Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_13.4948.846ON30430416220.0
YMR281W (GPI12)8.846ON30430413380.0
Suva_13.4708.846ON30330312481e-174
Skud_13.4538.846ON30030212351e-172
KNAG0J002408.846ON2862986136e-78
TDEL0B005208.846ON2682985873e-74
ZYRO0G14300g8.846ON2802935822e-73
Kpol_1068.48.846ON2913015623e-70
KAFR0B039608.846ON2783005543e-69
SAKL0D01320g8.846ON2602875491e-68
CAGL0M03047g8.846ON3042965478e-68
NDAI0K003308.846ON3133145443e-67
NCAS0C003808.846ON2762925241e-64
TPHA0I002808.846ON3013115121e-62
Kwal_27.102278.846ON2542854769e-58
KLTH0C03740g8.846ON2542864723e-57
ABL120W8.846ON2492844681e-56
Ecym_46178.846ON2492854566e-55
KLLA0D01430g8.846ON2632424491e-53
TBLA0B033008.846ON3193334452e-52
KLTH0D02376g7.81ON108664760.55
SAKL0B09966g7.81ON107764731.3
YPL066W (RGL1)8.530ON47975711.9
Kwal_26.71367.81ON108364702.9
Suva_7.738.151ON12962663.7
Smik_16.1698.530ON48076668.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_13.494
         (304 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_13.494 Chr13 (815351..816265) [915 bp, 304 aa] {ON} YMR281W...   629   0.0  
YMR281W Chr13 (832339..833253) [915 bp, 304 aa] {ON}  GPI12ER me...   520   0.0  
Suva_13.470 Chr13 (815029..815940) [912 bp, 303 aa] {ON} YMR281W...   485   e-174
Skud_13.453 Chr13 (805536..806438) [903 bp, 300 aa] {ON} YMR281W...   480   e-172
KNAG0J00240 Chr10 complement(32153..33013) [861 bp, 286 aa] {ON}...   240   6e-78
TDEL0B00520 Chr2 complement(94560..95366) [807 bp, 268 aa] {ON} ...   230   3e-74
ZYRO0G14300g Chr7 (1145709..1146551) [843 bp, 280 aa] {ON} simil...   228   2e-73
Kpol_1068.4 s1068 complement(6124..6999) [876 bp, 291 aa] {ON} c...   221   3e-70
KAFR0B03960 Chr2 (829312..830148) [837 bp, 278 aa] {ON} Anc_8.84...   218   3e-69
SAKL0D01320g Chr4 complement(99898..100680) [783 bp, 260 aa] {ON...   216   1e-68
CAGL0M03047g Chr13 (346435..347349) [915 bp, 304 aa] {ON} weakly...   215   8e-68
NDAI0K00330 Chr11 (63765..64706) [942 bp, 313 aa] {ON} Anc_8.846...   214   3e-67
NCAS0C00380 Chr3 complement(55971..56801) [831 bp, 276 aa] {ON} ...   206   1e-64
TPHA0I00280 Chr9 (54103..55008) [906 bp, 301 aa] {ON} Anc_8.846 ...   201   1e-62
Kwal_27.10227 s27 complement(249716..250480) [765 bp, 254 aa] {O...   187   9e-58
KLTH0C03740g Chr3 complement(323371..324135) [765 bp, 254 aa] {O...   186   3e-57
ABL120W Chr2 (175065..175814) [750 bp, 249 aa] {ON} Syntenic hom...   184   1e-56
Ecym_4617 Chr4 (1209745..1210494) [750 bp, 249 aa] {ON} similar ...   180   6e-55
KLLA0D01430g Chr4 complement(122369..123160) [792 bp, 263 aa] {O...   177   1e-53
TBLA0B03300 Chr2 (771332..772291) [960 bp, 319 aa] {ON} Anc_8.84...   176   2e-52
KLTH0D02376g Chr4 (238729..241989) [3261 bp, 1086 aa] {ON} some ...    34   0.55 
SAKL0B09966g Chr2 complement(841275..844508) [3234 bp, 1077 aa] ...    33   1.3  
YPL066W Chr16 (426233..427672) [1440 bp, 479 aa] {ON}  RGL1Regul...    32   1.9  
Kwal_26.7136 s26 (229557..232808) [3252 bp, 1083 aa] {ON} YOL051...    32   2.9  
Suva_7.73 Chr7 (140281..140670) [390 bp, 129 aa] {ON} YGL191W (R...    30   3.7  
Smik_16.169 Chr16 (309448..310890) [1443 bp, 480 aa] {ON} YPL066...    30   8.7  

>Smik_13.494 Chr13 (815351..816265) [915 bp, 304 aa] {ON} YMR281W
           (REAL)
          Length = 304

 Score =  629 bits (1622), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/304 (100%), Positives = 304/304 (100%)

Query: 1   MKMPRRVRVNFSKLLYKITKLSIVLTILYIYFTPKIISRNNESLQHVFPNKYSDYQINLI 60
           MKMPRRVRVNFSKLLYKITKLSIVLTILYIYFTPKIISRNNESLQHVFPNKYSDYQINLI
Sbjct: 1   MKMPRRVRVNFSKLLYKITKLSIVLTILYIYFTPKIISRNNESLQHVFPNKYSDYQINLI 60

Query: 61  IAHPDDEVMFFSPMISQLHSYFPNTVPFNIICLSKGNAEGLGQTRVRELNDSAALLLHNE 120
           IAHPDDEVMFFSPMISQLHSYFPNTVPFNIICLSKGNAEGLGQTRVRELNDSAALLLHNE
Sbjct: 61  IAHPDDEVMFFSPMISQLHSYFPNTVPFNIICLSKGNAEGLGQTRVRELNDSAALLLHNE 120

Query: 121 RAVSVQVMDFQDGMNEVWDIDSITSTLSQTIGINNNELNQIIVTFDSYGVSGHINHKSCH 180
           RAVSVQVMDFQDGMNEVWDIDSITSTLSQTIGINNNELNQIIVTFDSYGVSGHINHKSCH
Sbjct: 121 RAVSVQVMDFQDGMNEVWDIDSITSTLSQTIGINNNELNQIIVTFDSYGVSGHINHKSCH 180

Query: 181 TAVRKLIADYTRSNVRKEVKTPLITALYLRSYKNNIVLKYNSFIWEILRMLYGLISPFRK 240
           TAVRKLIADYTRSNVRKEVKTPLITALYLRSYKNNIVLKYNSFIWEILRMLYGLISPFRK
Sbjct: 181 TAVRKLIADYTRSNVRKEVKTPLITALYLRSYKNNIVLKYNSFIWEILRMLYGLISPFRK 240

Query: 241 TTQALPSDVVAEKNSLLLMNTHAQYILAFAAMLNAHKSQVVWFRYGWWILSRFVFVNEFD 300
           TTQALPSDVVAEKNSLLLMNTHAQYILAFAAMLNAHKSQVVWFRYGWWILSRFVFVNEFD
Sbjct: 241 TTQALPSDVVAEKNSLLLMNTHAQYILAFAAMLNAHKSQVVWFRYGWWILSRFVFVNEFD 300

Query: 301 VYIY 304
           VYIY
Sbjct: 301 VYIY 304

>YMR281W Chr13 (832339..833253) [915 bp, 304 aa] {ON}  GPI12ER
           membrane protein involved in the second step of
           glycosylphosphatidylinositol (GPI) anchor assembly, the
           de-N-acetylation of the
           N-acetylglucosaminylphosphatidylinositol intermediate;
           functional homolog of human PIG-Lp
          Length = 304

 Score =  520 bits (1338), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 243/304 (79%), Positives = 273/304 (89%)

Query: 1   MKMPRRVRVNFSKLLYKITKLSIVLTILYIYFTPKIISRNNESLQHVFPNKYSDYQINLI 60
           MKM RR +VNFSKLLYKITKL+IVLTILYIYFTPKI+SRNN SLQH+FP+KY DY+INL+
Sbjct: 1   MKMLRRTKVNFSKLLYKITKLAIVLTILYIYFTPKIVSRNNASLQHIFPHKYGDYEINLV 60

Query: 61  IAHPDDEVMFFSPMISQLHSYFPNTVPFNIICLSKGNAEGLGQTRVRELNDSAALLLHNE 120
           IAHPDDEVMFFSP+ISQL+SYFP TVPFNIICLSKGNAEGLG+TRVRELN+SAALLLHNE
Sbjct: 61  IAHPDDEVMFFSPIISQLNSYFPRTVPFNIICLSKGNAEGLGETRVRELNESAALLLHNE 120

Query: 121 RAVSVQVMDFQDGMNEVWDIDSITSTLSQTIGINNNELNQIIVTFDSYGVSGHINHKSCH 180
           RAVSVQVMDFQDGM+E+WDIDSITS+LSQ I I N+ LNQIIVTFDSYGVS HINHKSC+
Sbjct: 121 RAVSVQVMDFQDGMDEIWDIDSITSSLSQKIDIKNHNLNQIIVTFDSYGVSNHINHKSCY 180

Query: 181 TAVRKLIADYTRSNVRKEVKTPLITALYLRSYKNNIVLKYNSFIWEILRMLYGLISPFRK 240
            AV+KL+ DY +   ++  + P +TALYLRSYKNNIVLKYNSFIWEIL++LY LISPFR+
Sbjct: 181 AAVKKLVDDYAQPKTKRNEQPPHVTALYLRSYKNNIVLKYNSFIWEILKILYDLISPFRR 240

Query: 241 TTQALPSDVVAEKNSLLLMNTHAQYILAFAAMLNAHKSQVVWFRYGWWILSRFVFVNEFD 300
             QALP +  AEK+ L LMNTHAQY+LAFA MLNAH+SQVVWFRYGWWI SRFVFVNEFD
Sbjct: 241 IIQALPPNTAAEKDKLSLMNTHAQYVLAFATMLNAHESQVVWFRYGWWIFSRFVFVNEFD 300

Query: 301 VYIY 304
           VY Y
Sbjct: 301 VYTY 304

>Suva_13.470 Chr13 (815029..815940) [912 bp, 303 aa] {ON} YMR281W
           (REAL)
          Length = 303

 Score =  485 bits (1248), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 228/303 (75%), Positives = 264/303 (87%), Gaps = 1/303 (0%)

Query: 3   MPRRVRVNFSKLLYKITKLSIVLTILYIYFTPKIISRNNESLQHVFPNKYSDYQINLIIA 62
           M +RV+V FSKLL+KITKL+IVLT+LYIYFTPKI+SRN +SLQHVFP++  + QINL+IA
Sbjct: 1   MSKRVKVCFSKLLFKITKLAIVLTVLYIYFTPKILSRNTDSLQHVFPHRDRNSQINLVIA 60

Query: 63  HPDDEVMFFSPMISQLHSYFPNTVPFNIICLSKGNAEGLGQTRVRELNDSAALLLHNERA 122
           HPDDEVMFFSP+ISQLH+YFP+TVPFNI+CLSKG+AEGLG+TR +ELNDSA LLL NER 
Sbjct: 61  HPDDEVMFFSPVISQLHAYFPDTVPFNILCLSKGDAEGLGETRAKELNDSAVLLLRNERP 120

Query: 123 VSVQVMDFQDGMNEVWDIDSITSTLSQTIGINNNELNQIIVTFDSYGVSGHINHKSCHTA 182
           VSVQVMDF+DGM+EVWDIDSITSTLSQTI +NN +++QIIVTFDSYGVS HINHKSCH A
Sbjct: 121 VSVQVMDFEDGMDEVWDIDSITSTLSQTIDVNNEKVSQIIVTFDSYGVSNHINHKSCHIA 180

Query: 183 VRKLIADYTRSNVRKEVKTPLITALYLRSYKNNIVLKYNSFIWEILRMLYGLISPFRKTT 242
           V K I DY  S  +++ +   ITALYLRSYKNNI LKYNSFIWEIL+MLY  +SPF ++ 
Sbjct: 181 VEKFIDDYVGSKTKEKAENAHITALYLRSYKNNIFLKYNSFIWEILKMLYRTVSPFGRSI 240

Query: 243 QALPS-DVVAEKNSLLLMNTHAQYILAFAAMLNAHKSQVVWFRYGWWILSRFVFVNEFDV 301
           Q L +     EKN LLLMNTH+QYILAFAAMLNAHKSQVVWFRYGWWILSRFVFVNEFD+
Sbjct: 241 QPLAAPSTTTEKNGLLLMNTHSQYILAFAAMLNAHKSQVVWFRYGWWILSRFVFVNEFDI 300

Query: 302 YIY 304
           + Y
Sbjct: 301 FTY 303

>Skud_13.453 Chr13 (805536..806438) [903 bp, 300 aa] {ON} YMR281W
           (REAL)
          Length = 300

 Score =  480 bits (1235), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 233/302 (77%), Positives = 264/302 (87%), Gaps = 2/302 (0%)

Query: 3   MPRRVRVNFSKLLYKITKLSIVLTILYIYFTPKIISRNNESLQHVFPNKYSDYQINLIIA 62
           M RRV+VNFSKL+YKITKL+IVLTILYI+FTPKIISRN+E LQHVFP+K  D QINL+IA
Sbjct: 1   MSRRVKVNFSKLVYKITKLAIVLTILYIFFTPKIISRNDELLQHVFPHKNRDSQINLVIA 60

Query: 63  HPDDEVMFFSPMISQLHSYFPNTVPFNIICLSKGNAEGLGQTRVRELNDSAALLLHNERA 122
           HPDDEVMFFSP+ISQLHSYFP TVPFNIICLSKGNA+GLG++RV+ELN SAALLL NER 
Sbjct: 61  HPDDEVMFFSPVISQLHSYFPITVPFNIICLSKGNADGLGESRVKELNGSAALLLQNERP 120

Query: 123 VSVQVMDFQDGMNEVWDIDSITSTLSQTIGINNNELNQIIVTFDSYGVSGHINHKSCHTA 182
           VSVQVMDF+DGM+EVWDI+SI ST+SQTI ++N +LNQIIVTFDSYGVS HINHKSCHTA
Sbjct: 121 VSVQVMDFEDGMDEVWDINSIVSTISQTIDLSNEQLNQIIVTFDSYGVSDHINHKSCHTA 180

Query: 183 VRKLIADYTRSNVRKEVKTPLITALYLRSYKNNIVLKYNSFIWEILRMLYGLISPFRKTT 242
           V++LI  Y  S      +TP ITALYL+SYKNNIVLKYNSFIWEIL++LY +I PF KT 
Sbjct: 181 VKRLIDRYAESKAETNEETPHITALYLKSYKNNIVLKYNSFIWEILKILYSVIVPFPKTI 240

Query: 243 QALPSDVVAEKNSLLLMNTHAQYILAFAAMLNAHKSQVVWFRYGWWILSRFVFVNEFDVY 302
           Q        +++ LLLMNTHAQY+LA+AAMLNAHKSQVVWFRYGWWILSRFVFVNEFDVY
Sbjct: 241 QP--PTTTTQRSKLLLMNTHAQYVLAYAAMLNAHKSQVVWFRYGWWILSRFVFVNEFDVY 298

Query: 303 IY 304
            Y
Sbjct: 299 TY 300

>KNAG0J00240 Chr10 complement(32153..33013) [861 bp, 286 aa] {ON}
           Anc_8.846 YMR281W
          Length = 286

 Score =  240 bits (613), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 135/298 (45%), Positives = 190/298 (63%), Gaps = 21/298 (7%)

Query: 8   RVNFSKLLYKITKLSIVLTILYIYF-TPKIISRNNESLQHVFPNKYSDYQINLIIAHPDD 66
           R NFS+ +YK+TKLS++L ILYIY  T KI S N  +L+ +   ++    +NL+IAHPDD
Sbjct: 3   RFNFSRFIYKVTKLSLLLGILYIYASTSKIGSFNYTNLETL--GEHDINSVNLVIAHPDD 60

Query: 67  EVMFFSPMISQLHSYF--PNTVPFNIICLSKGNAEGLGQTRVRELNDSAALLLHNERAVS 124
           EVMFF+P +  L+     P+TV FNIIC S G A+GLG  R +EL+DS A+LL   R  S
Sbjct: 61  EVMFFAPSLINLNEQIRDPSTV-FNIICFSNGGADGLGNVREQELSDSIAMLLPT-RNTS 118

Query: 125 VQVMDFQDGMNEVWDIDSITSTLSQTI-GINNNELNQIIVTFDSYGVSGHINHKSCHTAV 183
           + V+DF+DGM E WD+  + + L   +  + +N    +++TFD  GVSGH+NH +C+   
Sbjct: 119 IVVLDFKDGMKEKWDVKEMIAKLRNIVPKLGHN----VLLTFDGKGVSGHLNHIACY--- 171

Query: 184 RKLIADYTRSNVRKEVKTPLITALYLRSYKNNIVLKYNSFIWEILRMLYGLISPFRKTTQ 243
           R  +  Y     +++     +T L L+SY  NIV KY+S+IWE++++LY    P R    
Sbjct: 172 RAALGYYNEFKSKQK-----LTVLSLQSYSKNIVKKYSSYIWELIKLLYSSWVPSR-LGN 225

Query: 244 ALPSDVVAEKNSLLLMNTHAQYILAFAAMLNAHKSQVVWFRYGWWILSRFVFVNEFDV 301
            LP         + + +T+ QY+L+ AAMLNAHK+QVVWFRYGWW  SR VFVN+ DV
Sbjct: 226 VLPKRGSNVARKITIFSTYPQYVLSLAAMLNAHKTQVVWFRYGWWFFSRLVFVNDLDV 283

>TDEL0B00520 Chr2 complement(94560..95366) [807 bp, 268 aa] {ON}
           Anc_8.846 YMR281W
          Length = 268

 Score =  230 bits (587), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 129/298 (43%), Positives = 173/298 (58%), Gaps = 33/298 (11%)

Query: 9   VNFSKLLYKITKLSIVLTILYIYFTPKIISRNNESLQHVFPNKYSDYQINLIIAHPDDEV 68
           +N S    K+ KL   L+ILY+  T +I  RN    Q       +   + L+IAHPDDEV
Sbjct: 1   MNVSGGAVKVFKLLFFLSILYVALTARINGRNEVQWQQHAAAIGTPESLTLLIAHPDDEV 60

Query: 69  MFFSPMISQLHSYFPNTVPFNIICLSKGNAEGLGQTRVRELNDSAALLLHN-ERAVSVQV 127
           MFFSP + QL    P +V FN +CLSKG+A+ LG+TR  EL  S  LL  N +R   +  
Sbjct: 61  MFFSPSLLQLDRLLPQSVRFNFVCLSKGDADHLGETRELELQRSLNLLTSNSQRKTQLYQ 120

Query: 128 MDFQDGMNEVWDIDSITSTLSQTIGINNNELNQIIVTFDSYGVSGHINHKSCHTAVRKLI 187
            D+ DG +E W+I+S+ S +   + I +     +++TFD++GVS H NH +CH AV +LI
Sbjct: 121 FDYPDGFDEKWEIESVVSIVESKVFIGSG--FNLLLTFDAHGVSNHPNHVACHNAVARLI 178

Query: 188 ADYTRSNVRKEVKTPLITALYLRSYKNNIVLKYNSFIWEILRMLYGLISPFRKTTQALPS 247
               +             ALYL S+  N+ LKY+ FIWE++RML               S
Sbjct: 179 EKGHK-------------ALYLNSHSRNLPLKYSGFIWELIRML---------------S 210

Query: 248 DVVA--EKNSLLLMNTHAQYILAFAAMLNAHKSQVVWFRYGWWILSRFVFVNEFDVYI 303
           D V   E+  L  MN+  QYILAFAAM NAH+SQ+VWFRYGWW LSRFVFVN+ ++ I
Sbjct: 211 DSVMKLERTGLTFMNSFPQYILAFAAMANAHESQLVWFRYGWWSLSRFVFVNDLEIVI 268

>ZYRO0G14300g Chr7 (1145709..1146551) [843 bp, 280 aa] {ON} similar
           to uniprot|P23797 Saccharomyces cerevisiae YMR281W GPI12
           ER membrane protein involved in the second step of
           glycosylphosphatidylinositol (GPI) anchor assembly the
           de-N-acetylation of the N-
           acetylglucosaminylphosphatidylinositol intermediate
           functional homolog of human PIG-Lp
          Length = 280

 Score =  228 bits (582), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 128/293 (43%), Positives = 180/293 (61%), Gaps = 29/293 (9%)

Query: 17  KITKLSIVLTILYIYFTPKIISRNNESLQHVFPN--KYSDY--QINLIIAHPDDEVMFFS 72
           K  K+  +L +L+I F+ +I SRN      VF +  K+ D    ++L++AHPDDEVMFF+
Sbjct: 6   KFPKVYFLLWVLFIAFSVRIKSRNGS----VFNDNLKFLDEIDSLSLVVAHPDDEVMFFA 61

Query: 73  PMISQLHSYFPNTVPFNIICLSKGNAEGLGQTRVRELNDSAALLLHN-ERAVSVQVMDFQ 131
           P I +L S  P  V FN++CLSKG A+ LG TRV+EL +S  LLL N +R   +Q  D+ 
Sbjct: 62  PTILELDSRLPPNVEFNVVCLSKGGADELGDTRVQELKESVNLLLANSKRQYQLQQHDYP 121

Query: 132 DGMNEVWDIDSITSTLSQTIGINNNELNQIIVTFDSYGVSGHINHKSCHTAVRKLIADYT 191
           DG  E WD +S+ ST+  ++       + +++TFD  GVS H+NH +CH AV  L+ D  
Sbjct: 122 DGHEETWDQESVQSTIKDSVL--QGRRSSVLLTFDDKGVSKHVNHIACHEAVSNLVQD-- 177

Query: 192 RSNVRKEVKTPLITALYLRSYKNNIVLKYNSFIWEILRMLYGLISPFRKTTQALPSDVVA 251
            SNV+         ALYL SY +NIVLKY++F WEI ++            + LP+    
Sbjct: 178 ESNVK--------AALYLDSYGDNIVLKYSAFFWEIWKLTRDWF-----LHRVLPTSSYN 224

Query: 252 EKN---SLLLMNTHAQYILAFAAMLNAHKSQVVWFRYGWWILSRFVFVNEFDV 301
           E      + LM+ ++ YIL+FA+ML++HKSQ+VWFRYGWW  SRFVFVN+  V
Sbjct: 225 ENKPATEITLMSDYSSYILSFASMLHSHKSQMVWFRYGWWTFSRFVFVNDLKV 277

>Kpol_1068.4 s1068 complement(6124..6999) [876 bp, 291 aa] {ON}
           complement(6124..6999) [876 nt, 292 aa]
          Length = 291

 Score =  221 bits (562), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 118/301 (39%), Positives = 178/301 (59%), Gaps = 23/301 (7%)

Query: 9   VNFSKLLYKITKLSIVLTILYIYFTPKIISRNNESLQHVFPNKYS-DYQINLIIAHPDDE 67
           +++   ++K  KL  +L   Y++F   I   N   ++   P  +S    +NL+IAHPDDE
Sbjct: 1   MSWMSFVFKAIKLYFLLWCGYVWFAGAIRGENARQVRG--PGYFSGSSSVNLVIAHPDDE 58

Query: 68  VMFFSPMISQLHSYFPNTVPFNIICLSKG-NAEG--LGQTRVRELNDSAALLLHNERAVS 124
           VMFFSP + QL ++ PN V  N+IC SKG N +G   G++R REL  S ++L+ ++R V+
Sbjct: 59  VMFFSPTLMQLDNWLPNDVAINVICFSKGVNVDGSIAGESRARELKKSVSMLIEHDRPVT 118

Query: 125 VQVMDFQDGMNEVWDIDSITSTLSQTIGINNN-ELNQIIVTFDSYGVSGHINHKSCHTAV 183
           V  +D++DG +++WD+DS+   L   I  + + +   +++TFD +GVS H NH +CH AV
Sbjct: 119 VHQLDYKDGKDQIWDLDSMVWDLKTLINPSKDYKRKDLLITFDEHGVSDHPNHIACHNAV 178

Query: 184 RKLIADYTRSNVRKEVKTPLITALYLRSYKNNIVLKYNSFIWEILRMLYGLISPFRKTTQ 243
            +LI +            PL  A  L S+  N++LKY+ F  EI++  Y       K   
Sbjct: 179 HRLIEE-----------EPLFMAYQLESHSTNVILKYSFFAREIVKYFYNYCHQRIKGQT 227

Query: 244 ALPS--DVVAEKNSLLLMNTHAQYILAFAAMLNAHKSQVVWFRYGWWILSRFVFVNEFDV 301
           +L    DV  E    +L NTH++YI+A+A MLNAH+SQVVWFRYGWW  SR  + NE  +
Sbjct: 228 SLNKNMDVPYE---YVLFNTHSEYIMAYATMLNAHESQVVWFRYGWWFFSRLTYANELKL 284

Query: 302 Y 302
           +
Sbjct: 285 F 285

>KAFR0B03960 Chr2 (829312..830148) [837 bp, 278 aa] {ON} Anc_8.846
           YMR281W
          Length = 278

 Score =  218 bits (554), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 120/300 (40%), Positives = 171/300 (57%), Gaps = 27/300 (9%)

Query: 9   VNFSKLLYKITKLSIVLTILYIYFTPKIISRNNESLQHVFP----NKYSDYQINLIIAHP 64
           ++ SKL++KITKL+++   LYI  +PKI   N++ L    P    ++ +D  + L++AHP
Sbjct: 2   IHISKLIFKITKLTLIFWCLYIVLSPKIQLSNDQILNTFIPSLIKDRSNDPSLTLVVAHP 61

Query: 65  DDEVMFFSPMISQLHSYFPNTVPFNIICLSKGNAEGLGQTRVRELNDSAALLLHNERAVS 124
           DDEVMFFSP + QL S+ P    FNII  S G+AEGLG  R  EL  S  +L+   R   
Sbjct: 62  DDEVMFFSPTLLQLDSHLPPNCKFNIISYSDGDAEGLGSLRSNELAHSIDMLI-PRRNKE 120

Query: 125 VQVMDFQDGMNEVWDIDSITSTLSQTIGINNNELNQIIVTFDSYGVSGHINHKSCHTAVR 184
           + + +  DGMNEVWD   +   L Q   I ++    I++TFD +GVS HINHK+CH  V 
Sbjct: 121 IFIFNHTDGMNEVWDNKLM---LHQLESILSDSQTNILLTFDQFGVSNHINHKACHQVVT 177

Query: 185 KLIADYTRSNVRKEVKTPLITALYLRSYKNNIVLKYNSFIWEILRMLYGLISPFRKTTQA 244
             I  + ++N           AL L SY +N++ KY  F W+++         F      
Sbjct: 178 SYIQSHAKNNF----------ALLLDSYSSNLLKKYTGFAWQLV---------FLAKNYW 218

Query: 245 LPSDVVAEKNSLLLMNTHAQYILAFAAMLNAHKSQVVWFRYGWWILSRFVFVNEFDVYIY 304
           +    +   + L L N ++ YI A+A ML AHKSQ+VWFRYGWW  SRFV+VN+  +Y +
Sbjct: 219 IHGKTLPNLDHLALFNPYSDYITAYATMLKAHKSQMVWFRYGWWFFSRFVYVNDLKLYTH 278

>SAKL0D01320g Chr4 complement(99898..100680) [783 bp, 260 aa] {ON}
           similar to uniprot|P23797 Saccharomyces cerevisiae
           YMR281W GPI12 ER membrane protein involved in the second
           step of glycosylphosphatidylinositol (GPI) anchor
           assembly the de-N-acetylation of the N-
           acetylglucosaminylphosphatidylinositol intermediate
           functional homolog of human PIG-Lp
          Length = 260

 Score =  216 bits (549), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 116/287 (40%), Positives = 173/287 (60%), Gaps = 33/287 (11%)

Query: 13  KLLYKITKLSIVLTILYIYFTPKIISRNNESLQHVFPNKYSDYQINLIIAHPDDEVMFFS 72
           +++ K+ K   +L++LYI  + +I + N +  ++VFP++ +   +NLI+AHPDDE MFFS
Sbjct: 5   EVVAKLLKAYALLSVLYICVSQRIAAHNRQVFRNVFPSR-TPTSVNLIVAHPDDETMFFS 63

Query: 73  PMISQLHSYFPNTVPFNIICLSKGNAEGLGQTRVRELNDSAALLLHNERAVSVQVMDFQD 132
           P + QLH  +P +VP  +ICL+ G+A+GLG  R +EL  S  LLL   R  SV V  F+D
Sbjct: 64  PTLLQLHVNYPPSVPLRVICLTNGDADGLGAVREQELRLSMQLLL-PARNTSVIVEGFED 122

Query: 133 GMNEVWDIDSITSTLSQTIGINNNELNQIIVTFDSYGVSGHINHKSCHTAVRKLIADYTR 192
           GM   WD   + +T+++ +    ++ + +++TFD +GVSGH+NH SC+TAV  L+     
Sbjct: 123 GMGVEWDTRQVVATINRHV----SDASPLLLTFDEHGVSGHVNHVSCNTAVSALVE---- 174

Query: 193 SNVRKEVKTPLITALYLRSYKNNIVLKYNSFIWEILRMLYGLISPFRKTTQALPSDVVAE 252
              ++E +    TALYL S K     KY SF  ++ R++ G   P               
Sbjct: 175 ---QREQREQRFTALYLNS-KRYFPPKYGSFAVDLARIITGRQPP--------------- 215

Query: 253 KNSLLLMNTHAQYILAFAAMLNAHKSQVVWFRYGWWILSRFVFVNEF 299
               + M+T  QY+L+ AAM NAH SQ+VWFR+GWW+ SRFVFVNE 
Sbjct: 216 ----VFMSTFPQYLLSLAAMCNAHVSQMVWFRWGWWLASRFVFVNEL 258

>CAGL0M03047g Chr13 (346435..347349) [915 bp, 304 aa] {ON} weakly
           similar to uniprot|P23797 Saccharomyces cerevisiae
           YMR281w GPI12 N-acetylglucosaminyl phosphatidylinositol
           deacetylase
          Length = 304

 Score =  215 bits (547), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 123/296 (41%), Positives = 178/296 (60%), Gaps = 21/296 (7%)

Query: 11  FSKLLYKITKLSIVLTILYIYFTPKIISRNNESLQHVFPNKYSDYQINLIIAHPDDEVMF 70
           FSKLL+K+TKL+I+  +LYIYFTPK+   N E+L  + P   +   +NL+IAHPDDE+MF
Sbjct: 18  FSKLLFKLTKLTIIFQVLYIYFTPKVEDLNKENLTKLLPTHDNFGVLNLVIAHPDDEIMF 77

Query: 71  FSPMISQLHSYFPNTVPFNIICLSKGNAEGLGQTRVRELNDSAALLL--HNERAVSVQVM 128
           FSP I QL  +       N++CLS G+A+GLG+ R +EL D+   L    N R VS+ ++
Sbjct: 78  FSPTILQLIDHVQE---LNVVCLSNGDADGLGELRAKELKDAIGYLTVNRNLRNVSLNIL 134

Query: 129 DFQDGMNEVWDIDSITSTLSQTIGINNNELNQ--IIVTFDSYGVSGHINHKSCHTAVRKL 186
           D+ DG NEVW    + + L + I  +   + Q  II+TFD  G+SGH NH +C+  V   
Sbjct: 135 DYTDGQNEVW--SGVATDLKKYILTSEPGVKQKDIILTFDREGISGHRNHIACNEGVISY 192

Query: 187 IADYTRSNVRKEVKTPLITALYLRSYKN-NIVLKYNSFIWEILRMLYGLISPFRKT-TQA 244
           +         K +K+     L L+S     I+ KY+  + ++L ++Y  I    KT    
Sbjct: 193 L---------KTIKSNSFVFLELKSLSTWQIISKYSGVVPKLLEIIYNKIRASNKTFVSY 243

Query: 245 LPS-DVVAEKNSLLLMNTHAQYILAFAAMLNAHKSQVVWFRYGWWILSRFVFVNEF 299
           LP+ D +A  +++  ++T  QY L+FAAM  AHKSQ+VWFRY WW  SR+VFVN+ 
Sbjct: 244 LPNRDSIATDSNVCFISTFDQYALSFAAMCYAHKSQMVWFRYLWWSFSRYVFVNDL 299

>NDAI0K00330 Chr11 (63765..64706) [942 bp, 313 aa] {ON} Anc_8.846
           YMR281W
          Length = 313

 Score =  214 bits (544), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 125/314 (39%), Positives = 190/314 (60%), Gaps = 33/314 (10%)

Query: 7   VRVNFSKLLYKITKLSIVLTILYIYFTPKIISRNNESLQHVFPNK-------YSDY---- 55
           + + FSK  YK  KL ++L + Y+  T KI S N +S  +   N+       ++D     
Sbjct: 1   MSLRFSKFTYKSFKLFLLLWMFYMISTQKISSYNKKSFDNSVLNQILRQDHSHADISEPI 60

Query: 56  -QINLIIAHPDDEVMFFSPMISQLHSYFPNTVPFNIICLSKGNAEGLGQTRVRELNDSAA 114
            Q++L+IAHPDDE+MFF+P + QL+ + P ++PFNIIC S G+AEGLG  R +EL+DS  
Sbjct: 61  TQLSLVIAHPDDELMFFAPTLLQLNRFLPTSIPFNIICFSDGDAEGLGYLRRKELHDSIN 120

Query: 115 LLL--HNERAVSVQVMDFQDGMNEVWDIDSITSTLSQTIGIN--NNELNQIIVTFDSYGV 170
           LLL   N R +++ ++DF DGM++VWD   + S+L   + +N   +  N I++TFD+ G+
Sbjct: 121 LLLSSSNNRKINISILDFIDGMDQVWDGKQLLSSLQNELLVNVPPSIKNNILLTFDANGI 180

Query: 171 SGHINHKSCHTAVRKLIADYTRSNVRKEVKTPLITALYLRSYKN------NIVLKYNSFI 224
           S H NH +C+ AV  LI+        KE+    I  L L S  +      N++ KY  F+
Sbjct: 181 SNHPNHIACNKAVHDLIS--YDGGKDKEMN---IIGLMLSSKSDEYNIVMNLLSKYTFFV 235

Query: 225 WEILRMLYGLISPFRKTTQALPSDVVAEKNSLLLMNTHAQYILAFAAMLNAHKSQVVWFR 284
            +++++ + L +    T   +P+    E   L  +NT++QYIL++A+MLN HKSQ+VWFR
Sbjct: 236 IDLVKVYWNLAT---GTFNTIPNSASLE---LSFINTYSQYILSYASMLNTHKSQMVWFR 289

Query: 285 YGWWILSRFVFVNE 298
           YGWW  SRFVF N+
Sbjct: 290 YGWWWFSRFVFSND 303

>NCAS0C00380 Chr3 complement(55971..56801) [831 bp, 276 aa] {ON}
           Anc_8.846 YMR281W
          Length = 276

 Score =  206 bits (524), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 122/292 (41%), Positives = 175/292 (59%), Gaps = 26/292 (8%)

Query: 11  FSKLLYKITKLSIVLTILYIYFTPKIISRNNESLQHVFPNKYSD-YQINLIIAHPDDEVM 69
           FSKL++K+TKL +VL +LY+  + +I   N  +   +    + +   +NL+IAHPDDEVM
Sbjct: 8   FSKLIFKVTKLFLVLWLLYLLSSNRIEQFNTLNYSQLNTKIFHEGTTLNLVIAHPDDEVM 67

Query: 70  FFSPMISQLHSYFPNTVPFNIICLSKGNAEGLGQTRVRELNDSAALLLHNERAVSVQVMD 129
           FF+P + QL +  P ++P N+IC S G+A+GLG+ R  EL  S   L+ N+R  +V V+ 
Sbjct: 68  FFAPTLLQLDNLMPLSIPINVICFSNGDAQGLGEKRQHELQSSIHALIQNQRQTNVTVLH 127

Query: 130 FQDGMNEVWDIDSITSTLSQTIGINNNELNQIIVTFDSYGVSGHINHKSCHTAVRKLIAD 189
           FQDG +++WDID +T  L Q         +Q  +TFDS+GVSGH NH +CH AV  L   
Sbjct: 128 FQDGNDQIWDIDQMTQYLPQND-------HQAFLTFDSHGVSGHKNHIACHNAVWNL--K 178

Query: 190 YTRSNVRKEVKTPLITALYLRSYKNNIVLKYNSFIWEILRMLYGLISPFRKTTQALPSDV 249
            T +NV         T L L S  ++++ KY  FI +++++ + L        Q  P   
Sbjct: 179 NTNNNV---------TILTLDSIHHSLLAKYTFFIIDLVKLYWNLWKD-----QQQPQWE 224

Query: 250 VAEKNSLLLMNTHAQYILAFAAMLNAHKSQVVWFRYGWWILSRFVFVNEFDV 301
             +K  +   N ++QYILA++ MLNAHKSQVVWFRYGWW  SRFVF N   +
Sbjct: 225 SHDK--ITFFNAYSQYILAYSTMLNAHKSQVVWFRYGWWAFSRFVFSNHLKI 274

>TPHA0I00280 Chr9 (54103..55008) [906 bp, 301 aa] {ON} Anc_8.846
           YMR281W
          Length = 301

 Score =  201 bits (512), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 119/311 (38%), Positives = 176/311 (56%), Gaps = 38/311 (12%)

Query: 14  LLYKITKLSIVLTILYIYFTPKIISRNNESLQHVFPNKYSDYQ----------INLIIAH 63
           +L+K+ K   +L+ILYI+ TP I   N +S        YS+ Q          +NLIIAH
Sbjct: 3   ILFKLFKCYCILSILYIWLTPHIEDLNLKSF-------YSNVQLNISQQSLKSVNLIIAH 55

Query: 64  PDDEVMFFSPMISQLHSYFPNTVPFNIICLSKG---NAEGLGQTRVRELNDSAALLLHNE 120
           PDDEVMFF+P + QL    P  VPFN+ICLSKG   +   +G  R  E+ DS  +LL + 
Sbjct: 56  PDDEVMFFTPTLLQLDDILPTHVPFNVICLSKGVDVDGRAVGDLRSNEIMDSLTMLLGHR 115

Query: 121 RA-----VSVQVMDFQDGMNEVWDIDSITSTLSQTIGINNN--ELNQIIVTFDSYGVSGH 173
           RA     V +   +++DGM++ WDI  + + +  TI + +N   L   ++TFD+ GVS H
Sbjct: 116 RAGLNREVKLHQFEYEDGMDKQWDISKVVTDIQNTISMESNVDGLKHWLLTFDAQGVSEH 175

Query: 174 INHKSCHTAVRKLIADYTRSNVRKEVKTPLITALYLRSYKNNIVLKYNSFIWEILRMLYG 233
            NH +C+ A+  L         +K         + L SY +NI+LKY+SF+  + ++L  
Sbjct: 176 PNHIACYDAMMTL--------KQKSSNPGDYLLMTLNSYGSNIILKYSSFLPVVFKLLIN 227

Query: 234 LIS-PFR--KTTQALPSDVVAEKNSLLLMNTHAQYILAFAAMLNAHKSQVVWFRYGWWIL 290
           +I+  FR  +  Q     +  E + +  +NT   YI+A ++MLN+H SQ+VWFRYGWW  
Sbjct: 228 IINDKFRIFELKQVPFLSMHKEHDQIQFINTFPHYIMALSSMLNSHTSQMVWFRYGWWSF 287

Query: 291 SRFVFVNEFDV 301
           SRFVFVN+  +
Sbjct: 288 SRFVFVNDLHI 298

>Kwal_27.10227 s27 complement(249716..250480) [765 bp, 254 aa] {ON}
           YMR281W (GPI12) -
           N-acetylglucosaminylphosphatidylinositol de-N-acetylase
           [contig 39] FULL
          Length = 254

 Score =  187 bits (476), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 105/285 (36%), Positives = 161/285 (56%), Gaps = 37/285 (12%)

Query: 18  ITKLSIVLTILYIYFTPKIISRNNESLQHVFPNKYSDYQINLIIAHPDDEVMFFSPMISQ 77
           + K+S +L ++YI  + +I   N  +L  +F    +   INL+IAHPDDEVMFF+P + Q
Sbjct: 7   VFKVSGILWLVYILGSVQIERSNRRALGSLFRGS-APTSINLVIAHPDDEVMFFAPTLLQ 65

Query: 78  LHSYFPNTVPFNIICLSKGNAEGLGQTRVRELNDSAALLLHNERAVSVQVMDFQDGMNEV 137
           +  + P ++  N+I L+ G A+GLG  R +EL D   LLL   +A SV+V+DF DGM+  
Sbjct: 66  IDEWLPGSIEVNVISLTDGGADGLGDLRTKELQDCVRLLLRKRKA-SVEVLDFLDGMDVE 124

Query: 138 WDIDSITSTLSQTIGINNNELNQIIVTFDSYGVSGHINHKSCHTAVRKLIADYTRSNVRK 197
           WD++     L + I     + + + +TFD  G+SGH+NH SC+ AV+K+   Y++S+  K
Sbjct: 125 WDLERAVKALQERI----LDESPLFLTFDENGISGHVNHISCYKAVQKVRKHYSKSSCFK 180

Query: 198 EVKTPLITALYLRSYKNNIVLKYNSFIWEILRMLYGLISPFRKTTQALPSDVVAEKNSLL 257
                L++  YL         KY+ FI  +          F     + PS          
Sbjct: 181 -----LVSKRYLFE-------KYSGFIPAL----------FHSFISSSPST--------- 209

Query: 258 LMNTHAQYILAFAAMLNAHKSQVVWFRYGWWILSRFVFVNEFDVY 302
           L+N+  QY+LA ++M+NAH SQ+VWFRYGWW+ S +V+ NE   +
Sbjct: 210 LINSFRQYLLALSSMMNAHVSQMVWFRYGWWLFSYYVYANELQAF 254

>KLTH0C03740g Chr3 complement(323371..324135) [765 bp, 254 aa] {ON}
           weakly similar to uniprot|P23797 Saccharomyces
           cerevisiae YMR281W GPI12 ER membrane protein involved in
           the second step of glycosylphosphatidylinositol (GPI)
           anchor assembly the de-N-acetylation of the N-
           acetylglucosaminylphosphatidylinositol intermediate
           functional homolog of human PIG-Lp
          Length = 254

 Score =  186 bits (472), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 107/286 (37%), Positives = 155/286 (54%), Gaps = 37/286 (12%)

Query: 13  KLLYKITKLSIVLTILYIYFTPKIISRNNESLQHVFPNKYSDYQINLIIAHPDDEVMFFS 72
           ++L  + KL  VL ILY   + +I + N ++   +F +  +   INL+IAHPDDEVMFF+
Sbjct: 2   RILKVVCKLLAVLCILYFASSARIKASNEQAFTTLF-SVLNPTSINLVIAHPDDEVMFFA 60

Query: 73  PMISQLHSYFPNTVPFNIICLSKGNAEGLGQTRVRELNDSAALLLHNERAVSVQVMDFQD 132
           P + QL  YF   +P ++  L+ G A+GLG+ R  EL DS  LL    +A  V V++F+D
Sbjct: 61  PTLLQLDHYFDTDIPVSVFSLTDGGADGLGKLREEELRDSVHLLFRRRKA-EVTVLNFED 119

Query: 133 GMNEVWDIDSITSTLSQTIGINNNELNQIIVTFDSYGVSGHINHKSCHTAVRKLIADYTR 192
           GM   WD+   +  L + + + +  L    +TFD +GVS HINH SC+  VR L A +  
Sbjct: 120 GMKVEWDLQKTSEALRKQV-VGDQPL---FLTFDDHGVSSHINHISCYETVRNLRAAHPE 175

Query: 193 SNVRKEVKTPLITALYLRSYKNNIVLKYNSFIWEILRMLYGLISPFRKTTQALPSDVVAE 252
           S              +  + K +I  KY +F+         LI+  R + QA        
Sbjct: 176 SRS------------FSLTSKRSIFQKYTAFV-------PSLITVLRGSRQA-------- 208

Query: 253 KNSLLLMNTHAQYILAFAAMLNAHKSQVVWFRYGWWILSRFVFVNE 298
               + M+T  QY+LA + M+NAH SQ+VWFRYGWW  S +VF NE
Sbjct: 209 ----VFMSTFKQYLLALSVMMNAHTSQMVWFRYGWWFFSCYVFANE 250

>ABL120W Chr2 (175065..175814) [750 bp, 249 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR281W (GPI12)
          Length = 249

 Score =  184 bits (468), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 98/284 (34%), Positives = 156/284 (54%), Gaps = 40/284 (14%)

Query: 16  YKITKLSIVLTILYIYFTPKIISRNNESLQHVFPNKYSDYQINLIIAHPDDEVMFFSPMI 75
           + + KL ++L  +Y +   ++   N +  + +         + L+IAHPDDEVMFF+P +
Sbjct: 6   FAVVKLYLLLLAVYCWSRRRLERHNTQVFERLVGGDSQHTSLTLVIAHPDDEVMFFAPTL 65

Query: 76  SQLHSYFPNTVPFNIICLSKGNAEGLGQTRVRELNDSAALLLHNERAVSVQVMDFQDGMN 135
            QL +  P  +PF ++CL+ G AEGLGQ R  EL  +  LL+  E  V+++V DF DGM 
Sbjct: 66  LQLDARLPAWMPFRVVCLTDGGAEGLGQLRRAELQKALRLLV-LEHDVTLEVADFTDGMK 124

Query: 136 EVWDIDSITSTLSQTIGINNNELNQIIVTFDSYGVSGHINHKSCHTAVRKLIADYTRSNV 195
           E WD+  + + L + +     +   +++TFD  GVSGH NH  C  A  +L         
Sbjct: 125 EDWDLAEVRTRLGELV----TDAKPLVLTFDERGVSGHRNHIGCALAAARL--------- 171

Query: 196 RKEVKTPLITALYLRSYKNNIVLKYNSFIWEILRMLYGLISPFRKTTQALPSDVVAEKNS 255
               KT     L+LRS + N++ KY+ F+ ++ R+++G   P                  
Sbjct: 172 --GHKT-----LFLRS-ERNLLRKYSFFVLDVFRVVFGTPPP------------------ 205

Query: 256 LLLMNTHAQYILAFAAMLNAHKSQVVWFRYGWWILSRFVFVNEF 299
            + ++T AQY+ A  AM+ AH+SQ+VWFR+GWW+ SR+V+ NE+
Sbjct: 206 TVFVSTLAQYLHALVAMVVAHRSQMVWFRWGWWMASRYVYANEY 249

>Ecym_4617 Chr4 (1209745..1210494) [750 bp, 249 aa] {ON} similar to
           Ashbya gossypii ABL120W
          Length = 249

 Score =  180 bits (456), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 99/285 (34%), Positives = 160/285 (56%), Gaps = 40/285 (14%)

Query: 15  LYKITKLSIVLTILYIYFTPKIISRNNESLQHVFPNKYSDYQINLIIAHPDDEVMFFSPM 74
            + + KL +VL  +Y      + + N++  +++  +  +   + LIIAHPDDEVMFF+P 
Sbjct: 5   FFAVIKLYLVLLAVYCGSYKHLETHNSKVYEYLVGSHGNYTSVTLIIAHPDDEVMFFAPT 64

Query: 75  ISQLHSYFPNTVPFNIICLSKGNAEGLGQTRVRELNDSAALLLHNERAVSVQVMDFQDGM 134
           + QL +    +VPF ++CL+ G+A+GLG+ R REL+ +  LL+  ER V +Q+  F+DGM
Sbjct: 65  LLQLDARMAQSVPFRVVCLTDGDADGLGEVRRRELHKALRLLV-LERDVEIQMGGFKDGM 123

Query: 135 NEVWDIDSITSTLSQTIGINNNELNQIIVTFDSYGVSGHINHKSCHTAVRKLIADYTRSN 194
           +E W ++ +   L+Q +     +   +++TFD  GVSGH NH +C  A  KL   +T   
Sbjct: 124 DEEWKMEVVREELAQVV----TDRRPLVLTFDERGVSGHRNHIACAHAAAKL-GHHT--- 175

Query: 195 VRKEVKTPLITALYLRSYKNNIVLKYNSFIWEILRMLYGLISPFRKTTQALPSDVVAEKN 254
                       L+L S  +N++ KY+ F  ++ R+L+G   P                 
Sbjct: 176 ------------LHLDS-GHNLIRKYSFFFVDLFRLLFGYPMP----------------- 205

Query: 255 SLLLMNTHAQYILAFAAMLNAHKSQVVWFRYGWWILSRFVFVNEF 299
             + ++T +QY+ +   ML AHKSQ+VWFR+GWW  SR+V+ NEF
Sbjct: 206 -TVFLSTFSQYLHSLVTMLVAHKSQMVWFRWGWWTASRYVYANEF 249

>KLLA0D01430g Chr4 complement(122369..123160) [792 bp, 263 aa] {ON}
           similar to uniprot|Q75DZ3 Ashbya gossypii ABL120W
           ABL120Wp and weakly similar to YMR281W uniprot|P23797
           Saccharomyces cerevisiae YMR281W GPI12 ER membrane
           protein involved in the second step of
           glycosylphosphatidylinositol (GPI) anchor assembly the
           de- N-acetylation of the N-
           acetylglucosaminylphosphatidylinositol intermediate
           functional homolog of human PIG-Lp
          Length = 263

 Score =  177 bits (449), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 94/242 (38%), Positives = 136/242 (56%), Gaps = 34/242 (14%)

Query: 57  INLIIAHPDDEVMFFSPMISQLHSYFPNTVPFNIICLSKGNAEGLGQTRVRELNDSAALL 116
           + L++AHPDDEVMFFSP ++Q +   P ++P N++C++ G+A+GLG  R +EL DS  ++
Sbjct: 51  VTLVVAHPDDEVMFFSPTLTQFNELLPISIPINVVCMTAGDADGLGHIRKQELVDSLRIM 110

Query: 117 LHNERAVSVQVMDFQDGMNEVWDIDSITSTLSQTIGINNNELNQIIVTFDSYGVSGHINH 176
            H  R     V+DF+DGM+ VWD   +   L  +I     + N +++TFD +GVSGHINH
Sbjct: 111 FHG-RQFGCDVLDFEDGMDAVWDQVLLEKQLRSSI----PDSNPLVLTFDQFGVSGHINH 165

Query: 177 KSCHTAVRKLIADYTRSNVRKEVKTPLITALYLRSYKNNIVLKYNSFIWEILRMLYGLIS 236
            SC   V KL               P    L+LRS    I +KY++FI  I ++    + 
Sbjct: 166 ISCGRLVEKL---------------PYSHKLHLRS-DQPIYVKYSAFIAGIFQLGISTVY 209

Query: 237 PFRKTTQALPSDVVAEKNSLLLMNTHAQYILAFAAMLNAHKSQVVWFRYGWWILSRFVFV 296
           P     +               ++T  QY+LA +AM  AH SQ+VWFR GWW+ SRF F+
Sbjct: 210 PDYGKPRC-------------FISTLPQYLLAASAMSLAHTSQMVWFRVGWWLFSRFCFI 256

Query: 297 NE 298
           NE
Sbjct: 257 NE 258

>TBLA0B03300 Chr2 (771332..772291) [960 bp, 319 aa] {ON} Anc_8.846
           YMR281W
          Length = 319

 Score =  176 bits (445), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 116/333 (34%), Positives = 177/333 (53%), Gaps = 56/333 (16%)

Query: 9   VNFSKLLYKITKLSIVLTILYIYFTPKIISRNNESL-------------QHVFPNKYSDY 55
           +NFS    +  KL ++  ++YI+ +  I   N++S              QHV  N  S  
Sbjct: 1   MNFSTNEIRTVKLILIFWLIYIFNSNSIKLLNDQSFNYFNKHIQLMSNKQHVKINSLS-- 58

Query: 56  QINLIIAHPDDEVMFFSPMISQLHSYFPNTVPFNIICLSKGNAEGLGQ----TRVRELND 111
              LIIAHPDDE+MFFSP + QL++Y    + FN++CLS+G  +  G      RV ELND
Sbjct: 59  ---LIIAHPDDEIMFFSPTLLQLNNYLEKDIMFNVVCLSQG-LDSTGSFKDPQRVHELND 114

Query: 112 SAALLL-------HNERAVSVQVMDFQDGMNEVWDIDSITSTLSQTIGINNNELNQIIVT 164
           S  LL        HN     +Q +D+ DGM E+W++D I   L Q +   +N +N +++T
Sbjct: 115 SLNLLFNRGSNNEHNRNFKLIQ-LDYTDGMKEIWNMDLIVDDLLQNLNFTDNGIN-LLLT 172

Query: 165 FDSYGVSGHINHKSCHTAVRKLIADYTRSNVRKEVKTPLITALYLRSYKNNIVLKYNSFI 224
           FD  GVS H NH +C+ AV KL+  Y+  +         +  ++L S+  N  LKY+ F+
Sbjct: 173 FDKSGVSNHKNHLACNEAVTKLLK-YSNPDSN-------LIGIFLNSHSKNFFLKYSFFV 224

Query: 225 WEI-----------LRMLYGLISP---FRKTTQALPS-DVVAEKN-SLLLMNTHAQYILA 268
            ++           + + Y    P   F ++ Q +   D+  + N S    N  A+Y+L+
Sbjct: 225 SKLFTIIKLKFFRSISLFYSFCFPNSDFLQSYQIISHYDLNTKTNLSFTFFNPFAKYMLS 284

Query: 269 FAAMLNAHKSQVVWFRYGWWILSRFVFVNEFDV 301
           ++ MLNAH+SQ+VWFRY WWI SRF F+N+  +
Sbjct: 285 YSTMLNAHESQMVWFRYLWWIFSRFAFINDLTI 317

>KLTH0D02376g Chr4 (238729..241989) [3261 bp, 1086 aa] {ON} some
           similarities with uniprot|P19659 Saccharomyces
           cerevisiae YOL051W GAL11 Component of the Mediator
           complex interacts with RNA polymerase II and the general
           transcription factors to form the RNA polymerase II
           holoenzyme affects transcription by acting as target of
           activators and repressors
          Length = 1086

 Score = 33.9 bits (76), Expect = 0.55,   Method: Composition-based stats.
 Identities = 21/64 (32%), Positives = 30/64 (46%), Gaps = 9/64 (14%)

Query: 156 NELNQIIVTFDSYGVSGHINHKSCHTAVRKLIADYTRSNVRKEVKTPLITALYLRSYKNN 215
           N LNQI    +          K+ +   +KLI D  R+N    V TP   A+Y++ Y N 
Sbjct: 344 NRLNQIFTPAE---------QKALYENGKKLIEDLQRTNRLPTVLTPQQQAIYIKKYINQ 394

Query: 216 IVLK 219
           + LK
Sbjct: 395 MALK 398

>SAKL0B09966g Chr2 complement(841275..844508) [3234 bp, 1077 aa]
           {ON} some similarities with uniprot|P19659 Saccharomyces
           cerevisiae YOL051W GAL11 Component of the Mediator
           complex interacts with RNA polymerase II and the general
           transcription factors to form the RNA polymerase II
           holoenzyme affects transcription by acting as target of
           activators and repressors
          Length = 1077

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 30/64 (46%), Gaps = 9/64 (14%)

Query: 156 NELNQIIVTFDSYGVSGHINHKSCHTAVRKLIADYTRSNVRKEVKTPLITALYLRSYKNN 215
           N LNQI    +          K+ +   +KLI D  R+N    + TP   A+Y++ Y N 
Sbjct: 350 NRLNQIFTPGE---------QKALYENGKKLIEDLQRNNRLPNILTPQQQAVYIKKYMNQ 400

Query: 216 IVLK 219
           + LK
Sbjct: 401 MALK 404

>YPL066W Chr16 (426233..427672) [1440 bp, 479 aa] {ON}
           RGL1Regulator of Rho1p signaling, cofactor of Tus1p;
           required for the localization of Tus1p during all phases
           of cytokinesis; green fluorescent protein (GFP)-fusion
           protein localizes to the bud neck and cytoplasm; null
           mutant is viable and exhibits growth defect on a
           non-fermentable (respiratory) carbon source
          Length = 479

 Score = 32.0 bits (71), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 36/75 (48%), Gaps = 19/75 (25%)

Query: 6   RVRVNFSKLLYKITKLSIVLTILYIYFTPKIISRNNESLQHVFPNKYSD----------- 54
           RVR N S L +K+ K+ IVL  + IYF   + S NN S      N+ SD           
Sbjct: 34  RVRSNNS-LPFKLVKIEIVLKTIEIYFNKNLYSSNNSSFTPF--NRPSDPSNGHSDTSNQ 90

Query: 55  -----YQINLIIAHP 64
                Y+ N++++HP
Sbjct: 91  NISIHYKKNIVLSHP 105

>Kwal_26.7136 s26 (229557..232808) [3252 bp, 1083 aa] {ON} YOL051W
           (GAL11) - Component of the RNA polymerase II holoenzyme
           complex, positive and negative transcriptional regulator
           of genes involved in mating-type specialization [contig
           47] FULL
          Length = 1083

 Score = 31.6 bits (70), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 29/64 (45%), Gaps = 9/64 (14%)

Query: 156 NELNQIIVTFDSYGVSGHINHKSCHTAVRKLIADYTRSNVRKEVKTPLITALYLRSYKNN 215
           N LNQI    +          K+ +   +KLI D  R+N    V  P   A+Y++ Y N 
Sbjct: 346 NRLNQIFTPAE---------QKALYENGKKLIEDLQRTNRLPAVLAPQQQAIYIKKYINQ 396

Query: 216 IVLK 219
           + LK
Sbjct: 397 MALK 400

>Suva_7.73 Chr7 (140281..140670) [390 bp, 129 aa] {ON} YGL191W
           (REAL)
          Length = 129

 Score = 30.0 bits (66), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 35/62 (56%), Gaps = 6/62 (9%)

Query: 22  SIVLTILYIYFTPKIISRNNESLQHVFPNKYS-DYQINLIIAHP-----DDEVMFFSPMI 75
           +I LT +  YF  K  + + E L+HV  +++  DY+   I + P      D+ MF++P++
Sbjct: 62  AIALTAVNTYFVEKEHAEHREHLKHVPDSEWPRDYEFMNIRSKPFFWGDGDKTMFWNPVV 121

Query: 76  SQ 77
           ++
Sbjct: 122 NR 123

>Smik_16.169 Chr16 (309448..310890) [1443 bp, 480 aa] {ON} YPL066W
           (REAL)
          Length = 480

 Score = 30.0 bits (66), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 35/76 (46%), Gaps = 15/76 (19%)

Query: 6   RVRVNFSKLLYKITKLSIVLTILYIYFTPKIISRNNESLQHV-----FPNKYSD------ 54
           RVR N S L +K+ K+  VL  + +YF   +   NN S          PN  SD      
Sbjct: 34  RVRSNDS-LPFKLVKIETVLKTIEMYFNRNLYGSNNNSFTPFNRTSDSPNGNSDTNNQNI 92

Query: 55  ---YQINLIIAHPDDE 67
              Y+  ++++HP D+
Sbjct: 93  TVHYRKKIVLSHPTDD 108

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.137    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 32,785,901
Number of extensions: 1400139
Number of successful extensions: 5342
Number of sequences better than 10.0: 41
Number of HSP's gapped: 5461
Number of HSP's successfully gapped: 41
Length of query: 304
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 195
Effective length of database: 40,982,805
Effective search space: 7991646975
Effective search space used: 7991646975
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 65 (29.6 bits)