLCTVSYQCQDGVDKRH 247

Query: 252 GFTYVQGAADDHELWSFGLDSKMFWAHVEFLCDKNNSDDQLHDYITDLVAKKLKSQMYIQ 311
           GFTYVQGAADDHELW+ GL +++FW H+  L + N SD +L  ++ D +  +  +    +
Sbjct: 248 GFTYVQGAADDHELWAQGLTAELFWKHISILSNINLSDQELESFVEDKIHPQEPNSA--E 305

Query: 312 DKGGLDEIFGKVDKITDEISLGKVVQGLFINEKLKEELKSEYGKVLILSDSVTVAEDAGV 371
           +   LD+I    D +T+E+ LGK+   + + E L +EL+ +Y  V+ILS++VT++ED   
Sbjct: 306 NGLSLDQIL-YTDILTEELHLGKISSNVHLGEHLVKELRLKYSLVIILSNTVTLSEDEAA 364

Query: 372 VEATKSNPFITVYKLQSGDKKSSKALRSILPKIHEEVELAFANRAEEMRPMLVCCNTGTD 431
                    I ++KLQS  KKSSKALR+ L KI    E    N      PMLVCCNTG D
Sbjct: 365 ---------IKIFKLQSECKKSSKALRTELIKICPLAEAYLPNSL----PMLVCCNTGKD 411

Query: 432 MSIGVILSILCTKY-TEEWMLTQELPEVNKIIIRKHLTKLISHLHGRNVNPSRATLNSVN 490
           MS+ V L+ILC  Y    W L  +   ++KI I+KHL+K+I+ L GRNVNP RA+LNSVN
Sbjct: 412 MSVCVSLAILCRNYNVGSWDLNVQ-QSIHKIDIKKHLSKIITKLEGRNVNPPRASLNSVN 470

Query: 491 SFLM 494
           ++LM
Sbjct: 471 AYLM 474

>Ecym_4623 Chr4 (1219438..1220880) [1443 bp, 480 aa] {ON} similar to
           Ashbya gossypii AFR451C
          Length = 480

 Score =  493 bits (1269), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 247/494 (50%), Positives = 340/494 (68%), Gaps = 17/494 (3%)

Query: 2   DEEICLSLTKINRDVRKENKSVRNRLQSILLDNKFLQDRVIPVFPYFPLVPNERCGIWYC 61
           DE    +L +I +++R++  S+RNRLQS+  D+KF+ + V+P+FP +PLVPNERCG+WYC
Sbjct: 3   DESGLDTLKQIKKEIRRDCTSLRNRLQSVFYDSKFIANEVLPMFPNYPLVPNERCGLWYC 62

Query: 62  KPSTYKQTSYFKSTDGHVNQWDFSTRRLNFHLLETIRDNKGIIIVDSTRRGKKIPDALSK 121
            P  Y+QT YFKSTDGH NQWDFSTRRLNFH+L  + +  GIIIVDSTRRGKK+PDALSK
Sbjct: 63  NPGKYEQTCYFKSTDGHTNQWDFSTRRLNFHILSKMAEAGGIIIVDSTRRGKKMPDALSK 122

Query: 122 TVPIWCAVLNTIMLQETEENFDIDKALYLPPETVPKSEYDMIKRKIPELVTKLRKLNIID 181
           T+PIWCAVLN +ML    +   I  +L+ PP TV K E+D I  K+P+LV KL+KLNII 
Sbjct: 123 TIPIWCAVLNNLMLDYKGKEDSI-PSLFCPPGTVSKLEFDGIHSKVPDLVEKLKKLNIIS 181

Query: 182 SKKLNELFMGKILRPIWVHPGSSLLNHSVDYFTGEIQQHETWETPEDQNIIPIILCTVSY 241
            ++L  +F GK+LRP WV+PGS LL+ S D FTGE+  +  W++  +QN IP+ILCT SY
Sbjct: 182 GEELYNMFQGKVLRPFWVYPGSPLLDTSRDIFTGEVLGN-VWQS--EQNSIPVILCTASY 238

Query: 242 QAQDGMDKRYGFTYVQGAADDHELWSFGLDSKMFWAHVEFLCDKNNSDDQLHDYITDL-V 300
           Q QDG DK +GFTYVQGAADDHELW+ GL+ ++FW ++EFL D + S+ +L D++  +  
Sbjct: 239 QCQDGEDKHHGFTYVQGAADDHELWANGLNPEIFWKNIEFLGDPDKSEFELEDFVQRIGR 298

Query: 301 AKKLKSQMYIQDKGGLDEIFGKVDKITDEISLGKVVQGLFINEKLKEELKSEYGKVLILS 360
            +KL +Q   Q        F KVD+IT  + LG V +G+ + E +++ELKS+Y   +I S
Sbjct: 299 TEKLTAQSNKQSDRESSSSFIKVDEITKNLYLGTVAEGIALTENIEKELKSKYSLCIICS 358

Query: 361 DSVTVAEDAGVVEATKSNPFITVYKLQSGDKKSSKALRSILPKIHEEVELAFANRAEEMR 420
            SVT   D            I VY + +  KKSS+ LR  L +I   ++    ++     
Sbjct: 359 QSVTAKADCNCER-------IKVYPINNNSKKSSRDLRVALIEISGLIKQHITDQL---- 407

Query: 421 PMLVCCNTGTDMSIGVILSILCTKYTEEWMLTQELPEVNKIIIRKHLTKLISHLHGRNVN 480
           P+L+CCNTG D+SIG++L+ LC  Y  +W L +E   VNK I++KHL ++I+ L G N+N
Sbjct: 408 PILICCNTGKDISIGIMLTALCQHYDLQWHL-EEQETVNKTIVKKHLARIITKLSGININ 466

Query: 481 PSRATLNSVNSFLM 494
           PSR+TL +VN+FL+
Sbjct: 467 PSRSTLKNVNAFLL 480

>KLLA0D01386g Chr4 (118965..120434) [1470 bp, 489 aa] {ON} similar
           to uniprot|P23796 Saccharomyces cerevisiae YMR283C RIT1
           Modifies initiator methionine tRNA to distinguish it
           from elongator methionine tRNA Initiator methionine tRNA
           2'-O-ribosyl phosphate transferase
          Length = 489

 Score =  488 bits (1257), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 255/502 (50%), Positives = 348/502 (69%), Gaps = 21/502 (4%)

Query: 1   MDEEICLSLTKINRDVRKENKSVRNRLQSILLDNKFLQDRVIPVFPYFPLVPNERCGIWY 60
           MD+E    + +I++++RKE+KS++NRLQSI+ DN FL+++V P F Y P+VPNERCG+WY
Sbjct: 1   MDKETLREIKEISKELRKEDKSLKNRLQSIIFDNNFLKEQVFPTFQY-PVVPNERCGLWY 59

Query: 61  CKPSTYKQTSYFKSTDGHVNQWDFSTRRLNFHLLETIRDNKGIIIVDSTRRGKKIPDALS 120
           C P  Y  TSYFKSTDGH+NQWDFSTRRLNFHLL  + +N G++I+DSTRRGKKIPDALS
Sbjct: 60  CDPKIYDTTSYFKSTDGHMNQWDFSTRRLNFHLLPLLGENGGLVILDSTRRGKKIPDALS 119

Query: 121 KTVPIWCAVLNTIMLQETEENFDIDKA-LYLPPETVPKSEYDMIKRKIPELVTKLRKLNI 179
           KTVPIWCAVLN +ML+   + +  ++  L++PP TVP+SE+D +  K+PELV KL+KL+I
Sbjct: 120 KTVPIWCAVLNYLMLEADGKQWPFEEEILFVPPSTVPESEFDRMFAKLPELVQKLKKLDI 179

Query: 180 IDSKKLNELFM-----GKILRPIWVHPGSSLLNHSVDYFTGEIQQHETWETPEDQNIIPI 234
           ID KKL +         K+LRPIWV+PGSSLL    D F+GE+ ++  WE P   NIIP+
Sbjct: 180 IDVKKLRKSLQIEEGHDKLLRPIWVYPGSSLLQLKHDLFSGEVIENTHWEPP--SNIIPV 237

Query: 235 ILCTVSYQAQDGMDKRYGFTYVQGAADDHELWSFGLDSKMFWAHVEFLCDKNNSDDQLHD 294
           ILCTVSYQ QDG DKRYGFTYVQGAADDHELW+  L  ++FW +++ L D + SD +L D
Sbjct: 238 ILCTVSYQCQDGTDKRYGFTYVQGAADDHELWAENLTPQLFWENIDELGDISKSDAELKD 297

Query: 295 YITDLVAKKLKSQMYIQDKGGLDEIFGKVDKITDEISLGKVVQGLFINEKLKEELKSEYG 354
               ++ +  K Q  +   G + ++  ++D IT  + LGK+     I  K  + L  +Y 
Sbjct: 298 SYNAVILRA-KVQNSLDISGDISKML-EIDTITARLHLGKITSQFRITPKTVKYLNQKYS 355

Query: 355 KVLILSDSVTVAEDAGVVEATKSNPFITVYKLQSGDKKSSKALRSILPKIHEEVE--LAF 412
            V++  ++++V E   + E  +S   I ++ L SG KKSS+ LRS L KI+  +E  L+ 
Sbjct: 356 AVVLCHEAISVTE---ITELPRS---IHIFPLPSGSKKSSRELRSHLIKINALIEEQLSR 409

Query: 413 ANRAEEMRPMLVCCNTGTDMSIGVILSILCTKYTEEWMLTQELPEVNKIIIRKHLTKLIS 472
            + A  + P+L+ C++G D+S+ ++L  LC  Y  +W L Q    VNK II+KHL K+I 
Sbjct: 410 PDTAANL-PILIACDSGKDISVSILLVALCKYYNLDWEL-QPQDSVNKTIIKKHLAKIIE 467

Query: 473 HLHGRNVNPSRATLNSVNSFLM 494
            L GRNVNPSRA+LNSVNSFLM
Sbjct: 468 SLQGRNVNPSRASLNSVNSFLM 489

>AFR451C Chr6 complement(1248648..1249874) [1227 bp, 408 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR283C
           (RIT1)
          Length = 408

 Score =  379 bits (972), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 197/426 (46%), Positives = 277/426 (65%), Gaps = 22/426 (5%)

Query: 69  TSYFKSTDGHVNQWDFSTRRLNFHLLETIRDNKGIIIVDSTRRGKKIPDALSKTVPIWCA 128
           T YFKSTDGHVN WDFS RRLNFHLL  + +  G IIVDSTRRGKKIPDALSKT+PIWCA
Sbjct: 5   TCYFKSTDGHVNGWDFSVRRLNFHLLPLLAERSGAIIVDSTRRGKKIPDALSKTIPIWCA 64

Query: 129 VLNTIMLQETEENFDIDKALYLPPETVPKSEYDMIKRKIPELVTKLRKLNIIDSKKLNEL 188
           VLNT++L+ TE + ++   L+ PP TV + EY+ I+ K+PELV KL++++ I   +L  L
Sbjct: 65  VLNTLILEHTEGSGEV---LFCPPGTVSQLEYNRIQAKLPELVQKLKRVDAISGAELCSL 121

Query: 189 FMGKILRPIWVHPGSSLLNHSVDYFTGEIQQHETWETPEDQNIIPIILCTVSYQAQDGMD 248
             G++LRP WV+PG+++L  + D FTGE  Q E W+ P    +IP+ILCT S Q QDG+D
Sbjct: 122 LGGRLLRPFWVYPGAAMLGTTRDLFTGESLQ-EPWQPPP--GVIPLILCTASRQCQDGVD 178

Query: 249 KRYGFTYVQGAADDHELWSFGLDSKMFWAHVEFLCDKNNSDDQLHDYITDLVAKKLKSQM 308
           K  G+ YVQGAADDHELW+ GL   +FWA+V+ L D +  +  L  ++  +V  +L    
Sbjct: 179 KSQGYAYVQGAADDHELWANGLTPSLFWANVQLLADDSMPEQLLQGHVERIV--ELHKST 236

Query: 309 YIQDKGGLDEIFGKVDKITDEISLGKVVQGLFINEKLKEELKSEYGKVLILSDSVTVAED 368
           + +     +    + D +T+ + LG V     I++K  E L+ +Y  V++   S+ ++  
Sbjct: 237 HTEAVAH-ELPCRETDVVTEHLRLGSVAP-CQISDKQAELLEQQYSLVVLCGSSIELS-- 292

Query: 369 AGVVEATKSNPFITVYKLQSGDKKSSKALRSILPKIHEEVELAFANRAEEMRPMLVCCNT 428
                A   +P I +Y L SG KKSS+ALR  L +I   +  A      E  P+L+CC++
Sbjct: 293 -----AAAPHPRIRIYPLNSGCKKSSRALRPALIEIIPLISTALC----EALPVLICCSS 343

Query: 429 GTDMSIGVILSILCTKYTEEWMLTQELPEVNKIIIRKHLTKLISHLHGRNVNPSRATLNS 488
           G+D+S+G++L+ LC  Y  EW   ++  ++ K II+KHL KL S +HGR +NPSR TLNS
Sbjct: 344 GSDISVGIVLAALCKNYDLEWR-HEDQKDMTKTIIKKHLIKLTSKIHGRIINPSRTTLNS 402

Query: 489 VNSFLM 494
           VN+FLM
Sbjct: 403 VNAFLM 408

>ZYRO0A01100g Chr1 (79473..80402) [930 bp, 309 aa] {ON} similar to
           uniprot|P53942 Saccharomyces cerevisiae YNL072W RNH201
           Ribonuclease H2 catalytic subunit removes RNA primers
           during Okazaki fragment synthesis cooperates with Rad27p
           nuclease
          Length = 309

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 25/94 (26%), Positives = 40/94 (42%), Gaps = 12/94 (12%)

Query: 52  PNERCGIWYCKPSTYKQTSYFKSTDGHVNQWDFSTRRLNFHLLETIRDNKGIIIVDSTRR 111
           P E   +    P+  K T++ ++T   +  WD    R ++   ET+ DNKGI I    + 
Sbjct: 224 PPEAGPLGSGYPADAKTTAWLRNTMKPLMGWDPHLVRFSWQTSETLLDNKGIQIEWEEK- 282

Query: 112 GKKIPDALSKTVPIWCAVLNTIMLQETEENFDID 145
                   SK+ P+W       MLQ   +   +D
Sbjct: 283 --------SKSKPVWAG---KSMLQAERKPLTLD 305

>CAGL0K06303g Chr11 (611434..621177) [9744 bp, 3247 aa] {ON} similar
            to uniprot|Q03280 Saccharomyces cerevisiae YDR457w
            ubiqitin ligase
          Length = 3247

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 36/117 (30%), Positives = 50/117 (42%), Gaps = 11/117 (9%)

Query: 94   LETIRDNKGIIIVDSTRRGKKIPDALSKTVPIWCAVLNTIMLQETEENFDIDKALYLPPE 153
            L TI DNK I I D     + I   LS+ +   C    T++    E N D+ +       
Sbjct: 2666 LSTIADNKDIFIKDLVENARNIVADLSEELRSLCKE-GTVVESGAEINSDLVQKF----- 2719

Query: 154  TVPKSEYDMIKRKIPELVTKLRKLNI----IDSKKLNELFMGKILRPIWVHPGSSLL 206
            TVP S    +  K+  +V  L   NI    ID+ KL+E++    L  IWV     L 
Sbjct: 2720 TVPSSNQAKL-LKVLTVVDFLYSDNISEEMIDTNKLSEIYKSMALGEIWVELSKCLF 2775

>TPHA0G01450 Chr7 (297855..299861) [2007 bp, 668 aa] {ON} 
          Length = 668

 Score = 32.0 bits (71), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 44/92 (47%), Gaps = 2/92 (2%)

Query: 289 DDQLHDYITDLVAKKLKSQMYIQDKGGLDEIFGKVDKITDEISLGKVVQGL--FINEKLK 346
           DD  HDY+      +L  +  I+ K   +EI  K  + +D I  G++ + L     E  +
Sbjct: 459 DDMEHDYVASAKHNELVIRERIKKKHEKEEILKKQKEKSDAIREGRLEEYLKEHAEEVPE 518

Query: 347 EELKSEYGKVLILSDSVTVAEDAGVVEATKSN 378
            ++K+E   V   +D++T +E+ G      +N
Sbjct: 519 ADVKTEDEPVQEKTDAITASEEKGSAPVEANN 550

>Smik_16.216 Chr16 complement(391489..393993) [2505 bp, 834 aa] {ON}
           YPL019C (REAL)
          Length = 834

 Score = 31.2 bits (69), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 56/127 (44%), Gaps = 18/127 (14%)

Query: 217 IQQHETWETPEDQNIIPIILCTVSYQAQDGMDK----RYGFTYVQGAADDH-----ELWS 267
           I     ++ P DQ+I   I   + Y  +D +DK    R    + +   D +         
Sbjct: 421 IYNRTAFQIPGDQSIRVTIDSNIMYIREDSLDKDRPIRNPANWHRDDIDSNVPNPLRFLR 480

Query: 268 FGLDSKMFWAHVEF-LCDKNNSDDQLHDYITDLVAKKL-----KSQMYIQDKGGLDEIFG 321
            G  SK  ++ +E  + +KNNS    H++I DL+   L     K  +Y+Q   G+  +FG
Sbjct: 481 PGEYSKFPYSVMEIKVINKNNSQMPNHEWIKDLINSHLVNEVPKFSLYLQ---GVASLFG 537

Query: 322 KVDKITD 328
           + DK  D
Sbjct: 538 EDDKYID 544

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 55,870,998
Number of extensions: 2571751
Number of successful extensions: 8295
Number of sequences better than 10.0: 37
Number of HSP's gapped: 8476
Number of HSP's successfully gapped: 37
Length of query: 494
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 380
Effective length of database: 40,409,475
Effective search space: 15355600500
Effective search space used: 15355600500
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)