Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_13.4958.847ON57657629350.0
YMR282C (AEP2)8.847ON58058021670.0
Skud_13.4548.847ON58058021540.0
Suva_13.4718.847ON58158320940.0
ZYRO0G14322g8.847ON5504695143e-57
SAKL0D01298g8.847ON5514175111e-56
Kpol_1068.38.847ON5665265111e-56
TDEL0B005108.847ON5503684987e-55
KLTH0C03718g8.847ON5514534644e-50
Kwal_27.102248.847ON5464534531e-48
TPHA0I002908.847ON5694854031e-41
NCAS0C003708.847ON4954483331e-32
KNAG0J002308.847ON4743763021e-28
Ecym_46188.847ON5273532996e-28
KLLA0D01408g8.847ON5183452952e-27
CAGL0M03069g8.847ON5484112952e-27
KAFR0B039708.847ON4744492896e-27
NDAI0K003408.847ON6244442741e-24
TBLA0B033108.847ON6134592581e-22
ABL119C8.847ON5373421054e-04
KLTH0H14454g1.467ON115198761.4
Smik_16.2478.106ON69681751.9
NDAI0D008406.24ON20879722.3
KAFR0E03850singletonON31191732.6
TBLA0F017903.408ON109771707.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_13.495
         (576 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_13.495 Chr13 complement(816375..818105) [1731 bp, 576 aa] {...  1135   0.0  
YMR282C Chr13 complement(833356..835098) [1743 bp, 580 aa] {ON} ...   839   0.0  
Skud_13.454 Chr13 complement(806601..808343) [1743 bp, 580 aa] {...   834   0.0  
Suva_13.471 Chr13 complement(816054..817799) [1746 bp, 581 aa] {...   811   0.0  
ZYRO0G14322g Chr7 complement(1146574..1148226) [1653 bp, 550 aa]...   202   3e-57
SAKL0D01298g Chr4 (98188..99843) [1656 bp, 551 aa] {ON} weakly s...   201   1e-56
Kpol_1068.3 s1068 (4295..5995) [1701 bp, 566 aa] {ON} (4295..599...   201   1e-56
TDEL0B00510 Chr2 (92878..94530) [1653 bp, 550 aa] {ON} Anc_8.847...   196   7e-55
KLTH0C03718g Chr3 (321675..323330) [1656 bp, 551 aa] {ON} weakly...   183   4e-50
Kwal_27.10224 s27 (248037..249677) [1641 bp, 546 aa] {ON} YMR282...   179   1e-48
TPHA0I00290 Chr9 complement(55148..56857) [1710 bp, 569 aa] {ON}...   159   1e-41
NCAS0C00370 Chr3 (54433..55920) [1488 bp, 495 aa] {ON} Anc_8.847...   132   1e-32
KNAG0J00230 Chr10 (30660..32084) [1425 bp, 474 aa] {ON} Anc_8.84...   120   1e-28
Ecym_4618 Chr4 complement(1210600..1212183) [1584 bp, 527 aa] {O...   119   6e-28
KLLA0D01408g Chr4 (120712..122268) [1557 bp, 518 aa] {ON} weakly...   118   2e-27
CAGL0M03069g Chr13 complement(347584..349230) [1647 bp, 548 aa] ...   118   2e-27
KAFR0B03970 Chr2 complement(830202..831626) [1425 bp, 474 aa] {O...   115   6e-27
NDAI0K00340 Chr11 complement(64928..66802) [1875 bp, 624 aa] {ON...   110   1e-24
TBLA0B03310 Chr2 complement(772555..774396) [1842 bp, 613 aa] {O...   103   1e-22
ABL119C Chr2 complement(175840..177453) [1614 bp, 537 aa] {ON} S...    45   4e-04
KLTH0H14454g Chr8 complement(1260084..1263539) [3456 bp, 1151 aa...    34   1.4  
Smik_16.247 Chr16 (449142..451232) [2091 bp, 696 aa] {ON} YPR008...    33   1.9  
NDAI0D00840 Chr4 (189925..190551) [627 bp, 208 aa] {ON} Anc_6.24       32   2.3  
KAFR0E03850 Chr5 complement(764595..765530) [936 bp, 311 aa] {ON}      33   2.6  
TBLA0F01790 Chr6 complement(442568..445861) [3294 bp, 1097 aa] {...    32   7.0  

>Smik_13.495 Chr13 complement(816375..818105) [1731 bp, 576 aa] {ON}
           YMR282C (REAL)
          Length = 576

 Score = 1135 bits (2935), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 554/576 (96%), Positives = 554/576 (96%)

Query: 1   MWMNKLTKCPSCSILGLYMKRFCTESFKSLQEIDVLPNRAIFHYTHSRRTCVTINDTSTR 60
           MWMNKLTKCPSCSILGLYMKRFCTESFKSLQEIDVLPNRAIFHYTHSRRTCVTINDTSTR
Sbjct: 1   MWMNKLTKCPSCSILGLYMKRFCTESFKSLQEIDVLPNRAIFHYTHSRRTCVTINDTSTR 60

Query: 61  KSFSTHSMCATGHLNNGNTPRDYDKFELKGIPIDVYTLRRIISSSGSTELDFSKGISYLF 120
           KSFSTHSMCATGHLNNGNTPRDYDKFELKGIPIDVYTLRRIISSSGSTELDFSKGISYLF
Sbjct: 61  KSFSTHSMCATGHLNNGNTPRDYDKFELKGIPIDVYTLRRIISSSGSTELDFSKGISYLF 120

Query: 121 TKTVDSGPRNSLSLAELSFLLNKLYSLRFQIRGICRDIKVKYSEFWFKIFSLYAEKVDAK 180
           TKTVDSGPRNSLSLAELSFLLNKLYSLRFQIRGICRDIKVKYSEFWFKIFSLYAEKVDAK
Sbjct: 121 TKTVDSGPRNSLSLAELSFLLNKLYSLRFQIRGICRDIKVKYSEFWFKIFSLYAEKVDAK 180

Query: 181 RNHINLRNTTLDACEIFDINLLIRNFIELGQLGKAQKILTFIIDRNPDILLSPNNADIGT 240
           RNHINLRNTTLDACEIFDINLLIRNFIELGQLGKAQKILTFIIDRNPDILLSPNNADIGT
Sbjct: 181 RNHINLRNTTLDACEIFDINLLIRNFIELGQLGKAQKILTFIIDRNPDILLSPNNADIGT 240

Query: 241 MVHFLKLRCGALAAYWKIPDNSGQDQKQLRKIVRLGAKNTSIRLSSTYKVMDHQTLLKIA 300
           MVHFLKLRCGALAAYWKIPDNSGQDQKQLRKIVRLGAKNTSIRLSSTYKVMDHQTLLKIA
Sbjct: 241 MVHFLKLRCGALAAYWKIPDNSGQDQKQLRKIVRLGAKNTSIRLSSTYKVMDHQTLLKIA 300

Query: 301 DLVLHEKRFLNSEDLLSTLIQSFGHLGQTQILERCIEHIWHITTQEFPSHVAIKPRGCYP 360
           DLVLHEKRFLNSEDLLSTLIQSFGHLGQTQILERCIEHIWHITTQEFPSHVAIKPRGCYP
Sbjct: 301 DLVLHEKRFLNSEDLLSTLIQSFGHLGQTQILERCIEHIWHITTQEFPSHVAIKPRGCYP 360

Query: 361 SSKILISILVSFHYNDNDLHRGLSILDSFIKHYPEVKLDALFWRRLFQLSNFAWTPAKDK 420
           SSKILISILVSFHYNDNDLHRGLSILDSFIKHYPEVKLDALFWRRLFQLSNFAWTPAKDK
Sbjct: 361 SSKILISILVSFHYNDNDLHRGLSILDSFIKHYPEVKLDALFWRRLFQLSNFAWTPAKDK 420

Query: 421 KATSVIRCWHLMKQWHVSKGLSLSVDYETLRQLYDIMKKTGNFPLGIDVLKSFKSGIERL 480
           KATSVIRCWHLMKQWHVSKGLSLSVDYETLRQLYDIMKKTGNFPLGIDVLKSFKSGIERL
Sbjct: 421 KATSVIRCWHLMKQWHVSKGLSLSVDYETLRQLYDIMKKTGNFPLGIDVLKSFKSGIERL 480

Query: 481 RETNSDKLNIVLIKYQKYIIKQLVDRGRISAVREFINDFGFDRTITKNLNIFCTXXXXXX 540
           RETNSDKLNIVLIKYQKYIIKQLVDRGRISAVREFINDFGFDRTITKNLNIFCT      
Sbjct: 481 RETNSDKLNIVLIKYQKYIIKQLVDRGRISAVREFINDFGFDRTITKNLNIFCTNRLLLR 540

Query: 541 XXXXXXXXXXXXXXXXLEPSGFDDDEDDGMIIGSLW 576
                           LEPSGFDDDEDDGMIIGSLW
Sbjct: 541 SKKNKSKIENKKERNKLEPSGFDDDEDDGMIIGSLW 576

>YMR282C Chr13 complement(833356..835098) [1743 bp, 580 aa] {ON}
           AEP2Mitochondrial protein, likely involved in
           translation of the mitochondrial OLI1 mRNA; exhibits
           genetic interaction with the OLI1 mRNA 5'-untranslated
           leader
          Length = 580

 Score =  839 bits (2167), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/580 (72%), Positives = 470/580 (81%), Gaps = 4/580 (0%)

Query: 1   MWMNKLTKCPSCSILGLYMKRFCTESFKSLQEIDVLPNRAIFHYTHSRRTCV----TIND 56
           MW+N+L K PS S+L  Y KR CT S KSL+E  VLPN  I H  + RRT V     IND
Sbjct: 1   MWINRLVKHPSYSVLRFYTKRLCTVSVKSLREFGVLPNSTICHSVYPRRTYVMGRAVIND 60

Query: 57  TSTRKSFSTHSMCATGHLNNGNTPRDYDKFELKGIPIDVYTLRRIISSSGSTELDFSKGI 116
              +KS+STH++CA     + N    YDKFE KGIPIDV+TL+RIISSSG  E +FSK I
Sbjct: 61  ILIKKSYSTHTVCAIDRSKDENNGSAYDKFEAKGIPIDVHTLKRIISSSGMDESEFSKSI 120

Query: 117 SYLFTKTVDSGPRNSLSLAELSFLLNKLYSLRFQIRGICRDIKVKYSEFWFKIFSLYAEK 176
           SYLF KTVD  P++ LSL +LSFLL+KLY+ RFQIR ICRDI  KYSEFWFK+FSLYAEK
Sbjct: 121 SYLFAKTVDPEPKDVLSLEDLSFLLSKLYTQRFQIRRICRDINAKYSEFWFKLFSLYAEK 180

Query: 177 VDAKRNHINLRNTTLDACEIFDINLLIRNFIELGQLGKAQKILTFIIDRNPDILLSPNNA 236
           VDAKRN +NLRNT LDACEIFD NL+I+NFIELGQLGKAQKIL+FI+DRNPDILLSP NA
Sbjct: 181 VDAKRNQVNLRNTKLDACEIFDANLMIKNFIELGQLGKAQKILSFILDRNPDILLSPKNA 240

Query: 237 DIGTMVHFLKLRCGALAAYWKIPDNSGQDQKQLRKIVRLGAKNTSIRLSSTYKVMDHQTL 296
           DI T+VHFL+LRCGALA YWKIPDNS Q Q  LRK+VRLGAKNTSIRLSSTYK MDHQTL
Sbjct: 241 DISTIVHFLQLRCGALAPYWKIPDNSEQKQGFLRKMVRLGAKNTSIRLSSTYKAMDHQTL 300

Query: 297 LKIADLVLHEKRFLNSEDLLSTLIQSFGHLGQTQILERCIEHIWHITTQEFPSHVAIKPR 356
           LKIADL L EK+ LNSEDLLSTLIQSFGHLGQTQILERCIEHIW I+ QEFPSHV IK R
Sbjct: 301 LKIADLALQEKKLLNSEDLLSTLIQSFGHLGQTQILERCIEHIWQISPQEFPSHVVIKHR 360

Query: 357 GCYPSSKILISILVSFHYNDNDLHRGLSILDSFIKHYPEVKLDALFWRRLFQLSNFAWTP 416
           GCYPSSKIL+SILVSF++ND+DLHRGLSILDSFIKHYP+VKLDALFWRRLFQLS+FAWTP
Sbjct: 361 GCYPSSKILVSILVSFYFNDHDLHRGLSILDSFIKHYPDVKLDALFWRRLFQLSHFAWTP 420

Query: 417 AKDKKATSVIRCWHLMKQWHVSKGLSLSVDYETLRQLYDIMKKTGNFPLGIDVLKSFKSG 476
           A DKKATSV+RCWHLMKQW+ SK L  SVDYETLRQLYDIMKKTGNFPLGIDVL+SFK G
Sbjct: 421 ANDKKATSVVRCWHLMKQWYASKRLRPSVDYETLRQLYDIMKKTGNFPLGIDVLRSFKPG 480

Query: 477 IERLRETNSDKLNIVLIKYQKYIIKQLVDRGRISAVREFINDFGFDRTITKNLNIFCTXX 536
           IER R  N+ K+N ++IKYQK IIK+LV+RGR SAVREFI+ +GFDR +TK+LNIFC   
Sbjct: 481 IERTRAENAGKVNNIIIKYQKCIIKELVNRGRFSAVREFIDSYGFDRKMTKDLNIFCANR 540

Query: 537 XXXXXXXXXXXXXXXXXXXXLEPSGFDDDEDDGMIIGSLW 576
                               +    FDDDEDDGMIIGSLW
Sbjct: 541 MFLRSKKMKNKIENKKEREKVRLDSFDDDEDDGMIIGSLW 580

>Skud_13.454 Chr13 complement(806601..808343) [1743 bp, 580 aa] {ON}
           YMR282C (REAL)
          Length = 580

 Score =  834 bits (2154), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/580 (70%), Positives = 468/580 (80%), Gaps = 4/580 (0%)

Query: 1   MWMNKLTKCPSCSILGLYMKRFCTESFKSLQEIDVLPNRAIFHYTHSRRTCVT----IND 56
           MWMNKL K    ++ GLY KR C ES  S+++ D+LPN  IFH T SR+T VT    + +
Sbjct: 1   MWMNKLVKYRFSNVFGLYKKRLCDESLGSVKQFDILPNSTIFHSTRSRKTYVTARTLVRN 60

Query: 57  TSTRKSFSTHSMCATGHLNNGNTPRDYDKFELKGIPIDVYTLRRIISSSGSTELDFSKGI 116
              +K +STH +         N  R YDKFE+KGIPID +TLRRII+SSG+ E +FSK +
Sbjct: 61  IVIQKFYSTHKLYLNNQSTYANAHRAYDKFEIKGIPIDAHTLRRIINSSGTNEQEFSKSV 120

Query: 117 SYLFTKTVDSGPRNSLSLAELSFLLNKLYSLRFQIRGICRDIKVKYSEFWFKIFSLYAEK 176
           +YLF K V+SG R  L L +LS LLNKLYS RF+IR IC++I VKYSEFWFK+FSLYAEK
Sbjct: 121 NYLFMKIVNSGNREILPLGDLSLLLNKLYSQRFEIRLICKEINVKYSEFWFKLFSLYAEK 180

Query: 177 VDAKRNHINLRNTTLDACEIFDINLLIRNFIELGQLGKAQKILTFIIDRNPDILLSPNNA 236
           VD +R+ +NLRNT LD+CEIFD+NLLI+NFIELGQL KAQKIL+FI+DRNPDILLSP NA
Sbjct: 181 VDTRRDQVNLRNTALDSCEIFDLNLLIKNFIELGQLSKAQKILSFILDRNPDILLSPRNA 240

Query: 237 DIGTMVHFLKLRCGALAAYWKIPDNSGQDQKQLRKIVRLGAKNTSIRLSSTYKVMDHQTL 296
           DIGT+VHFL+LRCGAL AYWKIPDNSG+ Q QLR++VRLGAKNTSIRLSSTYK MDHQTL
Sbjct: 241 DIGTIVHFLQLRCGALTAYWKIPDNSGRKQNQLRRMVRLGAKNTSIRLSSTYKAMDHQTL 300

Query: 297 LKIADLVLHEKRFLNSEDLLSTLIQSFGHLGQTQILERCIEHIWHITTQEFPSHVAIKPR 356
           LKIADLVL +KRFLNSEDLLSTLIQSFGHLGQTQILERCIEHIW I++QEFPSHVAIKPR
Sbjct: 301 LKIADLVLQDKRFLNSEDLLSTLIQSFGHLGQTQILERCIEHIWQISSQEFPSHVAIKPR 360

Query: 357 GCYPSSKILISILVSFHYNDNDLHRGLSILDSFIKHYPEVKLDALFWRRLFQLSNFAWTP 416
           GCYPSSKILISILVSFH ND DLHRGLSILDSFIKHYPEVKLDALFWRRL QLS+FAWTP
Sbjct: 361 GCYPSSKILISILVSFHLNDKDLHRGLSILDSFIKHYPEVKLDALFWRRLLQLSHFAWTP 420

Query: 417 AKDKKATSVIRCWHLMKQWHVSKGLSLSVDYETLRQLYDIMKKTGNFPLGIDVLKSFKSG 476
             DK+A S+++CWHLMK W+ SK LS SVDYETLRQLY++MKKTGNF LGIDVLKSFKSG
Sbjct: 421 VNDKRAASIVKCWHLMKHWYESKELSPSVDYETLRQLYEVMKKTGNFSLGIDVLKSFKSG 480

Query: 477 IERLRETNSDKLNIVLIKYQKYIIKQLVDRGRISAVREFINDFGFDRTITKNLNIFCTXX 536
           IE++R  N +KL  +LIKYQK IIKQLV+RG+ISA R+FI DFGF+R   K+LNIFC+  
Sbjct: 481 IEKMRTANPEKLEAILIKYQKCIIKQLVNRGKISAARKFIGDFGFNRRAAKDLNIFCSNR 540

Query: 537 XXXXXXXXXXXXXXXXXXXXLEPSGFDDDEDDGMIIGSLW 576
                               L P  +DDDEDDGMIIGSLW
Sbjct: 541 IFSRSKKIKNDIENKKKRDGLAPGNYDDDEDDGMIIGSLW 580

>Suva_13.471 Chr13 complement(816054..817799) [1746 bp, 581 aa] {ON}
           YMR282C (REAL)
          Length = 581

 Score =  811 bits (2094), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/583 (68%), Positives = 464/583 (79%), Gaps = 9/583 (1%)

Query: 1   MWMNKLTKCPSCSILGLYMKRFCTESFKSLQEIDVLPNRAIFHYTHSRRTCVTIN----- 55
           MWMNKL K PS SILGLY +R C ESF+SLQE+D+LPN  I +  HSRRTCVT       
Sbjct: 1   MWMNKLAKYPSPSILGLYTRRLCNESFRSLQEVDILPNIMIGNTVHSRRTCVTSRTLLTC 60

Query: 56  DTSTRKSFSTHSMCATGHLNNGNTPRDYDKFELKGIPIDVYTLRRIISSSGSTELDFSKG 115
           D + +K +STH + A     NGN  R +D F++K IPID++TLRRII SS   ELDFSK 
Sbjct: 61  DIAAQKFYSTHKLNAIDQPTNGNAQRPHDMFKVKDIPIDMFTLRRIIDSSSMNELDFSKS 120

Query: 116 ISYLFTKTVDSGPRNSLSLAELSFLLNKLYSLRFQIRGICRDIKVKYSEFWFKIFSLYAE 175
           ++YLF K ++S  R +LSL +LSFLLN LYS RF+I+ IC+DI V+YSEFWFK+FSLYAE
Sbjct: 121 MTYLFVKAINSEARETLSLEDLSFLLNNLYSQRFEIKKICKDINVRYSEFWFKLFSLYAE 180

Query: 176 KVDAKRNHINLRNTTLDACEIFDINLLIRNFIELGQLGKAQKILTFIIDRNPDILLSPNN 235
           KVD KRN INLRNT LD+ EIFD+NL+I+NFIELGQLGKAQK+L+FI+DRN DILLSP N
Sbjct: 181 KVDVKRNQINLRNTALDSSEIFDMNLIIKNFIELGQLGKAQKVLSFILDRNSDILLSPKN 240

Query: 236 ADIGTMVHFLKLRCGALAAYWKIPDNSGQDQKQLRKIVRLGAKNTSIRLSSTYKVMDHQT 295
           ADIGT++HFL+LRCGALAAYWK+PDNS  +QK  RK+VRLGAKNTSIR++S+YK MDHQT
Sbjct: 241 ADIGTIIHFLQLRCGALAAYWKMPDNS--EQKYSRKMVRLGAKNTSIRITSSYKAMDHQT 298

Query: 296 LLKIADLVLHEKRFLNSEDLLSTLIQSFGHLGQTQILERCIEHIWHITTQEFPSHVAIKP 355
           LLKIADLVL ++R LNSEDLLSTLIQSFGHLGQTQILERCIEHIW I+ QEFPSH  IKP
Sbjct: 299 LLKIADLVLQKERLLNSEDLLSTLIQSFGHLGQTQILERCIEHIWQISLQEFPSHATIKP 358

Query: 356 --RGCYPSSKILISILVSFHYNDNDLHRGLSILDSFIKHYPEVKLDALFWRRLFQLSNFA 413
             RGC PSSKILISILVSFH NDNDLHRGLSILDSFIKHYPEVK+D LFWRRLFQLS+FA
Sbjct: 359 KTRGCCPSSKILISILVSFHLNDNDLHRGLSILDSFIKHYPEVKVDELFWRRLFQLSHFA 418

Query: 414 WTPAKDKKATSVIRCWHLMKQWHVSKGLSLSVDYETLRQLYDIMKKTGNFPLGIDVLKSF 473
           WTP  DK+ATS++RCWHLMKQWH SKG SLSVDYETLRQLYD+ KKTGN+ LGIDVL++F
Sbjct: 419 WTPTHDKRATSIVRCWHLMKQWHESKGFSLSVDYETLRQLYDLTKKTGNYSLGIDVLQNF 478

Query: 474 KSGIERLRETNSDKLNIVLIKYQKYIIKQLVDRGRISAVREFINDFGFDRTITKNLNIFC 533
           K GI R     ++K+N ++IK+QKYIIKQLV+RG+ SA REFINDF FD    K LN+FC
Sbjct: 479 KPGITRTSAMKTEKINGIVIKHQKYIIKQLVNRGKTSAAREFINDFSFDIGAVKELNVFC 538

Query: 534 TXXXXXXXXXXXXXXXXXXXXXXLEPSGFDDDEDDGMIIGSLW 576
           T                           FDDD+DDGM+IGSLW
Sbjct: 539 TNRILLRSKKLKNKTENRKERNRSGQGNFDDDDDDGMVIGSLW 581

>ZYRO0G14322g Chr7 complement(1146574..1148226) [1653 bp, 550 aa]
           {ON} weakly similar to uniprot|P22136 Saccharomyces
           cerevisiae YMR282C AEP2 Mitochondrial protein likely
           involved in translation of the mitochondrial OLI1 mRNA
           exhibits genetic interaction with the OLI1 mRNA 5'-
           untranslated leader
          Length = 550

 Score =  202 bits (514), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 143/469 (30%), Positives = 234/469 (49%), Gaps = 44/469 (9%)

Query: 116 ISYLFTKTVDSGPRNSLSLAELSFLLNKLYS---LRFQIRGICRDIKVKYSEFWFKIFSL 172
           IS LFT          L+ +E S  +NKL S   L  ++  +  D    ++E  +K++  
Sbjct: 118 ISGLFTT-------GGLTKSEYSLFINKLLSEEELDVKLSNVIPD--TPHTELIYKLYEF 168

Query: 173 YAEKVDAKRNHINLRNTTLDACEIFDINLLIRNFIELGQLGKAQKILTFIIDRNP--DIL 230
           Y + +  + N        L   +++D+NL ++ FI   QL KA  +L FI+ R P  D+L
Sbjct: 169 YCDHIVDQHN--------LTPLQLYDLNLFLKTFIAEAQLSKAHNVLDFILLRRPLNDLL 220

Query: 231 LSPNNADIGTMVHFLKLRCGALAAYWKIPDNSGQDQKQLRKIVRLGAKNTSIRLSSTYKV 290
               N D+  ++ FL+L+CGAL+ +WKI   S ++       + LG K +   L+ +YK 
Sbjct: 221 A---NTDVEILIQFLRLKCGALSKFWKIQPASQRNST----AITLGEKASDCHLAKSYKF 273

Query: 291 MDHQTLLKIADLVLHEKRFLN--SEDLLSTLIQSFGHLGQTQILERCIEHIWHITTQEFP 348
            + + LL+I + VL E  + N  S  L + +I S G+LGQT ++E+ +   W  +  E  
Sbjct: 274 QNEKVLLQIINSVLGEHNWKNRRSPKLDAAIIYSLGYLGQTDLIEKYVNRTWSPSKDE-- 331

Query: 349 SHVAIKPRGCYPSSKILISILVSFHYNDNDLHRGLSILDSFIKHYPEVKLDALFWRRLFQ 408
               +K     P+S +L+++L S+   + ++ +GL +LD FI+ YPEV+LD LFWRRL Q
Sbjct: 332 ---GVKTN---PNSDLLVAVLTSYCVKEGNMRKGLEVLDRFIRDYPEVELDPLFWRRLLQ 385

Query: 409 LSNFAWTPAKDKKATSVIRCWHLMKQWHVSKGLSLSVDYETLRQLYDIMKKTGNFPLGID 468
           LS+  W   +D+KAT    CW +MKQWH  +   +  DY  +++LY I  +T N    ++
Sbjct: 386 LSSLLWDKKRDRKATLSHGCWTIMKQWHAQRQRKIPYDYGIMKELYPIFVRTKNKNGALE 445

Query: 469 VL-KSFKSGIERLRETNSDKLNIVLIKYQKYIIKQLVDRGRISAVREFINDFGFDRTITK 527
           V+ KSF     +   T       +L KYQ++I+K +  +G      EF  ++ F  T   
Sbjct: 446 VITKSFFGAFIQPEFTIRPNELSLLCKYQRFILKMIALKGNYHKGFEFCQEWSFSSTNKF 505

Query: 528 NLNIFCTXXXXXXXXXXXXXXXXXXXXXXLEPSGFDDDEDDGMIIGSLW 576
            L  +                             +D+ E+D M++G LW
Sbjct: 506 ELQSYFMKWRGIHEQRRTSQSKQKAALQ----EKYDEMEEDDMLLGRLW 550

>SAKL0D01298g Chr4 (98188..99843) [1656 bp, 551 aa] {ON} weakly
           similar to uniprot|P22136 Saccharomyces cerevisiae
           YMR282C AEP2 Mitochondrial protein likely involved in
           translation of the mitochondrial OLI1 mRNA exhibits
           genetic interaction with the OLI1 mRNA 5'- untranslated
           leader
          Length = 551

 Score =  201 bits (511), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 119/417 (28%), Positives = 214/417 (51%), Gaps = 27/417 (6%)

Query: 162 YSEFWFKIFSLYAEKVDAKRNHINLRNTTLDACEIFDINLLIRNFIELGQLGKAQKILTF 221
           ++E  FK++ +Y + V        + N TL   +++D+N  I+ F    QL KAQ++L F
Sbjct: 160 HTEVLFKLYEIYRDSV--------VGNATLTPVQLYDLNQFIKRFTGDAQLAKAQQVLGF 211

Query: 222 IIDRNPDILLSPNNADIGTMVHFLKLRCGALAAYWKIPDNSGQDQKQLRKIVRLGAKNTS 281
           +++    I   P      T++++L+L+CGA+   W IP +  +  K L      G+++  
Sbjct: 212 VLENYGSIPRDPQ-----TLINYLELKCGAMPRNWSIPLSRPELGKTL------GSQSFM 260

Query: 282 IRLSSTYKVMDHQTLLKIADLVLHEK--RFLNSEDLLSTLIQSFGHLGQTQILERCIEHI 339
             L+ +YKV++ + LL + D ++ ++   +  + DL + +I S G++GQ  +LER I+H 
Sbjct: 261 SNLAHSYKVLETEALLPLIDEMMKDRAWHYKRNCDLEAAVIYSLGYMGQFALLERYIKHT 320

Query: 340 WHITTQEFPSHVAIKPRGCYPSSKILISILVSFHYNDNDLHRGLSILDSFIKHYPEVKLD 399
           W ++     S     P+  YP+S +LISI VS +    +LH+ L I+DSF+  +P+++L+
Sbjct: 321 WGVSVSSNTSTEVEVPKNLYPTSNLLISI-VSCYAMKGNLHQALQIIDSFLSKFPQIELE 379

Query: 400 ALFWRRLFQLSNFAWTPAKDKKATSVIRCWHLMKQWHVSKGLSLSVDYETLRQLYDIMKK 459
            LFWRRLFQ S   W    D K      CW +MKQWH  +  SL +D   L + Y ++K+
Sbjct: 380 PLFWRRLFQWSTRLWNQKTDPKGELSNGCWQVMKQWHNKQKRSLPIDLGILNERYYVLKR 439

Query: 460 TGNFPLGIDVLKSFKSGIERLRETNSDKLNIVLIKYQKYIIKQLVDRGRISAVREFINDF 519
           T NF   + +     +G+   R     +++++  K+QK I+K++  RG      ++I+++
Sbjct: 440 TNNFTEALRIHDEALAGLYMKRNLIDPEVDVI-KKFQKLILKKMAGRGYYHKPLKYISEW 498

Query: 520 GFDRTITKNLNIFCTXXXXXXXXXXXXXXXXXXXXXXLEPSGFDDDEDDGMIIGSLW 576
             ++     +  +                             FD +E+D M++G LW
Sbjct: 499 CLNKRNELEMREYFDRHRKAYITRIEQRKQKQETAQV----TFDAEEEDDMLLGRLW 551

>Kpol_1068.3 s1068 (4295..5995) [1701 bp, 566 aa] {ON} (4295..5995)
           [1701 nt, 567 aa]
          Length = 566

 Score =  201 bits (511), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 157/526 (29%), Positives = 253/526 (48%), Gaps = 46/526 (8%)

Query: 73  HLNNGNT--------PRDYDKFELKGIPIDVYTLRRIISSSGSTELDFSKGISYLFTKTV 124
           H  N NT        P +  +  LK   ID +TL  + S  G    DF K +        
Sbjct: 65  HSRNSNTIIKQSDVLPENIWRNYLKNNEIDKFTLHLLASLRGDD--DFVKNL-------F 115

Query: 125 DSGPRNSLSLAELSFLLNKLY-SLRFQIRGICRDI-KVKYSEFWFKIFSLYAEKVDAKRN 182
            SG    L+  ELS  +N++Y S    I+ + ++   + Y+E  ++IF LY   +  +  
Sbjct: 116 KSG---DLTYNELSIFINRIYKSNGHDIKRVIQNHHSLSYTELIYEIFELYTSTIPKESG 172

Query: 183 HINLRNTTLDACEIFDINLLIRNFIELGQLGKAQKILTFIIDRNPDILLSPNNADIGTMV 242
            I L     +A  + D+NL I  FI+  QL KAQ +L +IID    I       D  TMV
Sbjct: 173 IIKL-----NALHLKDLNLFITIFIKEAQLSKAQNVLQYIIDAEGSI---EKITDHDTMV 224

Query: 243 HFLKLRCGALAAYWKIPDNSGQDQKQLRKIVRLGAKNTSIRLSSTYK-VMDHQTLLKIAD 301
           +FL+LRCG L  +W +P  S    KQ +K  RL + + + R  S+YK  + +  L ++ +
Sbjct: 225 NFLRLRCGGLPKFWLVPQASYAVTKQTKKNSRLSSNSPNTRFPSSYKSTVPNTVLFEVIN 284

Query: 302 LVLHEK--RFLNSEDLLSTLIQSFGHLGQTQILERCIEHIWHITTQEFPSHVAIKPR--G 357
           ++L++K  +  +S  L ST++ S  H  Q Q+++  I+  W I++   P  + IK +   
Sbjct: 285 MILNKKVWKSKHSGILDSTIVYSLAHTFQKQMMDGFIKEHWGISSHGDPLDLFIKKKKVA 344

Query: 358 CYPSSKILISILVSFHYNDNDLHRGLSILDSFIKHYPEVKLDALFWRRLFQLSNFAWTPA 417
             PS++ILI+I+ S+ Y D ++   + ILD FI+ YP++ LD +FWRRL Q  N  W P 
Sbjct: 345 SAPSNEILIAIMSSYIYKDRNIDGAMKILDKFIRMYPDISLDNMFWRRLIQWCNRLWDPK 404

Query: 418 KDKKATSVIRCWHLMKQWH---VSKGLSLSVDYETLRQLYDIMKKTGNFPLGIDVLKSFK 474
            D++ T    CW++MK W+     K + L  D++   + Y + K+T N  +  +++ +  
Sbjct: 405 IDRQGTFGYGCWNMMKNWNGAGTGKDVVLPYDFQIYEEFYRLFKRTNNGKIAAEIVSNVL 464

Query: 475 SGIERLRETN----SDKLNIVLIKYQKYIIKQLVDRGRISAVREFINDFGFDRTITKNLN 530
             I  L E N      +LN+ L KYQ   +  L++R +      FI ++  DR     L 
Sbjct: 465 --IPHLSEKNVAVKKAELNL-LNKYQTLAMNWLIERRQFKKAAFFIEEWSIDRNNRIQLR 521

Query: 531 IFCTXXXXXXXXXXXXXXXXXXXXXXLEPSGFDDDEDDGMIIGSLW 576
                                      +   +D+ E++ MIIG LW
Sbjct: 522 EAFKKRKQLMLRKLSTRDKKSQSQKKRQDR-YDEMEEEDMIIGRLW 566

>TDEL0B00510 Chr2 (92878..94530) [1653 bp, 550 aa] {ON} Anc_8.847
           YMR282C
          Length = 550

 Score =  196 bits (498), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 120/368 (32%), Positives = 204/368 (55%), Gaps = 29/368 (7%)

Query: 162 YSEFWFKIFSLYAEKVDAKRNHINLRNTTLDACEIFDINLLIRNFIELGQLGKAQKILTF 221
           ++E  F ++ +Y   V      I      L   ++ DIN  I+ FI+  QL KAQ+ L F
Sbjct: 157 HTEIIFNLYQIYCTYV------IKDSQNGLTPLQVHDINRFIKRFIDEAQLKKAQECLQF 210

Query: 222 IIDRNP--DILLSPNNADIGTMVHFLKLRCGALAAYWKIPDNSGQDQKQLRKIVRLGAKN 279
           +ID+    +IL S    D+ T+  FL+LRCGAL  +W++  NS +          LG  +
Sbjct: 211 LIDKQGLHNILQS---GDVETITQFLQLRCGALQKFWRVDSNSTK---------VLGEDS 258

Query: 280 TSIRLSSTYKVMDHQTLLKIADLVLHEK--RFLNSEDLLSTLIQSFGHLGQTQILERCIE 337
              +   +Y ++  Q  L+I + +L +K  R  +S  + S ++ S  +LGQT+++++ I+
Sbjct: 259 KHFKSPKSYNLLKEQPFLEIVNFLLKDKSWRLRSSPIIDSAIVYSLSNLGQTKLIDQYIQ 318

Query: 338 HIWHITTQEFPSHVAIKPRGCYPSSKILISILVSFHYNDNDLHRGLSILDSFIKHYPEVK 397
             W I+      HVA+K     P  ++LI+I+ ++   + D  +GL ILD F+K YP+ +
Sbjct: 319 LKWGISED---GHVAVKNEAV-PGHEVLINIVSAYCLKNGDTGKGLRILDQFMKKYPQTE 374

Query: 398 LDALFWRRLFQLSNFAWTPAKDKKATSVIRCWHLMKQWHVSKGLSLSVDYETLRQLYDIM 457
           L+ LFWRRL QLS   W   KDKKA     CW++MKQWH  KG+S++ D  TLR LY + 
Sbjct: 375 LEKLFWRRLLQLSFHNWDKQKDKKALVCHGCWNIMKQWHEQKGVSITYDSGTLRLLYQLF 434

Query: 458 KKTGNFPLGIDVLKSFKSGI--ERLRETNSDKLNIVLIKYQKYIIKQLVDRGRISAVREF 515
           K T N     +V+++  S +  ++  + + D+++++L+ +QK  +K +  +GR +   + 
Sbjct: 435 KFTRNGRGAAEVVRTCFSSVYAKQPYQISKDEMDLLLM-FQKLALKTMALKGRYNEPLQL 493

Query: 516 INDFGFDR 523
           I ++  D+
Sbjct: 494 IKEWNVDK 501

>KLTH0C03718g Chr3 (321675..323330) [1656 bp, 551 aa] {ON} weakly
           similar to uniprot|P22136 Saccharomyces cerevisiae
           YMR282C AEP2 Mitochondrial protein likely involved in
           translation of the mitochondrial OLI1 mRNA exhibits
           genetic interaction with the OLI1 mRNA 5'- untranslated
           leader
          Length = 551

 Score =  183 bits (464), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 128/453 (28%), Positives = 210/453 (46%), Gaps = 34/453 (7%)

Query: 130 NSLSLAELSFLLNKLYSLRFQIRGICRDI-KVKYSEFWFKIFSLYAEKVDAKRNHINLRN 188
           N LS+AE S  +  L S+   +  +   +  V  +E  F ++ LY + V           
Sbjct: 127 NDLSIAEFSAFIEGLLSVNNLLHKLSATLPNVSGTEMVFSLYQLYLKTVTP--------- 177

Query: 189 TTLDACEIFDINLLIRNFIELGQLGKAQKILTFIIDRNPDILLSPNNADIGTMVHFLKLR 248
             L   ++ D N  IR FI   QL KAQ +L  I+  N + L      D  T  H+L+LR
Sbjct: 178 GPLSPLQLHDFNKFIRFFIRSAQLRKAQTVLDCILKSNNNQL----PCDSATATHYLQLR 233

Query: 249 CGALAAYWKIPDNSGQDQKQLRKIVRLGAKNTSIRL-SSTYKVMDHQTLLKIADLVLHEK 307
           CGAL   WK+ D      + L +  RLGA+    +L S +YK +DH+++L    L+   K
Sbjct: 234 CGALPRNWKVLD------ENLGRSTRLGARKNRYQLVSHSYKALDHKSVLTFMSLLSDPK 287

Query: 308 RFL---NSEDLLSTLIQSFGHLGQTQILERCIEHIWHITTQEFPSHVAIKPRGCYPSSKI 364
                  S  L S ++ S G +GQ ++LE  +   W I+ QE   +         PSS++
Sbjct: 288 SVWFHRKSAALESAVVYSLGFMGQLKLLEEHVWRNWGISLQEH--NQVTDASFTSPSSEV 345

Query: 365 LISILVSFHYNDNDLHRGLSILDSFIKHYPEVKLDALFWRRLFQLSNFAWTPAKDKKATS 424
           L+++L S+  N N +   L ++D F+  YP ++LD +FWRRLFQ S   W+   D +   
Sbjct: 346 LVAVLTSYASNKN-ISSALHLIDGFMAKYPTLELDHVFWRRLFQWSTRVWSEKTDPRGEL 404

Query: 425 VIRCWHLMKQWHVSKGLSLSVDYETLRQLYDIMKKTGNFPLGIDVLKSFKSGIERLRETN 484
              CW +M++WH ++   L  D   L + + ++ +T N+   I+V++   S     ++ N
Sbjct: 405 SRGCWRVMREWHAARNRQLPADAVLLNERFVVLSRTNNYRDAIEVVEQCYSSF--FQKAN 462

Query: 485 SDKLNIVLI-KYQKYIIKQLVDRGRISAVREFINDFGFDRTITKNLNIFCTXXXXXXXXX 543
             +   VL  K+ K I+K +   G      +FI ++  ++ +   L  +           
Sbjct: 463 LSRHEAVLFQKFAKLILKNMAHLGYYHKPLKFIKEWSPNKLLEHTLRAYFEKHRNAYSAR 522

Query: 544 XXXXXXXXXXXXXLEPSGFDDDEDDGMIIGSLW 576
                             FDD+E+D M++G LW
Sbjct: 523 KQRRTEAAQKAQ----KRFDDEEEDSMLLGRLW 551

>Kwal_27.10224 s27 (248037..249677) [1641 bp, 546 aa] {ON} YMR282C
           (AEP2) - basic, hydrophilic 67.5 kDa protein [contig 39]
           FULL
          Length = 546

 Score =  179 bits (453), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 130/453 (28%), Positives = 217/453 (47%), Gaps = 34/453 (7%)

Query: 130 NSLSLAELSFLLNKLYSLR-FQIRGICRDIKVKYSEFWFKIFSLYAEKVDAKRNHINLRN 188
           N L+  E S LLN L + R    +       V+ +E  F ++  Y   + A         
Sbjct: 122 NLLTPNEFSTLLNGLLTERNLSTKLETVLPSVQSTEMIFGLYQTYLMTIPAG-------- 173

Query: 189 TTLDACEIFDINLLIRNFIELGQLGKAQKILTFIIDRNPDILLSPNNADIGTMVHFLKLR 248
            +L+  ++ D+N  ++ FIE  QLGKAQ +L  I+  N D L      D  T +H+L+LR
Sbjct: 174 -SLNPLQLHDLNSFVQYFIETAQLGKAQIVLDRILASNNDQL----PCDTTTGIHYLQLR 228

Query: 249 CGALAAYWKIPDNSGQDQKQLRKIVRLGA-KNTSIRLSSTYKVMDHQTLLKIADLVLHEK 307
           CGAL   WK+ D+      ++    RLG+ +N S  +S TYK +D  ++L+  +++  E 
Sbjct: 229 CGALPRNWKVFDS------RVGHSCRLGSHRNKSQPVSHTYKALDQSSVLEFVNVLNDEN 282

Query: 308 R---FLNSEDLLSTLIQSFGHLGQTQILERCIEHIWHITTQEFPSHVAIKPRGCYPSSKI 364
                  S  L + +I S G +GQ  +L+  I   W IT  E  + +A +     PS ++
Sbjct: 283 SEWFHKKSPTLEAAVIYSLGFMGQLTLLKEHIAVRWGIT--ELGASLATEVNEVPPSPEV 340

Query: 365 LISILVSFHYNDNDLHRGLSILDSFIKHYPEVKLDALFWRRLFQLSNFAWTPAKDKKATS 424
           LI+I  SF  +  ++  GL ++D+FI  Y E+ LD +FWRRLFQ +N  W    D +   
Sbjct: 341 LIAIFTSFA-SHQEVTLGLRLMDAFITKYSEINLDIVFWRRLFQWTNLVWDVKTDPRGDL 399

Query: 425 VIRCWHLMKQWHVSKGLSLSVDYETLRQLYDIMKKTGNFPLGIDVL-KSFKSGIERLRET 483
              CW +M +WH      L  D   L + Y ++ +T N+   + V+ +SF    E  + T
Sbjct: 400 SRGCWRVMTEWHEKGSKKLQPDTTLLNERYFVLAQTNNYKEALTVISQSFPQLYE--KPT 457

Query: 484 NSDKLNIVLIKYQKYIIKQLVDRGRISAVREFINDFGFDRTITKNLNIFCTXXXXXXXXX 543
            S K   ++ KY K ++K + + G       FI ++  ++ +  +L ++           
Sbjct: 458 LSSKEMAIVQKYSKLVLKSMAELGYYHKPLTFITEWSPNKAVEDSLRVYFKKHRDGFTKR 517

Query: 544 XXXXXXXXXXXXXLEPSGFDDDEDDGMIIGSLW 576
                         + + +DD+E+D M++G LW
Sbjct: 518 KERLREESRR----KQNTYDDEEEDNMLLGRLW 546

>TPHA0I00290 Chr9 complement(55148..56857) [1710 bp, 569 aa] {ON}
           Anc_8.847 YMR282C
          Length = 569

 Score =  159 bits (403), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 126/485 (25%), Positives = 226/485 (46%), Gaps = 50/485 (10%)

Query: 117 SYLFTKTVDSGPRNSLSLAELSFLLNKLYSLRFQIRGICRDIKV-------KYSEFWFKI 169
           SY+F + +    +  L+  E S  LN+L       +G   D  V       K+SE  FK+
Sbjct: 110 SYMFLRELLESKQ--LTFNEFSIFLNRL----IDRKGFIYDSIVLKEFPNGKHSEMVFKL 163

Query: 170 FSLYAEKVDAKRNHINLRNTTLDACEIFDINLLIRNFIELGQLGKAQKILTFIIDRNPDI 229
           F LY   + + +         L    + D+NL I  FI  G LG+A+ +LTF++++   I
Sbjct: 164 FQLYGNAIGSDK---------LSLLSLRDMNLFIEFFINEGHLGRAEIVLTFVLNKTRSI 214

Query: 230 LLSPNNADIGTMVHFLKLRCGALAAYWKIPDNSGQ-------DQKQLRKIVRLGAKNTSI 282
           L   +  D+ T+ H+L+LRCGAL  YW   + S +         +  +   RLG KN ++
Sbjct: 215 L---DLYDVDTVTHYLQLRCGALPRYWMFQNKSAELAYKDKFGNRLSKYKTRLGRKNFAV 271

Query: 283 RLSSTYKVMDHQTLLKIADLVLHEKRFLN--SEDLLSTLIQSFGHLGQTQILERCIEHIW 340
           +L++ YK++D   +LKIA+ ++ + ++ +  S  L +T++ S  + GQ   +   I   W
Sbjct: 272 KLTNRYKILDPLGVLKIANKIITDDKWKSNHSAKLDATVVYSLCYSGQLSNIPSYINSRW 331

Query: 341 H--ITTQEFPSHVA--IKPRGCYP-SSKILISILVSFHYNDNDLHRGLSILDSFIKHYPE 395
           +  I+  +  S V   I      P  S+++ +IL S+ Y+D  + R ++I+D  +  YP 
Sbjct: 332 NVDISMSDGNSDVGTQISNEASKPLPSEVMEAILSSYSYDDKSIERAINIIDKIMNSYPN 391

Query: 396 VKLDALFWRRLFQLSNFAWTPAKDKKATSVIRCWHLMKQWHVSKGLSLSVDYETLRQLYD 455
           ++L+  FWRRL Q S   W    D+K + V  C+  +K++H  + + ++ D   L++LY 
Sbjct: 392 LELNQQFWRRLMQWSVLCWDHKLDRKGSLVYGCFKTLKKYHEMRSIRINFDEGLLQELYT 451

Query: 456 IMKKTGNFPLGIDVLKSFKSGIERLRETNSDKLNI----VLIKYQKYIIKQLVDRGRISA 511
           ++  T N  +  +V+  F   + +     SD++      +L  +QK  I  ++ +     
Sbjct: 452 LVYYTKNSRIAAEVVSEF---MPQFFYKRSDEITFGERKLLFYFQKRSIDGMLGKKDYFT 508

Query: 512 VREFINDFGFDRTITKNLNIFCTXXXXXXXXXXXXXXXXXXXXXXLEPSGFDDDEDDGMI 571
              FI  +  D    + L  +                        LE    D  ++D  +
Sbjct: 509 ASNFIEKWSMDNQNKEELFKYYKDSIAKKLQKVRRNSLQQKIKEKLE----DHSDEDDTL 564

Query: 572 IGSLW 576
           +G LW
Sbjct: 565 LGRLW 569

>NCAS0C00370 Chr3 (54433..55920) [1488 bp, 495 aa] {ON} Anc_8.847
           YMR282C
          Length = 495

 Score =  132 bits (333), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 123/448 (27%), Positives = 210/448 (46%), Gaps = 55/448 (12%)

Query: 132 LSLAELSFLLNKLYSLRFQIRGICRDIKVKYSEFWFKIFSLYAEKVDAKRNHINLRNTTL 191
            +L E S  L K+ S++        D+ V      F++F +YA     +         +L
Sbjct: 100 FTLEEYSLFLGKVLSMK------DSDVNVNVV---FQLFEIYARMYCGE--------GSL 142

Query: 192 DACEIFDINLLIRNFIELGQLGKAQKILTFIIDRNPDILLSPNNADIGTMVHFLKLRCGA 251
           +A +I+D+N LI+ FI+  QL + Q +L FII +   I     + D+ ++ + LKL+ G+
Sbjct: 143 NALQIYDLNKLIKYFIKRDQLKQGQIVLDFIIMKYGGIENMIAHRDLISLNNHLKLKNGS 202

Query: 252 LAAYWKIPDNSGQDQKQLRKIVRLGAKNTSIRLSSTYKVMDHQTLLKIADLVLHEKRFLN 311
           L   WK     G++ + L+   R G  N        YK +D  +LLKIADLVL++   + 
Sbjct: 203 LVKDWKF---EGKNLRYLQS--RQGRLN--------YKFLDGWSLLKIADLVLNDP--MK 247

Query: 312 SEDLLS-TLIQSFGHLGQTQILERCIEHIWHITTQEFPSHVAIKPRG--CYPSSKILISI 368
            +++L+ ++I S GHL Q ++L+  I+ +W   T         +PR    YP +  +I+I
Sbjct: 248 CQNVLTNSIIYSLGHLRQVELLDHFIDQMWMQET---------RPRNGLLYPDTNNIIAI 298

Query: 369 LVSFHYNDNDLHRGLSILDSFIKHYPEVKLDALFWRRLFQLSNFAWTPAKDKKATSVIRC 428
           + S+ YN  ++ +   +LD  ++ Y  +K D  FWRRLFQ      T     K   + +C
Sbjct: 299 ITSYCYNYGNMDKSFDVLDRILEKYSGLKFDKFFWRRLFQWC--ILTEPNANKGFILGQC 356

Query: 429 WHLMKQWHVSKGLSLSVDYETLRQLYDIMKKTGNFPLGIDVLKSFKSGIERLRETNSDKL 488
           W LM+     K   +  D   L  L + + K  + PL + VLK     ++++   N   +
Sbjct: 357 WSLME-----KQEKVEFDGVLLELLREKIVKVRDVPLALRVLKMIVIELKKVNFINELDM 411

Query: 489 NIVLIKYQKYIIKQLVDRGRISAVREFINDFGFDRTITKNLNIFCTXXXXXXXXXXXXXX 548
            + L+KYQK++  +L +  +     E ++    D TI K    F                
Sbjct: 412 EL-LLKYQKFVFSKLGEINKTVKAMELLS--CDDYTINKENKAFMRAYYFENKREKRKKN 468

Query: 549 XXXXXXXXLEPSGFDDDEDDGMIIGSLW 576
                   L+   +D+ +++ MIIG LW
Sbjct: 469 KRSNQYDDLQRK-YDEMDEEDMIIGKLW 495

>KNAG0J00230 Chr10 (30660..32084) [1425 bp, 474 aa] {ON} Anc_8.847
           YMR282C
          Length = 474

 Score =  120 bits (302), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 95/376 (25%), Positives = 172/376 (45%), Gaps = 54/376 (14%)

Query: 164 EFWFKIFSLYAEKVDAKRNHINLRNTTLDACEIFDINLLIRNFIELGQLGKAQKILTFII 223
           E +F IF  Y       +  I L++  L   ++ D NL+   FI   QL KAQ I+ F++
Sbjct: 113 EKFFAIFMRY-------KGAIALQSNKLTQIQLHDFNLMCDYFIACNQLKKAQLIMDFLL 165

Query: 224 DRNPDILLSPNNADIGTMVHFLKLRCGALAAYWKIPDNSGQDQKQLRKIVRLGAKNTSIR 283
            ++          D+  + ++ KLRCG+                        G +  +  
Sbjct: 166 QQDVKF-------DVFMIKNYTKLRCGS----------------------SFGKQTLN-- 194

Query: 284 LSSTYKVMDHQTLLKIADLVLHEKRFL--NSEDLLSTLIQSFGHLGQTQILERCIEHIWH 341
            +  YKV D  T+ ++   V  +++F   N+E     ++ S G+     ++E  I  +W 
Sbjct: 195 -NKAYKVFDQNTVFQLIGKVEADRKFAFWNNE-----IVSSLGYTNNITLMEIYIWDLWR 248

Query: 342 ITTQEFPS-HVAI----KPRGCYPSSKILISILVSFHYNDNDLHRGLSILDSFIKHYPEV 396
           I+  +  + ++ I    +    YPSSK+L +I+ S+  +D  + R + I++ F K YP++
Sbjct: 249 ISIHDHSTENIKIDHLQQGDAMYPSSKVLATIVSSYARHDQTMKRAVDIVERFAKSYPKL 308

Query: 397 KLDALFWRRLFQLSNFAWTPAKDKKATSVIRCWHLMKQWHVSKGLSLSVDYETLRQLYDI 456
            L+  FW  L    N A      K  +  + CW+LMK+WH  +   +      L  +   
Sbjct: 309 LLNVHFWSTLL---NCAIKCGGSKDPSQFLACWNLMKKWHTQRSKLMPFQSALLVTILRY 365

Query: 457 MKKTGNFPLGIDVLKSFKSGIERLRETNSDKLNIVLIKYQKYIIKQLVDRGRISAVREFI 516
           M++T N    +D+L+ +   +   R    +    VLIKYQK I+++LVD+ + +    FI
Sbjct: 366 MRQTSNLHGTVDILQYWLGPLYLKRGNIPEFERDVLIKYQKQILRKLVDKRKYNWCTAFI 425

Query: 517 NDFGFDRTITKNLNIF 532
           + +  D +  ++L  F
Sbjct: 426 DQWSIDASNKEDLEAF 441

>Ecym_4618 Chr4 complement(1210600..1212183) [1584 bp, 527 aa] {ON}
           similar to Ashbya gossypii ABL119C
          Length = 527

 Score =  119 bits (299), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 91/353 (25%), Positives = 168/353 (47%), Gaps = 25/353 (7%)

Query: 187 RNTTLDACEIFDINLLIRNFIELGQLGKAQKILTFIIDRNPDILLSPNNADIGTMVHFLK 246
           + T     E+ D+N     F+   +L  A+K+L  I+ +     L     D  T+V + +
Sbjct: 147 KKTRFTPMELHDLNKFSNWFLNENKLKLARKVLQQILRQTGSEQLP---RDHQTLVTYFQ 203

Query: 247 LRCGALAAYWKIP--DNSGQDQKQLRKIVRLGAKNTSIRLSSTYKVMDHQTLLKIADLVL 304
           L  G+LA+ W  P   ++  D     K+VR   +   +  +S  + + +  L K+  L  
Sbjct: 204 LYLGSLASLWPTPKVQSACYD-----KLVRGSRRPKYVVYNSLPEGIMYDVLQKL--LEN 256

Query: 305 HEKRFLNSEDLLSTLIQSFGHLGQTQILERCIEHIWHIT------TQEFPSHVAIKPRGC 358
            + + L S +L + ++ S  H  +  + E  +E  W I        +E P  ++    G 
Sbjct: 257 DDWKHLRSSELDAKILYSLCHYNRMDLFEGFMERAWGIVDHPKKVEKEVPVDIS---SGT 313

Query: 359 YPSSKILISILVSFHYNDNDLHRGLSILDSFIKHYPEVKLDALFWRRLFQLSNFAWTPAK 418
           YP S++LI+I+ SF Y  NDL + + ++D+F+  YP++ L   FW +LF  +   +    
Sbjct: 314 YPGSEVLIAIVTSFSYR-NDLEKAVRLVDAFLNKYPQMDLRTEFWEKLFLWTRVMFDRKL 372

Query: 419 DKKATSVIRCWHLMKQWHVSKGLSLSVDYETLRQLYDIMKKTGNFPLGIDVLKSFKSGIE 478
           D   +    CW  M  W+ S+G S+          Y+I+K+T N+   + +   + S + 
Sbjct: 373 DPLGSLQKACWLRMLSWYKSRGESVPYSSYLASCRYEILKQTSNYKDAMAMFPDYMSAV- 431

Query: 479 RLRETNSDKLNIVLI-KYQKYIIKQLVDRGRISAVREFINDFGFDRTITKNLN 530
              ++ + K N+ ++ KYQK++I++L  RG+  A  +FI  + F+    K L 
Sbjct: 432 -YAKSAAAKHNLTVVRKYQKFVIRELSARGKRDACTQFIEQWRFNEENEKELQ 483

>KLLA0D01408g Chr4 (120712..122268) [1557 bp, 518 aa] {ON} weakly
           similar to uniprot|P22136 Saccharomyces cerevisiae
           YMR282C AEP2 Mitochondrial protein likely involved in
           translation of the mitochondrial OLI1 mRNA exhibits
           genetic interaction with the OLI1 mRNA 5'- untranslated
           leader
          Length = 518

 Score =  118 bits (295), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 94/345 (27%), Positives = 168/345 (48%), Gaps = 29/345 (8%)

Query: 192 DACEIFDINLLIRNFIELGQLGKAQKILTFII--DRNPDILLSPNNADIGTMVHFLKLRC 249
           +A  ++D+N  +R FI L  L  A+ +   I+   +N +I       D+ T+  +L+L C
Sbjct: 145 NAMVLYDLNQFVRMFINLNDLPLARNVFQLILKNSKNGEI-----PKDVQTICMYLRLYC 199

Query: 250 GALAAYWKIPDNSGQDQKQLRKIVRLGAKNTSIRLSS-----TYKVMDHQTLLK--IADL 302
           GAL+  W    +    Q  +  +   G+  +SIR+ S     T  V   Q LL+  + D 
Sbjct: 200 GALSELWTTQTSRNFYQDLIGSLS--GSNASSIRIPSHIAYPTIGVPQFQLLLRKLVED- 256

Query: 303 VLHEKRFLNSEDLLSTLIQSFGHLGQTQILERCIEHIW----HITTQEFPSHVAIKPRGC 358
              E   L + ++ S +IQ+ GH  +   L++ I   +    ++T  E  +H  IK    
Sbjct: 257 --PEYSKLRNTEMDSLIIQALGHYKEVPFLKQYISIFYGIDENVTITE--THPGIK--KL 310

Query: 359 YPSSKILISILVSFHYNDNDLHRGLSILDSFIKHYPEVKLDALFWRRLFQLSNFAWTPAK 418
            P S++L S++ ++ +N+N +  G++++ SF++ YPE+ LD  FWR     S   W   K
Sbjct: 311 TPDSQLLKSVISAYGHNNN-ITSGMTVIGSFMEKYPEMNLDKSFWRTTIYWSLREWNKYK 369

Query: 419 DKKATSVIRCWHLMKQWHVSKGLSLSVDYETLRQLYDIMKKTGNFPLGI-DVLKSFKSGI 477
           D K +   + W+LM  W+ + G ++  D + +      +K   +    I DV + FK   
Sbjct: 370 DSKGSQPKKAWNLMLNWYATIGKAVPFDQKIMLYRLSFLKSRKDHNAAIRDVQQVFKRIF 429

Query: 478 ERLRETNSDKLNIVLIKYQKYIIKQLVDRGRISAVREFINDFGFD 522
            +  +       +VL  YQ++IIK LV++   +   +FIN++  D
Sbjct: 430 IKTEKNTFIVERLVLYAYQRFIIKNLVNQNENAKCVDFINEWRID 474

>CAGL0M03069g Chr13 complement(347584..349230) [1647 bp, 548 aa]
           {ON} weakly similar to uniprot|P22136 Saccharomyces
           cerevisiae YMR282c AEP2 required for the expression of
           subunit-9 of atp synthase
          Length = 548

 Score =  118 bits (295), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 112/411 (27%), Positives = 178/411 (43%), Gaps = 47/411 (11%)

Query: 190 TLDACEIFDINLLIRNFIELGQLGKAQKILTFIID----RNPDILLSPNNADIGTMVHFL 245
           ++DA    D+N  I+ FIE  QL +AQ  L F++D    R  D LL P   D  T+ HFL
Sbjct: 161 SVDALNKDDMNKFIKRFIEGSQLKRAQTALQFLLDGYKERGED-LLGPY-GDKQTIAHFL 218

Query: 246 KLRCGALAAYWKIPDNSGQDQKQLRKIVRLGAKNTSIRLSSTYKVMDHQTLLKIADLVL- 304
            LR GAL   WKI  ++G ++KQ    +    +N    + STY V+D   L +I   +L 
Sbjct: 219 MLRSGALQDLWKIDVSNGNNKKQAFYKINGSHRN----VKSTYNVLDSVKLFEIVRYILR 274

Query: 305 ------HEKRFLNSEDLLSTLIQSFGHLGQTQILERCIEHIWHITTQEFPSHVAIKPRGC 358
                 H +     E +L  +I   G++GQT ++E  I  IW + +   P    I     
Sbjct: 275 YNDKDNHSQPVYFDEGILKNVILCLGYVGQTTLIEDIINKIWELDSVSVPPKYNIT---- 330

Query: 359 YPSSKILISILVSFHYNDNDLHRGLSILDSFIKHYPEVKLDALFWRRLFQLSNFAWTPAK 418
             +S +L +I+ ++      +  GL I D F    P + +   FW  L +     W    
Sbjct: 331 -VTSDLLTAIVSAYSKCGKSIQPGLVIADKFFGKIPNIIVKDDFWINLQK-----WNIIL 384

Query: 419 DKKATSVI----RCWHLMKQWHVS--KGLSLSVDYETLRQLYDIMK----KTGNFPLGID 468
             K  S I    R W LMK W  S   G  ++ + E L  +Y ++     K  +     D
Sbjct: 385 PNKWRSTIDLSKRTWELMKSWRNSTNNGGFITANVEFLNLVYKVLSSDYIKLKDLEWIYD 444

Query: 469 VLKSFKSGIERLRETNSDKLNIV--LIKYQKYIIKQLVDRGRISAVREFINDFGFDRTIT 526
           +   F+  +  L   NS  ++ +  L K+Q + IK++V  G  S   +FI ++ +D    
Sbjct: 445 I---FQHSLVTLYSKNSLTVDEIKLLKKFQIFTIKKMVYFGHYSKCLQFIKEWSYDAANK 501

Query: 527 KNL-NIFCTXXXXXXXXXXXXXXXXXXXXXXLEPSGFDDDEDDGMIIGSLW 576
           + L N+F                             +D++E + M++G LW
Sbjct: 502 QQLTNLFVVLRNRYLQKRGYNQEKEMTKV----QKKYDEEEQEDMLLGGLW 548

>KAFR0B03970 Chr2 complement(830202..831626) [1425 bp, 474 aa] {ON}
           Anc_8.847 YMR282C
          Length = 474

 Score =  115 bits (289), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 105/449 (23%), Positives = 184/449 (40%), Gaps = 62/449 (13%)

Query: 131 SLSLAELSFLLNKLYSLRFQIRGICRDIKVKYSEFWFKIFSLYAEKVDAKRNHINLRNTT 190
           ++ L   + L+N   S ++ I+ I    K +  E  F++F  Y + + +        +  
Sbjct: 85  TIDLNRFARLINIALSEKYNIQRI----KERRPEIIFQLFETYVKLISS--------HEE 132

Query: 191 LDACEIFDINLLIRNFIELGQLGKAQKILTFIIDRNPDILLSPNNADIGTMVHFLKLRCG 250
           L   ++ D+N  I  F+E  QL KAQ ++ ++I ++P +L      D+ T  ++LKL CG
Sbjct: 133 LTILQVEDMNKFINYFVEFKQLKKAQLVMKYLILKSPRVL---EKYDVSTTRNYLKLNCG 189

Query: 251 ALAAYWKIPDNSGQDQKQLRKIVRLGAKNTSIRLSSTYKVMD--HQTLLKIADLVLHEKR 308
           A    W                             + YK+ D  + TL K+    L  K 
Sbjct: 190 ACHELW----------------------------YTNYKIFDFNNTTLDKLVKYSLDNK- 220

Query: 309 FLNSEDLLSTLIQSFGHLGQTQILERCIEHIWHITTQEFPSHVAIKPRGCYPSSKILISI 368
            +   D+   +I S G+ G+ + LE  I   W I+         +      P S++L +I
Sbjct: 221 -IGYWDV--EIIHSLGYSGRIRSLEDYILKKWGIS---LCDRAQVNTTNEAPESEVLEAI 274

Query: 369 LVSFHYNDNDLHRGLSILDSFIKHYPEVKLDALFWRRLFQLSNFAWTPAKDKKATSVIRC 428
           +  F Y D  + R + IL+ F+  YP++ L   FW+         W    D+K   ++  
Sbjct: 275 INGFFYRDKRMFRAIKILNEFVNVYPDLNLKITFWKTFMNNCIKEWDEKVDQKGVVIVEY 334

Query: 429 WHLMKQWHVSKGLSLSVDYETLRQLYDIMKKTGNFPLGIDVLKS-FKSGIERLRETNSDK 487
           W  MK+W+      +  +   L+ +    KK  N  L  D+ ++ F +        N  +
Sbjct: 335 WETMKRWYTVHNRRIPFNINFLKVMRTCFKKNNNLVLATDIFQNCFHNFYFCATRMNDSE 394

Query: 488 LNIVLIKYQKYIIKQLVDRGRISAVREFINDFGFDRTITKNLNIFCTXXXXXXXXXXXXX 547
           LN++  +YQ +I+ +L+++   S    FIND  F     + L                  
Sbjct: 395 LNVIK-EYQNFILSRLIEKKGFSNALTFINDHCFSLENKRQL-------MNYYHGRKEHK 446

Query: 548 XXXXXXXXXLEPSGFDDDEDDGMIIGSLW 576
                    LE + +DD  ++  IIG LW
Sbjct: 447 LKKMTRNENLEKT-YDDMVEEDFIIGKLW 474

>NDAI0K00340 Chr11 complement(64928..66802) [1875 bp, 624 aa] {ON}
           Anc_8.847 YMR282C
          Length = 624

 Score =  110 bits (274), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 114/444 (25%), Positives = 197/444 (44%), Gaps = 51/444 (11%)

Query: 169 IFSLYAEKVDAKRNHINLRNTTLDACEIFDINLLIRNFIELGQLGKAQKILTFIIDRNPD 228
           IFSL+    D   N+ N     L+   ++D+N  I+ F+  GQL KAQ +L +IIDR   
Sbjct: 196 IFSLFNICKDEYCNNTN----QLNPLMVYDLNQFIKYFLREGQLKKAQLVLDYIIDRFGG 251

Query: 229 ILLSPNNADIGTMVHFLKLRCGALAAYWKIPDNSGQDQKQLRKIVRLGAKNTSIRLSSTY 288
           I     + D+ T+ + LKL+ GA+   WK P    +    L+  + L  K+ + +    Y
Sbjct: 252 IEQLIKSKDLTTLDNHLKLKNGAIYKNWK-PLTDSESNTFLQYRLSLEDKSHNFKGFKNY 310

Query: 289 KVMDHQTLLKIADLVLHEKRF-LNSEDLLSTLIQSFGHLGQTQILERCIEHIWHITTQEF 347
           K +D  +LLKI D+VL +K   LN   L  +++ S G L Q + +E  I+ IW +   + 
Sbjct: 311 KFLDGWSLLKIIDMVLTDKTHCLNI--LNESILYSLGTLRQIEFMEHFIKQIWDVHPDD- 367

Query: 348 PSHVAIKPR-------GCYPSSKILISILVSFHYNDNDLHRGLSILDSFIKHYPEVKL-- 398
               A++ R          P +  LI+IL S+      + R   +LD  I+ YPE     
Sbjct: 368 ----AVEERNHQLDKYNLPPDTNELIAILTSYCQTYKSMDRAFLLLDKLIQKYPEPMKSR 423

Query: 399 --DALFWRRLFQLS-NFAWTPAKDKKATSVIRCWHLMKQWHVSKGLSLSV-------DYE 448
             D  FW ++ Q     A     +   T++  C  +M++W +      ++       DY 
Sbjct: 424 LNDNKFWIKMLQWGIKIADKNGNNVNGTTIDNCLEIMEEWFLKGKKKTALEHWKIDDDYG 483

Query: 449 T--LRQLYDIMKKTGNFPLGIDVLKSFKSGIERLRETNSDK-----LNIVLIKYQKYIIK 501
           +  +  L++IMK+  N  +G+  +++F   +++L+  + +K     L  VL   QK I +
Sbjct: 484 SILINLLHNIMKERKNVDIGLKAIENF---VQKLKLGSVNKYYERNLTHVLYGLQKCIFR 540

Query: 502 QLVDRGRISAVREFINDFGFDRT--ITKNLNIFCTXXXXXXXXXXXXXXXXXXXXXXLEP 559
           ++ + G  +     I++  + +   +   L  +                         E 
Sbjct: 541 KIAESGSYNKGLALIDNGAYTQNSGVESMLREYYITTVKEIRSKRSRRNKAQSNIQDREQ 600

Query: 560 SGF-------DDDEDDGMIIGSLW 576
             F       D+ E++GMIIG LW
Sbjct: 601 DEFEKLQQKYDEIEEEGMIIGKLW 624

>TBLA0B03310 Chr2 complement(772555..774396) [1842 bp, 613 aa] {ON}
           Anc_8.847 YMR282C
          Length = 613

 Score =  103 bits (258), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 111/459 (24%), Positives = 209/459 (45%), Gaps = 54/459 (11%)

Query: 105 SGSTELDFSKGIS------YLFTKTVDSGPRNSLSLAELSFLLNKLYSL-RFQIRGICRD 157
           S  T +++ K +       YL  K ++      L+   LS ++N L     FQ +   R 
Sbjct: 118 SDGTSINYKKFVDELIQWHYLDAKALNKLVNKHLNDMNLSIVINLLVKYNHFQPKDSDRL 177

Query: 158 IKVKYSEFWFKIFSLYAEKVD------AKRNHINL----RNTTLDACEIFDINLLIRNFI 207
               +SE  FK++ +Y E+++         +HI       +T L+  +++D+N +I  FI
Sbjct: 178 SFKSHSELIFKVYQIYIERIEHPILNSNNNSHIQSIAEHSSTPLNPIQLYDLNKVITWFI 237

Query: 208 ELGQLGKAQKILTFIIDR-NPDILLSPNNADIGTMVHFLKLRCGALAAYWKI-PDNSGQD 265
           + GQL KA   L +I+ R N +I   P   D  T+++FLKL CG L   W+I P N    
Sbjct: 238 KAGQLKKATTALMYILKRYNAEIFQIP---DSKTIINFLKLYCGGLPTNWRIEPINHRFI 294

Query: 266 QKQLRKIVRLGAKNTSIRLSSTYKVMDHQTLLKIA--------DLVLHEK--RFLNSEDL 315
           + Q ++  +LG  ++  RL S+YK +  +  ++I         D+ L  K   F+ + + 
Sbjct: 295 KNQGKRSFKLGNNSSYYRLPSSYKAVYEKVPIQIVEHIKKNTNDMKLSGKLFHFIRTGEF 354

Query: 316 LSTLIQSFGHLGQTQILERCIEHIWHITTQEFPSHVAIKPRGCYPSSKILISILVSFHYN 375
            STLI S   LG+  + E+  +  W          ++        +S I+I+I  S+ YN
Sbjct: 355 DSTLIYSLTSLGRFDLAEQYFKDNW----------LSDSCDDVELTSDIVIAIFSSYVYN 404

Query: 376 D-NDLHRGLSILDSFIKHYPEVKLDALFWRRLFQLSNFAWTPAKDKKATSVIRCWHLMKQ 434
           + N++ +   ++   IK YP++ L+   W R+ + +   W    D         ++ M  
Sbjct: 405 NSNNIEKANKLIQEIIKRYPDLHLNISTWCRIIRWNIQMWDTTTDFNGEIPYDSFYTMLT 464

Query: 435 WHVS--------KGLSLSVDYETLRQLYDIMKKTGNFPLGIDVLKS-FKSGIERLRETNS 485
           ++ +        K   +  +   L  LY +     +    + ++ + FK  + +     +
Sbjct: 465 YYSNYCSRNSTFKSCHIPYNKMLLGDLYHLFNTKISLNKCLFIMDNCFKKSLFKTPSKVT 524

Query: 486 DKLNIVLIKYQKYIIKQLVDRGRISAVR--EFINDFGFD 522
            K   +L+KYQK I+K L++  ++++ +  +FI  +  D
Sbjct: 525 TKDYQILLKYQKMILKYLINDRKLTSNKPLDFIEKYSLD 563

>ABL119C Chr2 complement(175840..177453) [1614 bp, 537 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR282C
           (AEP2)
          Length = 537

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 64/342 (18%), Positives = 138/342 (40%), Gaps = 30/342 (8%)

Query: 196 IFDINLLIRNFIELGQLGKAQKILTFIIDRNPDILLSPNNADIGTMVHFLKLRCGALAAY 255
           + D N   R F+   +L  A+ +   ++    ++   P   D  T++  L+L  GA   +
Sbjct: 187 LHDANSFARWFMAESKLRLARTVFAELVGNPTELAKLPR--DTETIITLLQLHLGAKHIF 244

Query: 256 WKIPDNSGQDQKQLRKIVRLGAKNTSIRLSSTYKVMDHQTLLKIADLVLHEKRFLN--SE 313
           W+ P NS     QL     +        + + Y  +  +TLL++  L+  + ++ +  S 
Sbjct: 245 WRDPGNSVGRGGQLFTPAHMA-------VVTAYNSLGEETLLRLLRLLQSDPQWKSVCSP 297

Query: 314 DLLSTLIQSFGHLGQTQILERCIEHIWHITT--QEFPSHVAIKPRGCYPSSKILISILVS 371
           DL   +I +     +  ++       +         PS   +      P   ++ +++ +
Sbjct: 298 DLDRNIILALAFHNRLDLVHAQAARYYAPAAPGHGLPSTPLL------PDGALVGAVVTA 351

Query: 372 FHYNDNDLHRGLSILDSFIKHYPEVKLDALFWRRLFQLSNFAWT----PAKDKKATSVIR 427
           F +  + L +GL+I   F+  +  +  +   W+ +F      W     P   + A     
Sbjct: 352 FAFK-HQLAQGLAIAYQFLDRFTHLPNEHELWKIIF-----TWLARRHPTGSQGAALYDE 405

Query: 428 CWHLMKQWHVSKGLSLSVDYETLRQLYDIMKKTGNFPLGIDVLKSFKSGIERLRETNSDK 487
            W  M+  +   G     DY   R  Y I+++  +      +L  + S + + +   + +
Sbjct: 406 AWSKMRTRYAEHGQPTPYDYSIARASYRIVRRDSSLRRVRALLNDYMSPLYQ-QPAVAPR 464

Query: 488 LNIVLIKYQKYIIKQLVDRGRISAVREFINDFGFDRTITKNL 529
             ++L+K Q +I+ +LV   R SA  +F++ +  D     +L
Sbjct: 465 DRLLLLKCQAHIVGRLVRARRNSAAADFVDQWALDSEARSHL 506

>KLTH0H14454g Chr8 complement(1260084..1263539) [3456 bp, 1151 aa]
           {ON} similar to uniprot|P47108 Saccharomyces cerevisiae
           YJR041C URB2 Nucleolar protein required for normal
           metabolism of the rRNA primary transcript proposed to be
           involved in ribosome biogenesis
          Length = 1151

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 33/98 (33%), Positives = 50/98 (51%), Gaps = 11/98 (11%)

Query: 262 SGQDQKQLRKIVRLGAKNTSIRLSSTYKVMDHQTLLKIADLVLHEKRFLNSEDLLSTLIQ 321
           SG +Q+QL K + L   +T   L ++Y   DH++L KI  LVLHE    N+ DLL  +++
Sbjct: 543 SGSEQRQLLKDI-LSRWST---LVNSY--FDHESLQKIVRLVLHE----NAIDLLDDIMR 592

Query: 322 SFGHLGQTQILERCI-EHIWHITTQEFPSHVAIKPRGC 358
           S     + QI+   + E    I  ++  S  A  P  C
Sbjct: 593 SDDFFEEEQIIRTLVNEMCEQIQNKDVISRYAKIPIQC 630

>Smik_16.247 Chr16 (449142..451232) [2091 bp, 696 aa] {ON} YPR008W
           (REAL)
          Length = 696

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 42/81 (51%), Gaps = 6/81 (7%)

Query: 454 YDIMKKTGNFPLGIDVLKSFKSGIERLRETNSDKLNIVLIKYQKYIIKQLVDRGRISAVR 513
           + +M+K  N  +G+D+L   K    R+   ++ ++  V +  ++YI   +   GR++   
Sbjct: 250 FTLMEK--NNSMGLDLLGHSK----RISPISNSRVGEVSVPLEEYIPSDIDGVGRVTDKS 303

Query: 514 EFINDFGFDRTITKNLNIFCT 534
             + D+ FD +I +NL+   T
Sbjct: 304 SLVYDWPFDESIERNLSTTAT 324

>NDAI0D00840 Chr4 (189925..190551) [627 bp, 208 aa] {ON} Anc_6.24
          Length = 208

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 38/79 (48%), Gaps = 4/79 (5%)

Query: 51  CVTINDTSTRKSFSTHSMCATGHLNNGN--TPRDYDKFELKGIPIDVYTLRRIISSSGST 108
           CV + D +  KSF          L + N  TP  +  F + G  IDV   ++I+SS+ +T
Sbjct: 85  CVLVYDVTNAKSFENIKSWRDEFLIHANISTPETF-PFVILGNKIDVEESKKIVSSNSAT 143

Query: 109 ELDFSKG-ISYLFTKTVDS 126
           EL  S G I   FT   DS
Sbjct: 144 ELAKSLGDIPLFFTSAKDS 162

>KAFR0E03850 Chr5 complement(764595..765530) [936 bp, 311 aa] {ON} 
          Length = 311

 Score = 32.7 bits (73), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 44/91 (48%), Gaps = 6/91 (6%)

Query: 376 DNDLHR-GLSILDSFIKHYPEVKLDALFWRRLFQLSNFAWTPAKDKKATS---VIRCWHL 431
           D  L R GL  +D ++ H+P V ++A +  +   L  F + P       S    I+ W L
Sbjct: 96  DQSLERLGLDYVDLYLMHWP-VPMEAKY-SKSSSLLEFPYRPDGSLAVESDWDFIKTWEL 153

Query: 432 MKQWHVSKGLSLSVDYETLRQLYDIMKKTGN 462
           M++   +K  ++ V   ++  + D++K  GN
Sbjct: 154 MQELPKTKTRAIGVSNFSINNINDLLKSPGN 184

>TBLA0F01790 Chr6 complement(442568..445861) [3294 bp, 1097 aa] {ON}
           Anc_3.408 YPR097W
          Length = 1097

 Score = 31.6 bits (70), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 38/71 (53%), Gaps = 8/71 (11%)

Query: 125 DSGPRNSLSLAELSFLLNKL-YSLRFQIRGICRDIKVKYSEFWFKIFSLYAEKVDAK--- 180
           DS  +++L    +S  L K+  SLR+ +R I +DI + +SE  F+ F+     +D +   
Sbjct: 387 DSKFKDALDSENVSLPLEKMRTSLRYFLREIVKDIDIAHSELVFQFFNTNV-LIDPRNFT 445

Query: 181 ---RNHINLRN 188
              +  INLRN
Sbjct: 446 QEIKKQINLRN 456

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.139    0.421 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 60,348,483
Number of extensions: 2655749
Number of successful extensions: 9488
Number of sequences better than 10.0: 34
Number of HSP's gapped: 9630
Number of HSP's successfully gapped: 35
Length of query: 576
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 461
Effective length of database: 40,294,809
Effective search space: 18575906949
Effective search space used: 18575906949
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 68 (30.8 bits)