Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_13.4928.843ON54354323640.0
Skud_13.4518.843ON53954021190.0
YMR279C8.843ON54054021140.0
Suva_13.4678.843ON54354320060.0
NCAS0A02540singletonON53944815080.0
CAGL0M03003g8.843ON55848815010.0
KNAG0J002608.843ON55047414980.0
NDAI0K004008.843ON55348614860.0
NCAS0C004008.843ON51747914590.0
KAFR0B03930singletonON55544814600.0
Smik_13.188.843ON54549014260.0
YML116W (ATR1)8.843ON54248814230.0
KAFR0B039408.843ON54748714170.0
NCAS0B002908.843ON54247814140.0
KNAG0G034308.843ON54249014080.0
NDAI0E002808.843ON54948914070.0
Suva_13.278.843ON55348413950.0
Skud_13.258.843ON53748113910.0
TPHA0C047908.843ON55648613510.0
KAFR0A028408.843ON52044713390.0
TDEL0B005508.843ON53748613171e-177
TBLA0D032708.843ON55049213171e-177
SAKL0D01386g8.843ON52148813071e-176
Kpol_541.168.843ON52848613071e-176
KLTH0C03806g8.843ON52548212841e-172
CAGL0B02343g8.843ON53744912541e-167
Kwal_27.102458.843ON51547512451e-166
TBLA0D03280singletonON58048912361e-164
TBLA0C01160singletonON6004809661e-123
Skud_15.545na 1ON5164807372e-90
Smik_15.560na 1ON5164767215e-88
YOR378Wna 1ON5154767041e-85
Suva_8.435na 1ON5154796999e-85
KLLA0B00352gna 1ON4984516882e-83
KLTH0C10560gna 1ON5154396781e-81
Kwal_23.6547na 1ON5114856613e-79
TDEL0G04950singletonON5124516334e-75
KNAG0D00130na 1ON5654264345e-46
KAFR0C04860na 1ON5344263622e-36
SAKL0C06116gsingletonON1851903393e-36
NCAS0A05720na 1ON5634383376e-33
CAGL0L02519gna 1ON5294233012e-28
NDAI0K02730singletonON6044762731e-24
Skud_6.16na 2ON5494581126e-05
Smik_6.24na 2ON5444541109e-05
Suva_10.11singletonON5404231036e-04
SAKL0F00440gsingletonON544175950.006
TPHA0G031502.473ON60085830.15
KLLA0C18931gna 3ON553144830.15
YMR088C (VBA1)2.473ON56259770.91
Skud_13.2442.473ON56259770.92
Smik_13.2722.473ON56159761.3
Suva_13.2652.473ON56159751.3
NCAS0A078102.473ON56859751.6
Kpol_467.242.473ON37059742.0
KLTH0G13464g8.272ON593229732.5
TDEL0A024902.473ON55444732.6
NDAI0H022002.473ON57144714.0
TPHA0M00120singletonON61992714.6
SAKL0E02992g2.473ON57044714.8
KLTH0H16214gsingletonON55155715.0
Ecym_73992.473ON56387715.1
Kwal_34.15746na 3ON518102705.4
KLLA0F13684g2.473ON57159705.5
ZYRO0G03234g2.473ON56244705.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_13.492
         (543 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_13.492 Chr13 complement(807726..809357) [1632 bp, 543 aa] {...   915   0.0  
Skud_13.451 Chr13 complement(798006..799625) [1620 bp, 539 aa] {...   820   0.0  
YMR279C Chr13 complement(824729..826351) [1623 bp, 540 aa] {ON} ...   818   0.0  
Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {...   777   0.0  
NCAS0A02540 Chr1 complement(481807..483426) [1620 bp, 539 aa] {O...   585   0.0  
CAGL0M03003g Chr13 complement(337942..339618) [1677 bp, 558 aa] ...   582   0.0  
KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.84...   581   0.0  
NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON}               577   0.0  
NCAS0C00400 Chr3 (61257..62810) [1554 bp, 517 aa] {ON} Anc_8.843      566   0.0  
KAFR0B03930 Chr2 complement(816351..818018) [1668 bp, 555 aa] {O...   566   0.0  
Smik_13.18 Chr13 (34422..36059) [1638 bp, 545 aa] {ON} YML116W (...   553   0.0  
YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidr...   552   0.0  
KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {O...   550   0.0  
NCAS0B00290 Chr2 (33760..35388) [1629 bp, 542 aa] {ON} Anc_8.843      549   0.0  
KNAG0G03430 Chr7 complement(734828..736456) [1629 bp, 542 aa] {O...   546   0.0  
NDAI0E00280 Chr5 (37676..39325) [1650 bp, 549 aa] {ON} Anc_8.843      546   0.0  
Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W (...   541   0.0  
Skud_13.25 Chr13 (37872..39485) [1614 bp, 537 aa] {ON} YML116W (...   540   0.0  
TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa] ...   525   0.0  
KAFR0A02840 Chr1 complement(588197..589759) [1563 bp, 520 aa] {O...   520   0.0  
TDEL0B00550 Chr2 (105483..107096) [1614 bp, 537 aa] {ON} Anc_8.8...   511   e-177
TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {O...   511   e-177
SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON} unipro...   508   e-176
Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}...   508   e-176
KLTH0C03806g Chr3 (332195..333772) [1578 bp, 525 aa] {ON} simila...   499   e-172
CAGL0B02343g Chr2 complement(222130..223743) [1614 bp, 537 aa] {...   487   e-167
Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116...   484   e-166
TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {O...   480   e-164
TBLA0C01160 Chr3 complement(246034..247836) [1803 bp, 600 aa] {O...   376   e-123
Skud_15.545 Chr15 (988549..990099) [1551 bp, 516 aa] {ON} YOR378...   288   2e-90
Smik_15.560 Chr15 (995453..997003) [1551 bp, 516 aa] {ON} YOR378...   282   5e-88
YOR378W Chr15 (1049511..1051058) [1548 bp, 515 aa] {ON} Putative...   275   1e-85
Suva_8.435 Chr8 (786917..788464) [1548 bp, 515 aa] {ON} YOR378W ...   273   9e-85
KLLA0B00352g Chr2 (22476..23972) [1497 bp, 498 aa] {ON} highly s...   269   2e-83
KLTH0C10560g Chr3 (875216..876763) [1548 bp, 515 aa] {ON} simila...   265   1e-81
Kwal_23.6547 s23 (1635677..1637212) [1536 bp, 511 aa] {ON} YOR37...   259   3e-79
TDEL0G04950 Chr7 complement(922428..923966) [1539 bp, 512 aa] {O...   248   4e-75
KNAG0D00130 Chr4 complement(6264..7961) [1698 bp, 565 aa] {ON}  ...   171   5e-46
KAFR0C04860 Chr3 (964552..966156) [1605 bp, 534 aa] {ON}  YOR378W     144   2e-36
SAKL0C06116g Chr3 complement(571813..572370) [558 bp, 185 aa] {O...   135   3e-36
NCAS0A05720 Chr1 (1117491..1119182) [1692 bp, 563 aa] {ON}            134   6e-33
CAGL0L02519g Chr12 complement(297555..299144) [1590 bp, 529 aa] ...   120   2e-28
NDAI0K02730 Chr11 complement(612590..614404) [1815 bp, 604 aa] {...   109   1e-24
Skud_6.16 Chr6 (26284..27933) [1650 bp, 549 aa] {ON} YOR378W (REAL)    48   6e-05
Smik_6.24 Chr6 (39520..41154) [1635 bp, 544 aa] {ON} YMR279C (REAL)    47   9e-05
Suva_10.11 Chr10 (18934..20556) [1623 bp, 540 aa] {ON} YOR378W (...    44   6e-04
SAKL0F00440g Chr6 complement(36452..38086) [1635 bp, 544 aa] {ON...    41   0.006
TPHA0G03150 Chr7 (670343..672145) [1803 bp, 600 aa] {ON} Anc_2.4...    37   0.15 
KLLA0C18931g Chr3 (1680133..1681794) [1662 bp, 553 aa] {ON} unip...    37   0.15 
YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON} ...    34   0.91 
Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {...    34   0.92 
Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {...    34   1.3  
Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {...    33   1.3  
NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa] ...    33   1.6  
Kpol_467.24 s467 (55523..56632) [1110 bp, 370 aa] {ON} (55523..5...    33   2.0  
KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]...    33   2.5  
TDEL0A02490 Chr1 (446429..448093) [1665 bp, 554 aa] {ON} Anc_2.4...    33   2.6  
NDAI0H02200 Chr8 complement(536385..538100) [1716 bp, 571 aa] {O...    32   4.0  
TPHA0M00120 Chr13 (23458..25317) [1860 bp, 619 aa] {ON}                32   4.6  
SAKL0E02992g Chr5 complement(243652..245364) [1713 bp, 570 aa] {...    32   4.8  
KLTH0H16214g Chr8 complement(1398230..1399885) [1656 bp, 551 aa]...    32   5.0  
Ecym_7399 Chr7 complement(820280..821971) [1692 bp, 563 aa] {ON}...    32   5.1  
Kwal_34.15746 s34 (37757..39313) [1557 bp, 518 aa] {ON} YGR224W ...    32   5.4  
KLLA0F13684g Chr6 complement(1267367..1269082) [1716 bp, 571 aa]...    32   5.5  
ZYRO0G03234g Chr7 (247798..249486) [1689 bp, 562 aa] {ON} simila...    32   5.8  

>Smik_13.492 Chr13 complement(807726..809357) [1632 bp, 543 aa] {ON}
           YMR279C (REAL)
          Length = 543

 Score =  915 bits (2364), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 457/543 (84%), Positives = 457/543 (84%)

Query: 1   MLPIFKKKMSVQGTDYQIHDKTIMKVDDKXXXXXXXXXXXXXXXXXXXXXXXXDSPWQDP 60
           MLPIFKKKMSVQGTDYQIHDKTIMKVDDK                        DSPWQDP
Sbjct: 1   MLPIFKKKMSVQGTDYQIHDKTIMKVDDKVVISTEDEEVTTVTSSNESNQVTNDSPWQDP 60

Query: 61  IYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSESNNQAWLMASFPLAAG 120
           IYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSESNNQAWLMASFPLAAG
Sbjct: 61  IYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSESNNQAWLMASFPLAAG 120

Query: 121 SFILISGRLGDIYGLKKMXXXXXXXXXXXXXXXXXXKYSNSDAFFITCRAFQGLGIAFIL 180
           SFILISGRLGDIYGLKKM                  KYSNSDAFFITCRAFQGLGIAFIL
Sbjct: 121 SFILISGRLGDIYGLKKMLLIGYVIIIIWSIISGLSKYSNSDAFFITCRAFQGLGIAFIL 180

Query: 181 PNIMGLVGHVYKVGSLRKNLVISVIGACAPAXXXXXXXXXXLIVTEDPEQWPWVFYAFSI 240
           PNIMGLVGHVYKVGSLRKNLVISVIGACAPA          LIVTEDPEQWPWVFYAFSI
Sbjct: 181 PNIMGLVGHVYKVGSLRKNLVISVIGACAPAGGMFGGVFGGLIVTEDPEQWPWVFYAFSI 240

Query: 241 ATFISLLMAWYSIPNNVPTNVHGLSMDWTGSTLAVLGLILFNFVWNQAPIAGWGEAYXXX 300
           ATFISLLMAWYSIPNNVPTNVHGLSMDWTGSTLAVLGLILFNFVWNQAPIAGWGEAY   
Sbjct: 241 ATFISLLMAWYSIPNNVPTNVHGLSMDWTGSTLAVLGLILFNFVWNQAPIAGWGEAYIIV 300

Query: 301 XXXXXXXXXXXXXXYEIKYAEVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYVSFQ 360
                         YEIKYAEVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYVSFQ
Sbjct: 301 LLILSVFFLIAFFVYEIKYAEVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYVSFQ 360

Query: 361 LNLRHYSPVWTGGTYFVFVIFGSIAAFFVAFSIKRLGPAILLCFALMAFDAGSIMFSVLP 420
           LNLRHYSPVWTGGTYFVFVIFGSIAAFFVAFSIKRLGPAILLCFALMAFDAGSIMFSVLP
Sbjct: 361 LNLRHYSPVWTGGTYFVFVIFGSIAAFFVAFSIKRLGPAILLCFALMAFDAGSIMFSVLP 420

Query: 421 VEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLG 480
           VEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLG
Sbjct: 421 VEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLG 480

Query: 481 MGVTVERQINKSGQNLLKGYRXXXXXXXXXXXXXXXXXVTYMLENFWNKHKESEKKRLEA 540
           MGVTVERQINKSGQNLLKGYR                 VTYMLENFWNKHKESEKKRLEA
Sbjct: 481 MGVTVERQINKSGQNLLKGYRAAIYLGIGLASLGLLISVTYMLENFWNKHKESEKKRLEA 540

Query: 541 ETS 543
           ETS
Sbjct: 541 ETS 543

>Skud_13.451 Chr13 complement(798006..799625) [1620 bp, 539 aa] {ON}
           YMR279C (REAL)
          Length = 539

 Score =  820 bits (2119), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/540 (75%), Positives = 430/540 (79%), Gaps = 1/540 (0%)

Query: 1   MLPIFKKKMSVQGTDYQIHDKTIMKVDDKXXXXXXXXXXXXXXXXXXXXXXXXDSPWQDP 60
           MLP F++KMSVQGT   ++DK  MK +DK                        DSPWQDP
Sbjct: 1   MLPSFERKMSVQGTSSPVNDKISMKEEDKVIVSTDEEVTTVASSSKSNQISN-DSPWQDP 59

Query: 61  IYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSESNNQAWLMASFPLAAG 120
            YFSSFGKELMFI TCMLAQLLNQAGQTHALCIMNVLSKSF SESNNQAWLMASFPLAAG
Sbjct: 60  TYFSSFGKELMFIGTCMLAQLLNQAGQTHALCIMNVLSKSFGSESNNQAWLMASFPLAAG 119

Query: 121 SFILISGRLGDIYGLKKMXXXXXXXXXXXXXXXXXXKYSNSDAFFITCRAFQGLGIAFIL 180
           SFILISGRLGDIYGLKKM                  KYSN+D+FFITCRAFQG+GIAFIL
Sbjct: 120 SFILISGRLGDIYGLKKMLMIGYVIIIVWSIISGLSKYSNNDSFFITCRAFQGVGIAFIL 179

Query: 181 PNIMGLVGHVYKVGSLRKNLVISVIGACAPAXXXXXXXXXXLIVTEDPEQWPWVFYAFSI 240
           PNIMGLVGHVYKVGSLRKNLVISVIGAC P           LIVTEDP QWPWVFYAF I
Sbjct: 180 PNIMGLVGHVYKVGSLRKNLVISVIGACGPTGALFGGVFGGLIVTEDPNQWPWVFYAFGI 239

Query: 241 ATFISLLMAWYSIPNNVPTNVHGLSMDWTGSTLAVLGLILFNFVWNQAPIAGWGEAYXXX 300
           ATFIS+LMAWYSIPNNVPTNVHGLSMDWTGS LAV+GLILFNFVWN+APIAGW +AY   
Sbjct: 240 ATFISMLMAWYSIPNNVPTNVHGLSMDWTGSVLAVIGLILFNFVWNEAPIAGWDKAYIIV 299

Query: 301 XXXXXXXXXXXXXXYEIKYAEVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYVSFQ 360
                         YEIKYAEVPLLPHAVTKNRHMIMILLAVF+GWGSFGIWTFYYVSFQ
Sbjct: 300 LLVVSVFFLVAFFVYEIKYAEVPLLPHAVTKNRHMIMILLAVFVGWGSFGIWTFYYVSFQ 359

Query: 361 LNLRHYSPVWTGGTYFVFVIFGSIAAFFVAFSIKRLGPAILLCFALMAFDAGSIMFSVLP 420
           LNLRHYSPVWTGGTYFVF IFG+IAAFFVAFSIKRLGPA+LLCFALMAFDAGSIMFSVLP
Sbjct: 360 LNLRHYSPVWTGGTYFVFAIFGTIAAFFVAFSIKRLGPALLLCFALMAFDAGSIMFSVLP 419

Query: 421 VEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLG 480
           VEQSYWKLNFAMQA+LCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLG
Sbjct: 420 VEQSYWKLNFAMQAVLCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLG 479

Query: 481 MGVTVERQINKSGQNLLKGYRXXXXXXXXXXXXXXXXXVTYMLENFWNKHKESEKKRLEA 540
           MG TVE QINKSG+N+L+GYR                 VTYMLE  WN+ K+ ++K LEA
Sbjct: 480 MGATVEHQINKSGKNVLEGYRAAVYLGIGLASLGVLISVTYMLETVWNERKKCQRKSLEA 539

>YMR279C Chr13 complement(824729..826351) [1623 bp, 540 aa] {ON}
           Putative boron transporter involved in boron efflux and
           resistance; overexpression mutant but not null mutant
           displays boron tolerance phenotype; identified as a
           heat-induced gene in a high-throughout screen; YMR279C
           is not an essential gene; paralog of the efflux pump
           ATR1
          Length = 540

 Score =  818 bits (2114), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/540 (75%), Positives = 426/540 (78%)

Query: 1   MLPIFKKKMSVQGTDYQIHDKTIMKVDDKXXXXXXXXXXXXXXXXXXXXXXXXDSPWQDP 60
           M  IFKKK SVQGTD +I +K  +K  DK                        DSPWQDP
Sbjct: 1   MFSIFKKKTSVQGTDSEIDEKITVKAKDKVVVSTEDEEVTTIVSSTKSTQVTNDSPWQDP 60

Query: 61  IYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSESNNQAWLMASFPLAAG 120
            YFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSE+NNQAWLMASFPLAAG
Sbjct: 61  TYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSEANNQAWLMASFPLAAG 120

Query: 121 SFILISGRLGDIYGLKKMXXXXXXXXXXXXXXXXXXKYSNSDAFFITCRAFQGLGIAFIL 180
           SFILISGRLGDIYGLKKM                  KYSNSDAFFIT RAFQG+GIAFIL
Sbjct: 121 SFILISGRLGDIYGLKKMLIVGYVIVIVWSIISGLSKYSNSDAFFITSRAFQGVGIAFIL 180

Query: 181 PNIMGLVGHVYKVGSLRKNLVISVIGACAPAXXXXXXXXXXLIVTEDPEQWPWVFYAFSI 240
           PNIMGLVGHVYKVGS RKN+VIS IGACAP           LIVTEDP QWPWVFYAF I
Sbjct: 181 PNIMGLVGHVYKVGSFRKNIVISFIGACAPTGGMFGGLFGGLIVTEDPNQWPWVFYAFGI 240

Query: 241 ATFISLLMAWYSIPNNVPTNVHGLSMDWTGSTLAVLGLILFNFVWNQAPIAGWGEAYXXX 300
           ATF+SLLMAWYSIPNNVPTN+HGLSMDWTGS LA++GLILFNFVWNQAPI GW + Y   
Sbjct: 241 ATFLSLLMAWYSIPNNVPTNIHGLSMDWTGSALAIIGLILFNFVWNQAPIVGWDKPYIIV 300

Query: 301 XXXXXXXXXXXXXXYEIKYAEVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYVSFQ 360
                         YE KYAEVPLLP A+TKNRHMIMILLAVFLGWGSFGIWTFYYVSFQ
Sbjct: 301 LLIISVIFLVAFFVYESKYAEVPLLPRAMTKNRHMIMILLAVFLGWGSFGIWTFYYVSFQ 360

Query: 361 LNLRHYSPVWTGGTYFVFVIFGSIAAFFVAFSIKRLGPAILLCFALMAFDAGSIMFSVLP 420
           LNLRHYSPVWTGGTYFVFVIFGS+AAFFVAFSIKRLGPA+LLCF+LMAFDAGSIMFSVLP
Sbjct: 361 LNLRHYSPVWTGGTYFVFVIFGSMAAFFVAFSIKRLGPALLLCFSLMAFDAGSIMFSVLP 420

Query: 421 VEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLG 480
           VEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLG
Sbjct: 421 VEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLG 480

Query: 481 MGVTVERQINKSGQNLLKGYRXXXXXXXXXXXXXXXXXVTYMLENFWNKHKESEKKRLEA 540
           MG TVE QINKSG +LLKGYR                 VTYMLEN WN+H++SE + LEA
Sbjct: 481 MGGTVEHQINKSGNDLLKGYRAAVYLGVGLASLGVVISVTYMLENLWNRHRKSEDRSLEA 540

>Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {ON}
           YMR279C (REAL)
          Length = 543

 Score =  777 bits (2006), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/543 (70%), Positives = 416/543 (76%)

Query: 1   MLPIFKKKMSVQGTDYQIHDKTIMKVDDKXXXXXXXXXXXXXXXXXXXXXXXXDSPWQDP 60
           M P+ ++K++VQ  D  + DK  MK +DK                        DSPWQDP
Sbjct: 1   MYPVIEEKVNVQSKDSPVIDKISMKAEDKVVVSSEDEDVTTVASSNKSTQVSNDSPWQDP 60

Query: 61  IYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSESNNQAWLMASFPLAAG 120
            YFSSFG+ELMFI TCMLAQLLNQAGQTHAL IMNVLSKSFNSES+ QAWLMASFPL AG
Sbjct: 61  TYFSSFGRELMFIVTCMLAQLLNQAGQTHALTIMNVLSKSFNSESDKQAWLMASFPLVAG 120

Query: 121 SFILISGRLGDIYGLKKMXXXXXXXXXXXXXXXXXXKYSNSDAFFITCRAFQGLGIAFIL 180
           SFILISGRLGDIYGLKKM                  KYSN+DAFFITCRAFQGLGIAFIL
Sbjct: 121 SFILISGRLGDIYGLKKMLMIGYVTIIVWSLICGLSKYSNNDAFFITCRAFQGLGIAFIL 180

Query: 181 PNIMGLVGHVYKVGSLRKNLVISVIGACAPAXXXXXXXXXXLIVTEDPEQWPWVFYAFSI 240
           PN+MGLVGHVYKVGS RKNLVIS IGACAPA          LIV ED EQWPWVFYAF+I
Sbjct: 181 PNVMGLVGHVYKVGSTRKNLVISFIGACAPAGGMFGGLFGGLIVNEDSEQWPWVFYAFAI 240

Query: 241 ATFISLLMAWYSIPNNVPTNVHGLSMDWTGSTLAVLGLILFNFVWNQAPIAGWGEAYXXX 300
           A F+++++AWYSIPNN+PTNVHG SMDWTGS LAV+GLILFNFVWNQAP AGWG AY   
Sbjct: 241 AFFLNMILAWYSIPNNIPTNVHGFSMDWTGSVLAVIGLILFNFVWNQAPTAGWGTAYIIA 300

Query: 301 XXXXXXXXXXXXXXYEIKYAEVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYVSFQ 360
                         YE+KYA+VPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYY+SFQ
Sbjct: 301 LLIISVFFLVAFFVYEVKYAKVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYMSFQ 360

Query: 361 LNLRHYSPVWTGGTYFVFVIFGSIAAFFVAFSIKRLGPAILLCFALMAFDAGSIMFSVLP 420
           LNLRHYSPVWTGGTYFVFVIFG+IAAF VA SIKR+GPA LLCFAL+AFD GSIMFSVLP
Sbjct: 361 LNLRHYSPVWTGGTYFVFVIFGTIAAFMVALSIKRVGPAFLLCFALVAFDVGSIMFSVLP 420

Query: 421 VEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLG 480
           V+QS+WKLNF MQAILCFGMDLSFPASSIILSDGLPM+YQGMAGSLVNTVINYSASLCLG
Sbjct: 421 VKQSFWKLNFGMQAILCFGMDLSFPASSIILSDGLPMEYQGMAGSLVNTVINYSASLCLG 480

Query: 481 MGVTVERQINKSGQNLLKGYRXXXXXXXXXXXXXXXXXVTYMLENFWNKHKESEKKRLEA 540
           MG TVE QINK+G++LLKGYR                  TYMLE FWN  ++ +K  +  
Sbjct: 481 MGATVEHQINKNGKDLLKGYRGAIYLGVGLASLGVLISFTYMLETFWNNRRDRQKDSVIT 540

Query: 541 ETS 543
           E S
Sbjct: 541 EMS 543

>NCAS0A02540 Chr1 complement(481807..483426) [1620 bp, 539 aa] {ON} 
          Length = 539

 Score =  585 bits (1508), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/448 (62%), Positives = 338/448 (75%)

Query: 54  DSPWQDPIYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSESNNQAWLMA 113
           DSPWQ+P YFSS  KE  FI TCM+A LLNQAGQT  L  MNV+S+SF+S+S  Q WLMA
Sbjct: 47  DSPWQNPNYFSSKYKEYFFIFTCMVANLLNQAGQTQVLSTMNVISESFHSDSGKQTWLMA 106

Query: 114 SFPLAAGSFILISGRLGDIYGLKKMXXXXXXXXXXXXXXXXXXKYSNSDAFFITCRAFQG 173
           SFPL +GSFILISGR+GDIYGLKK                    ++++D FFI CRAFQG
Sbjct: 107 SFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIWSLLCGFADFTHNDTFFIVCRAFQG 166

Query: 174 LGIAFILPNIMGLVGHVYKVGSLRKNLVISVIGACAPAXXXXXXXXXXLIVTEDPEQWPW 233
           LGI+FILPN+MGL+G++YKVG+LRKN+VIS+IG  AP           LIVTE+ +QWPW
Sbjct: 167 LGISFILPNVMGLIGNIYKVGTLRKNIVISMIGLTAPTGACMGALWGGLIVTENAKQWPW 226

Query: 234 VFYAFSIATFISLLMAWYSIPNNVPTNVHGLSMDWTGSTLAVLGLILFNFVWNQAPIAGW 293
           +FYA+++   ++L+MA YS+PN +PTNVH  +MDW GS + V+GLILFNFVWNQ P+AGW
Sbjct: 227 IFYAYALTGLVNLIMALYSVPNCIPTNVHNFAMDWIGSIIGVVGLILFNFVWNQGPVAGW 286

Query: 294 GEAYXXXXXXXXXXXXXXXXXYEIKYAEVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWT 353
            +AY                 YE+KY   PLLP  VTKN  ++ IL  +FLGWG+FGIWT
Sbjct: 287 DKAYIIVLLIISVLFLVAFVVYELKYPISPLLPVEVTKNGQILTILSILFLGWGAFGIWT 346

Query: 354 FYYVSFQLNLRHYSPVWTGGTYFVFVIFGSIAAFFVAFSIKRLGPAILLCFALMAFDAGS 413
           FYY +FQLNLR YSPVW GGTYF+F+I+G+IAA  VAF+IK++GPAILL F+ + F  GS
Sbjct: 347 FYYFAFQLNLRDYSPVWVGGTYFMFIIWGTIAALIVAFTIKKVGPAILLFFSALGFTMGS 406

Query: 414 IMFSVLPVEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINY 473
           +M SV P+ Q YW++N  MQ ILCFGMDLSFPASSIILSD LPMQYQGMAGSLVNTVINY
Sbjct: 407 LMLSVTPIHQMYWRMNLGMQIILCFGMDLSFPASSIILSDHLPMQYQGMAGSLVNTVINY 466

Query: 474 SASLCLGMGVTVERQINKSGQNLLKGYR 501
           + SLCLGMG TVERQINKSG++LLKGYR
Sbjct: 467 ATSLCLGMGTTVERQINKSGEDLLKGYR 494

>CAGL0M03003g Chr13 complement(337942..339618) [1677 bp, 558 aa]
           {ON} similar to uniprot|Q03263 Saccharomyces cerevisiae
           YMR279c or uniprot|P13090 Saccharomyces cerevisiae
           YML116w ATR1
          Length = 558

 Score =  582 bits (1501), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/488 (60%), Positives = 358/488 (73%), Gaps = 3/488 (0%)

Query: 54  DSPWQDPIYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSESNNQAWLMA 113
           DSP+Q+P YF +  KE+MFI +CM+AQLLNQAGQT +L  MNVL+  F S S+ Q WLMA
Sbjct: 70  DSPFQNPEYFETGFKEVMFIISCMVAQLLNQAGQTQSLSTMNVLADYFKSNSSKQPWLMA 129

Query: 114 SFPLAAGSFILISGRLGDIYGLKKMXXXXXXXXXXXXXXXXXXKYSNSDAFFITCRAFQG 173
           SFPL +GSFILISGRLGDIYGLKK                   KY+NSDAFFI CR+FQG
Sbjct: 130 SFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIICGLAKYTNSDAFFIVCRSFQG 189

Query: 174 LGIAFILPNIMGLVGHVYKVGSLRKNLVISVIGACAPAXXXXXXXXXXLIVTEDPEQWPW 233
           LGIAFILPNIMGLVG++YKVG+LRKN+VIS IG  APA          LIVTED EQWPW
Sbjct: 190 LGIAFILPNIMGLVGNIYKVGTLRKNIVISCIGCMAPAGAALGALFGGLIVTEDAEQWPW 249

Query: 234 VFYAFSIATFISLLMAWYSIPNNVPTNVHGLSMDWTGSTLAVLGLILFNFVWNQAPIAGW 293
           VFYAF IA+F+++L+A YSIPNNVPTN++ L+MDW GS L V GL+L N VWNQAPI GW
Sbjct: 250 VFYAFGIASFVNMLLALYSIPNNVPTNLNNLNMDWIGSLLGVSGLLLLNIVWNQAPIVGW 309

Query: 294 GEAYXXXXXXXXXXXXXXXXXYEIKYAEVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWT 353
           GEAY                 YEIKYA  PLLP +V +N+ ++MIL A+F GWGSFGIWT
Sbjct: 310 GEAYIIVLLIISIILLLIFVVYEIKYATSPLLPPSVLENKKILMILAALFFGWGSFGIWT 369

Query: 354 FYYVSFQLNLRHYSPVWTGGTYFVFVIFGSIAAFFVAFSIKRLGPAILLCFALMAFDAGS 413
           +YY +FQLNLR Y+P+W GGT+F+FVI+G++AAF VA +IK++GPA+LLCF+++AFD GS
Sbjct: 370 YYYYAFQLNLRKYTPLWAGGTHFMFVIWGTVAAFVVALTIKKVGPAVLLCFSMVAFDCGS 429

Query: 414 IMFSVLPVEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINY 473
           IM SV PV Q+YW++N  MQ IL FGMDLSFPASSIILSD LPMQYQGMAGSLVNTV+NY
Sbjct: 430 IMLSVTPVHQTYWRMNVGMQIILSFGMDLSFPASSIILSDFLPMQYQGMAGSLVNTVVNY 489

Query: 474 SASLCLGMGVTVERQINKSGQNLLKGYRXXXXXXXXXXXXXXXXXVTYMLENFWNKHKES 533
           S SLCLGMG TVE+Q N  G +LLKGYR                 + +++ +   K    
Sbjct: 490 STSLCLGMGNTVEQQYNAHGADLLKGYRSALYLAIGLASAGVCVSLVFLVTDIIAKR--- 546

Query: 534 EKKRLEAE 541
            +KR+E+E
Sbjct: 547 HRKRIESE 554

>KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.843
           YMR279C
          Length = 550

 Score =  581 bits (1498), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/474 (58%), Positives = 337/474 (71%)

Query: 54  DSPWQDPIYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSESNNQAWLMA 113
           D+PWQ+P YF++  +E  FI+TCMLAQLLNQAGQ  A   MN+L+ +FNS +  Q WLMA
Sbjct: 59  DTPWQNPTYFANRWQEYAFISTCMLAQLLNQAGQAQATAPMNILADAFNSSAKKQTWLMA 118

Query: 114 SFPLAAGSFILISGRLGDIYGLKKMXXXXXXXXXXXXXXXXXXKYSNSDAFFITCRAFQG 173
           SFPL +GSFIL+SGR+GDIYGLKK                    Y+++DAFFI CRAFQG
Sbjct: 119 SFPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWSLICGFANYTHNDAFFILCRAFQG 178

Query: 174 LGIAFILPNIMGLVGHVYKVGSLRKNLVISVIGACAPAXXXXXXXXXXLIVTEDPEQWPW 233
           LGIAFILPN+MGL+G++YK  +LRKN VIS +G CAP           LI  E+P+QWPW
Sbjct: 179 LGIAFILPNVMGLIGNIYKANTLRKNFVISFVGMCAPIGAALGGVWSGLIAHENPKQWPW 238

Query: 234 VFYAFSIATFISLLMAWYSIPNNVPTNVHGLSMDWTGSTLAVLGLILFNFVWNQAPIAGW 293
           +FYA++I   I+++MA YSIP+ VPTN+HG  MDWTGS + V+G+ILFNFVWNQ PI GW
Sbjct: 239 IFYAYAIVVAINMVMAIYSIPSTVPTNIHGFGMDWTGSAIGVVGMILFNFVWNQGPIDGW 298

Query: 294 GEAYXXXXXXXXXXXXXXXXXYEIKYAEVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWT 353
            + Y                 YEIK+A+ PLLP  V KNRH+ MILLAVF+GWGSFGIWT
Sbjct: 299 NKGYIIALLIVSVFLLIAFFIYEIKFAKSPLLPPEVIKNRHIGMILLAVFMGWGSFGIWT 358

Query: 354 FYYVSFQLNLRHYSPVWTGGTYFVFVIFGSIAAFFVAFSIKRLGPAILLCFALMAFDAGS 413
           FYY +FQLNLRHYS VW GGT+F+FVI+G+IAAF VA +IKR+GP++LLCF++  F  G 
Sbjct: 359 FYYYAFQLNLRHYSAVWAGGTFFMFVIWGTIAAFLVALTIKRVGPSVLLCFSMTGFTVGC 418

Query: 414 IMFSVLPVEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINY 473
           IM SV PV QSYWK+N  MQ IL FGMDLSFPASSIILSD LP QYQGMAGSLVNT++NY
Sbjct: 419 IMLSVTPVHQSYWKMNLGMQIILSFGMDLSFPASSIILSDFLPSQYQGMAGSLVNTMVNY 478

Query: 474 SASLCLGMGVTVERQINKSGQNLLKGYRXXXXXXXXXXXXXXXXXVTYMLENFW 527
           S SLCLG+G T E Q+NK+G + LKGYR                   Y+ E  W
Sbjct: 479 STSLCLGVGSTAEAQVNKNGTDKLKGYRAALYVGIGLGACGMLVAFCYLFEVLW 532

>NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON} 
          Length = 553

 Score =  577 bits (1486), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/486 (58%), Positives = 349/486 (71%)

Query: 54  DSPWQDPIYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSESNNQAWLMA 113
           +S WQ+P YFSS  KE +F+ATCM+A LLNQAGQ+  L  MNV+S SF+S +  Q WLMA
Sbjct: 60  NSSWQNPDYFSSSFKEYIFVATCMIANLLNQAGQSQVLSAMNVISDSFHSSTGGQTWLMA 119

Query: 114 SFPLAAGSFILISGRLGDIYGLKKMXXXXXXXXXXXXXXXXXXKYSNSDAFFITCRAFQG 173
           SFPL +GSFILISGRLGDIYGLK+M                   Y++SD FFI  RAFQG
Sbjct: 120 SFPLVSGSFILISGRLGDIYGLKRMMIGGFIFMIIWSLICGFTNYAHSDTFFIVARAFQG 179

Query: 174 LGIAFILPNIMGLVGHVYKVGSLRKNLVISVIGACAPAXXXXXXXXXXLIVTEDPEQWPW 233
           LGI+FILPN+MGLVG++YKVG+LRKN+VIS+IG  AP           LIVTE+P+QWPW
Sbjct: 180 LGISFILPNVMGLVGNIYKVGTLRKNVVISLIGIMAPTGSCFGALWGGLIVTENPKQWPW 239

Query: 234 VFYAFSIATFISLLMAWYSIPNNVPTNVHGLSMDWTGSTLAVLGLILFNFVWNQAPIAGW 293
           +FYA+++A  + L+M +Y++P+N+PTNV+G +MDW GS L V+GLILFNFVWNQ PI GW
Sbjct: 240 IFYAYAVAAAVCLVMGYYTVPDNIPTNVNGFTMDWIGSVLGVIGLILFNFVWNQGPIVGW 299

Query: 294 GEAYXXXXXXXXXXXXXXXXXYEIKYAEVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWT 353
            +AY                 YEIKYA+VPLLP AVT+N H++ IL  +FLGWGSFGIWT
Sbjct: 300 EKAYIIVLLIVSVIFLIAFFVYEIKYAKVPLLPKAVTQNGHILTILTVLFLGWGSFGIWT 359

Query: 354 FYYVSFQLNLRHYSPVWTGGTYFVFVIFGSIAAFFVAFSIKRLGPAILLCFALMAFDAGS 413
           FYY +FQLNLR YSPVW+GGT+FVF+IFG++AA  VA +IK++GPAILL F+ + F  GS
Sbjct: 360 FYYFAFQLNLREYSPVWSGGTFFVFIIFGTVAATTVALTIKKVGPAILLFFSAIGFTCGS 419

Query: 414 IMFSVLPVEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINY 473
           I+ SV PV Q+YW+  F MQ IL FGMDL FPASSIILSD LPMQYQGMA SLVNT++NY
Sbjct: 420 IIMSVTPVHQTYWRNTFGMQIILVFGMDLPFPASSIILSDYLPMQYQGMAVSLVNTIVNY 479

Query: 474 SASLCLGMGVTVERQINKSGQNLLKGYRXXXXXXXXXXXXXXXXXVTYMLENFWNKHKES 533
           S SLCLGMG TVERQINKSG +LLKGYR                    +  + W+K    
Sbjct: 480 STSLCLGMGTTVERQINKSGDDLLKGYRAALYFGVGIAGLGACIAFLNVCHDIWSKRNAK 539

Query: 534 EKKRLE 539
           + K L+
Sbjct: 540 DPKDLQ 545

>NCAS0C00400 Chr3 (61257..62810) [1554 bp, 517 aa] {ON} Anc_8.843
          Length = 517

 Score =  566 bits (1459), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/479 (57%), Positives = 333/479 (69%)

Query: 54  DSPWQDPIYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSESNNQAWLMA 113
            +PWQ+  YF S  KE  FI TCM A LLNQAGQT  L  MNV+S+SF+S+   Q WLMA
Sbjct: 25  STPWQNEQYFQSHLKEYFFIFTCMFANLLNQAGQTQVLSTMNVISESFHSDVGTQTWLMA 84

Query: 114 SFPLAAGSFILISGRLGDIYGLKKMXXXXXXXXXXXXXXXXXXKYSNSDAFFITCRAFQG 173
           SFPL +GSFILISGR+GDIYGLKK                    Y++SD FFI CRAFQG
Sbjct: 85  SFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIWTLLCGFADYTHSDTFFIVCRAFQG 144

Query: 174 LGIAFILPNIMGLVGHVYKVGSLRKNLVISVIGACAPAXXXXXXXXXXLIVTEDPEQWPW 233
           LGI+FILPNIMGLVG++YKVG+LRKN+VIS+IG  AP           LI TE   QWPW
Sbjct: 145 LGISFILPNIMGLVGNIYKVGTLRKNIVISLIGITAPTGACMGALWGGLIATESSRQWPW 204

Query: 234 VFYAFSIATFISLLMAWYSIPNNVPTNVHGLSMDWTGSTLAVLGLILFNFVWNQAPIAGW 293
           +FYA+++A F++L+MA YS+P NVPTNVH  +MDW G+ + V+GLILFNFVWNQ P+ GW
Sbjct: 205 IFYAYALAAFVNLIMAIYSVPENVPTNVHNFAMDWMGAIIGVVGLILFNFVWNQGPVNGW 264

Query: 294 GEAYXXXXXXXXXXXXXXXXXYEIKYAEVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWT 353
            + Y                 YE+K+   PLLP  VTKN  ++ IL  +FLGWGSFGIWT
Sbjct: 265 AKPYIIVLLIISIIFLVAFIIYELKFPISPLLPREVTKNGQILTILGILFLGWGSFGIWT 324

Query: 354 FYYVSFQLNLRHYSPVWTGGTYFVFVIFGSIAAFFVAFSIKRLGPAILLCFALMAFDAGS 413
           FYY +FQLNLR+YSP+W G T+F+F+I+GSIAAF V F+I R+GPA+LL F+ + F  GS
Sbjct: 325 FYYYAFQLNLRNYSPLWAGATHFMFIIWGSIAAFIVGFTINRVGPAVLLFFSALGFTMGS 384

Query: 414 IMFSVLPVEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINY 473
           +M SV P+ Q+YW++N  MQ IL FGMDLSFPASSIILSD LPMQYQGMAGSLVNT+INY
Sbjct: 385 LMLSVTPIHQTYWRMNVGMQIILSFGMDLSFPASSIILSDHLPMQYQGMAGSLVNTIINY 444

Query: 474 SASLCLGMGVTVERQINKSGQNLLKGYRXXXXXXXXXXXXXXXXXVTYMLENFWNKHKE 532
           S SLCLGMG TVERQINK+G+ LL+GYR                    +  + W K K 
Sbjct: 445 STSLCLGMGTTVERQINKTGEELLRGYRSALYLAVGLGGLGACVAFLNLCYDLWRKRKS 503

>KAFR0B03930 Chr2 complement(816351..818018) [1668 bp, 555 aa] {ON} 
          Length = 555

 Score =  566 bits (1460), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/448 (60%), Positives = 337/448 (75%)

Query: 54  DSPWQDPIYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSESNNQAWLMA 113
           ++PWQ+P YFSS  KE +FI TCML+ LLNQAGQT A   MNV+  +FN++S+++ WLMA
Sbjct: 66  NTPWQNPSYFSSRWKEYLFILTCMLSNLLNQAGQTQATSTMNVIGSAFNADSSSKTWLMA 125

Query: 114 SFPLAAGSFILISGRLGDIYGLKKMXXXXXXXXXXXXXXXXXXKYSNSDAFFITCRAFQG 173
           SFPL +GSFIL+SGR+GDIYGLK+                    YS+S  FFI CRAFQG
Sbjct: 126 SFPLVSGSFILVSGRIGDIYGLKRTMIGGLIVMIIWSLICGFANYSSSVTFFIICRAFQG 185

Query: 174 LGIAFILPNIMGLVGHVYKVGSLRKNLVISVIGACAPAXXXXXXXXXXLIVTEDPEQWPW 233
           LGIAF+LPN+MGLVG++YKVGSLRKN+VIS IG CAP           LI T+  +QWPW
Sbjct: 186 LGIAFVLPNVMGLVGNIYKVGSLRKNIVISCIGMCAPTGAAFGAFWAGLIATKAEKQWPW 245

Query: 234 VFYAFSIATFISLLMAWYSIPNNVPTNVHGLSMDWTGSTLAVLGLILFNFVWNQAPIAGW 293
           +FYA++ A  ++L++A YSIP+ VP NVHG SMDWTGS + V+GLILFNFVWN+API GW
Sbjct: 246 IFYAYAFAGILNLVLAIYSIPDTVPVNVHGFSMDWTGSVVGVIGLILFNFVWNEAPIVGW 305

Query: 294 GEAYXXXXXXXXXXXXXXXXXYEIKYAEVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWT 353
            +AY                 YEIK+A+ PLLP AVT N ++IMIL A+F+GWGSFGIWT
Sbjct: 306 EKAYIIVLLIFSLLIIVVFFIYEIKFAKSPLLPQAVTHNHNIIMILSAMFMGWGSFGIWT 365

Query: 354 FYYVSFQLNLRHYSPVWTGGTYFVFVIFGSIAAFFVAFSIKRLGPAILLCFALMAFDAGS 413
           FYY +F LNLR Y+P+  G ++ +F+++G+IAAF VAF+IKR+GP++LL  +++AF  GS
Sbjct: 366 FYYYAFLLNLRGYTPLEAGASHCMFILWGTIAAFTVAFTIKRVGPSVLLFCSMVAFTVGS 425

Query: 414 IMFSVLPVEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINY 473
           IM S+ PV Q+YWK+ F MQ IL FGMDLSFPASSIILSD LPM+YQGMAGSLVNT++NY
Sbjct: 426 IMLSITPVHQTYWKMTFGMQIILAFGMDLSFPASSIILSDALPMEYQGMAGSLVNTIVNY 485

Query: 474 SASLCLGMGVTVERQINKSGQNLLKGYR 501
           S SLCLGMG T E Q+NK+G +LLKGYR
Sbjct: 486 STSLCLGMGTTAEIQVNKNGTDLLKGYR 513

>Smik_13.18 Chr13 (34422..36059) [1638 bp, 545 aa] {ON} YML116W
           (REAL)
          Length = 545

 Score =  553 bits (1426), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/490 (55%), Positives = 337/490 (68%)

Query: 54  DSPWQDPIYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSESNNQAWLMA 113
           +  WQ+P YF    +E +FI TCM++QLLNQAG T  L IMN+LS SF SE N+++WLMA
Sbjct: 56  NQKWQNPKYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMA 115

Query: 114 SFPLAAGSFILISGRLGDIYGLKKMXXXXXXXXXXXXXXXXXXKYSNSDAFFITCRAFQG 173
           SFPL +GSFILISGRLGDIYGLKKM                   YS SD FFI CRAFQG
Sbjct: 116 SFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFIICRAFQG 175

Query: 174 LGIAFILPNIMGLVGHVYKVGSLRKNLVISVIGACAPAXXXXXXXXXXLIVTEDPEQWPW 233
           LGIAF+LPN++G++G++Y  G+ RKN+VIS +GA AP           LI TE+P QWPW
Sbjct: 176 LGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTENPNQWPW 235

Query: 234 VFYAFSIATFISLLMAWYSIPNNVPTNVHGLSMDWTGSTLAVLGLILFNFVWNQAPIAGW 293
            FYAFSIA+ I+  ++ Y+IPNN+PTN+H  SMDW GS L V+GLIL NFVWNQAPI+GW
Sbjct: 236 AFYAFSIASLINFGLSIYAIPNNIPTNIHHFSMDWIGSVLGVIGLILLNFVWNQAPISGW 295

Query: 294 GEAYXXXXXXXXXXXXXXXXXYEIKYAEVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWT 353
            +AY                 YE+ +A+ PLLPHAV K+ HMI I+LA+F GWGSFGI+T
Sbjct: 296 SQAYIIVILIISVIFLAVFIIYEMWFAKSPLLPHAVIKDYHMIQIMLALFFGWGSFGIFT 355

Query: 354 FYYVSFQLNLRHYSPVWTGGTYFVFVIFGSIAAFFVAFSIKRLGPAILLCFALMAFDAGS 413
           FYY  FQLN+RHY+ +W GGTYF+F+I+G IAA  V F+IK + P++ L F+++AF+ GS
Sbjct: 356 FYYFQFQLNIRHYTALWAGGTYFMFLIWGIIAALLVGFTIKNVSPSVYLFFSMVAFNVGS 415

Query: 414 IMFSVLPVEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINY 473
           IM SV PV ++Y++       IL FGMDLSFPASSII SD LPM+YQGMAGSLVNTV+NY
Sbjct: 416 IMASVTPVHETYFRTQLGTMIILSFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNY 475

Query: 474 SASLCLGMGVTVERQINKSGQNLLKGYRXXXXXXXXXXXXXXXXXVTYMLENFWNKHKES 533
           S SLCLGMG TVE Q++  G++LLKGYR                   YM+E+F N HK  
Sbjct: 476 SMSLCLGMGATVETQLDPDGKHLLKGYRGAQYLGIGLASLACMISGLYMVESFINDHKAK 535

Query: 534 EKKRLEAETS 543
                +  T+
Sbjct: 536 AATENDCATT 545

>YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidrug
           efflux pump of the major facilitator superfamily,
           required for resistance to aminotriazole and
           4-nitroquinoline-N-oxide
          Length = 542

 Score =  552 bits (1423), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/488 (55%), Positives = 337/488 (69%), Gaps = 4/488 (0%)

Query: 54  DSPWQDPIYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSESNNQAWLMA 113
           +  WQ+P YF    +E +FI TCM++QLLNQAG T  L IMN+LS SF SE N+++WLMA
Sbjct: 53  NQKWQNPNYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMA 112

Query: 114 SFPLAAGSFILISGRLGDIYGLKKMXXXXXXXXXXXXXXXXXXKYSNSDAFFITCRAFQG 173
           SFPL +GSFILISGRLGDIYGLKKM                  KYS SD FFI  RAFQG
Sbjct: 113 SFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITKYSGSDTFFIISRAFQG 172

Query: 174 LGIAFILPNIMGLVGHVYKVGSLRKNLVISVIGACAPAXXXXXXXXXXLIVTEDPEQWPW 233
           LGIAF+LPN++G++G++Y  G+ RKN+VIS +GA AP           LI TEDP+QWPW
Sbjct: 173 LGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTEDPKQWPW 232

Query: 234 VFYAFSIATFISLLMAWYSIPNNVPTNVHGLSMDWTGSTLAVLGLILFNFVWNQAPIAGW 293
            FYA+SIA FI+ +++ Y+IP+ +PTN+H  SMDW GS L V+GLIL NFVWNQAPI+GW
Sbjct: 233 AFYAYSIAAFINFVLSIYAIPSTIPTNIHHFSMDWIGSVLGVIGLILLNFVWNQAPISGW 292

Query: 294 GEAYXXXXXXXXXXXXXXXXXYEIKYAEVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWT 353
            +AY                 YEI++A+ PLLP AV K+RHMI I+LA+F GWGSFGI+T
Sbjct: 293 NQAYIIVILIISVIFLVVFIIYEIRFAKTPLLPRAVIKDRHMIQIMLALFFGWGSFGIFT 352

Query: 354 FYYVSFQLNLRHYSPVWTGGTYFVFVIFGSIAAFFVAFSIKRLGPAILLCFALMAFDAGS 413
           FYY  FQLN+R Y+ +W GGTYF+F+I+G IAA  V F+IK + P++ L F+++AF+ GS
Sbjct: 353 FYYFQFQLNIRQYTALWAGGTYFMFLIWGIIAALLVGFTIKNVSPSVFLFFSMVAFNVGS 412

Query: 414 IMFSVLPVEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINY 473
           IM SV PV ++Y++       IL FGMDLSFPASSII SD LPM+YQGMAGSLVNTV+NY
Sbjct: 413 IMASVTPVHETYFRTQLGTMIILSFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNY 472

Query: 474 SASLCLGMGVTVERQINKSGQNLLKGYRXXXXXXXXXXXXXXXXXVTYMLENFWNKHKES 533
           S SLCLGMG TVE Q+N  G++LLKGYR                   YM+E+F     + 
Sbjct: 473 SMSLCLGMGATVETQVNSDGKHLLKGYRGAQYLGIGLASLACMISGLYMVESF----IKG 528

Query: 534 EKKRLEAE 541
            + R  AE
Sbjct: 529 RRARAAAE 536

>KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {ON}
           Anc_8.843 YMR279C
          Length = 547

 Score =  550 bits (1417), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/487 (54%), Positives = 333/487 (68%), Gaps = 3/487 (0%)

Query: 54  DSPWQDPIYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSESNNQAWLMA 113
           +S WQDP YF S  +E  FI TCMLA LLNQAGQT  L  MNVL+ S NS+   + WLMA
Sbjct: 58  NSKWQDPTYFKSSWQEYTFIGTCMLANLLNQAGQTQTLSTMNVLADSLNSDGAAKTWLMA 117

Query: 114 SFPLAAGSFILISGRLGDIYGLKKMXXXXXXXXXXXXXXXXXXKYSNSDAFFITCRAFQG 173
           SF LA+GSFIL+SGR+GDIYGLK                    KY+ +  FFI CRAFQG
Sbjct: 118 SFTLASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQG 177

Query: 174 LGIAFILPNIMGLVGHVYKVGSLRKNLVISVIGACAPAXXXXXXXXXXLIVTEDPEQWPW 233
           LG+AF+LPN+MGLVG++Y VGS+RKN+VIS IG  AP           LIV  + +QWPW
Sbjct: 178 LGVAFVLPNVMGLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQWPW 237

Query: 234 VFYAFSIATFISLLMAWYSIPNNVPTNVHGLSMDWTGSTLAVLGLILFNFVWNQAPIAGW 293
           +F+A +IA FI+L+M  YSIPN+VPTN++ L MDW GS L V+GLIL NFVWNQAPI+GW
Sbjct: 238 IFFATAIAVFINLIMGIYSIPNHVPTNIYNLKMDWIGSLLGVIGLILMNFVWNQAPISGW 297

Query: 294 GEAYXXXXXXXXXXXXXXXXXYEIKYAEVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWT 353
            +AY                 YE+K AE PLLP  VTKNRH++ I++++FLGWG+FGIWT
Sbjct: 298 SKAYIIVILIVAVFFLVAFFIYELKKAESPLLPPEVTKNRHIVTIIISLFLGWGAFGIWT 357

Query: 354 FYYVSFQLNLRHYSPVWTGGTYFVFVIFGSIAAFFVAFSIKRLGPAILLCFALMAFDAGS 413
           FYY +F LNLRH+SP+W G T+FVF+IFGS+ A  VAF+I ++GP++L C + + F  G+
Sbjct: 358 FYYYAFNLNLRHFSPLWAGSTHFVFIIFGSLTAITVAFTINKVGPSVLFCLSSIGFTCGN 417

Query: 414 IMFSVLPVEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINY 473
           I+FSV   +Q+YW+ +  MQ IL  GMDLSFP SSIILSD LPMQYQGM+GSLVNT+ NY
Sbjct: 418 IIFSVTSPDQTYWRNSLGMQIILALGMDLSFPGSSIILSDLLPMQYQGMSGSLVNTITNY 477

Query: 474 SASLCLGMGVTVERQINKSGQNLLKGYRXXXXXXXXXXXXXXXXXVTYMLENFW---NKH 530
           + SLCLGMG T E Q N  G+++LKGYR                  +YM E+ W    K 
Sbjct: 478 ATSLCLGMGTTAEVQYNNGGKDVLKGYRAALYVAIGLGALGFAFSFSYMAEDLWIRYRKR 537

Query: 531 KESEKKR 537
           +++EKK 
Sbjct: 538 RQNEKKE 544

>NCAS0B00290 Chr2 (33760..35388) [1629 bp, 542 aa] {ON} Anc_8.843
          Length = 542

 Score =  549 bits (1414), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/478 (56%), Positives = 331/478 (69%)

Query: 55  SPWQDPIYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSESNNQAWLMAS 114
           S WQ+P YF +  +E +FI +CM++QLLNQA     L IMN+++ SFNSE   + WL+AS
Sbjct: 54  SKWQNPDYFQNQWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITDSFNSEGGKETWLIAS 113

Query: 115 FPLAAGSFILISGRLGDIYGLKKMXXXXXXXXXXXXXXXXXXKYSNSDAFFITCRAFQGL 174
           FPL +GSFILISGR+GDIYGLKK                   KYS+SD FFI  RAFQGL
Sbjct: 114 FPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSIISGLTKYSHSDTFFIVSRAFQGL 173

Query: 175 GIAFILPNIMGLVGHVYKVGSLRKNLVISVIGACAPAXXXXXXXXXXLIVTEDPEQWPWV 234
            IAFILPN+MG+VG++YK  S RKN+VIS+IGA AP           LI TEDP+QWPW 
Sbjct: 174 SIAFILPNVMGIVGNIYKPDSNRKNIVISMIGASAPIGAFFGSLFAGLIGTEDPDQWPWA 233

Query: 235 FYAFSIATFISLLMAWYSIPNNVPTNVHGLSMDWTGSTLAVLGLILFNFVWNQAPIAGWG 294
           FYAF+IA+  +L ++ YSIPN+VPTNVHG +MDW GS LAV+GLIL NFVWNQ PI GW 
Sbjct: 234 FYAFAIASAFNLAISIYSIPNSVPTNVHGFAMDWIGSVLAVIGLILLNFVWNQGPIVGWQ 293

Query: 295 EAYXXXXXXXXXXXXXXXXXYEIKYAEVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTF 354
            AY                 YE+KYAE PLLP  VTKNRH+IMIL A+FLGWGSFGI++F
Sbjct: 294 TAYIIALLVVSVFFLALFFTYEVKYAESPLLPVEVTKNRHIIMILAALFLGWGSFGIFSF 353

Query: 355 YYVSFQLNLRHYSPVWTGGTYFVFVIFGSIAAFFVAFSIKRLGPAILLCFALMAFDAGSI 414
           YY SF LNLRHYS +W G TYF+F I+G++AA  V   IK++  A +L  +++AF+ G I
Sbjct: 354 YYFSFLLNLRHYSALWAGTTYFMFAIWGTVAAVIVGAFIKKISAAFILFMSMVAFNIGII 413

Query: 415 MFSVLPVEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYS 474
           M SV PV+Q+Y+++N     IL FGMD+SFPA++IILSDGL MQYQGMAGSL NT++NYS
Sbjct: 414 MLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAIILSDGLTMQYQGMAGSLANTMVNYS 473

Query: 475 ASLCLGMGVTVERQINKSGQNLLKGYRXXXXXXXXXXXXXXXXXVTYMLENFWNKHKE 532
            SLCLGMG TVERQINKSG +LLKGYR                   Y+ E  W K K+
Sbjct: 474 MSLCLGMGTTVERQINKSGNDLLKGYRGAEYLGIGLAGLGIIITAIYLGEILWGKRKQ 531

>KNAG0G03430 Chr7 complement(734828..736456) [1629 bp, 542 aa] {ON}
           Anc_8.843 YMR279C
          Length = 542

 Score =  546 bits (1408), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/490 (53%), Positives = 336/490 (68%)

Query: 54  DSPWQDPIYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSESNNQAWLMA 113
           +  WQD  YF +  +E +F+ TCM++QLLNQA     L +MN+L+KSF+S + NQ WLMA
Sbjct: 53  NCKWQDTTYFQNRWQEYIFVGTCMMSQLLNQACIPQTLSLMNILTKSFHSNAKNQTWLMA 112

Query: 114 SFPLAAGSFILISGRLGDIYGLKKMXXXXXXXXXXXXXXXXXXKYSNSDAFFITCRAFQG 173
           SFPL +GSFILISGR+GDIYGLK                     Y++SD FFI  R+FQG
Sbjct: 113 SFPLVSGSFILISGRVGDIYGLKWSLVGGNIFFIIWALISGFTNYTHSDTFFIVSRSFQG 172

Query: 174 LGIAFILPNIMGLVGHVYKVGSLRKNLVISVIGACAPAXXXXXXXXXXLIVTEDPEQWPW 233
           LG+AFILPN+MG VG++YK  + RKN+VIS+IGACAP           LI T++P+ WPW
Sbjct: 173 LGVAFILPNVMGCVGNIYKPNTFRKNIVISLIGACAPVGAFMGAFFAGLIGTKNPDDWPW 232

Query: 234 VFYAFSIATFISLLMAWYSIPNNVPTNVHGLSMDWTGSTLAVLGLILFNFVWNQAPIAGW 293
            FYA +IA+ ++LL A YSIPN++PTNVHG SMDW GS LAV+GLIL NFVWNQ PI GW
Sbjct: 233 SFYAMAIASTLTLLGALYSIPNHIPTNVHGFSMDWIGSGLAVVGLILLNFVWNQGPIDGW 292

Query: 294 GEAYXXXXXXXXXXXXXXXXXYEIKYAEVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWT 353
           G+AY                 YE+ YA  PLLP  +T+NRHM+MIL+A+FLGWGSFGI++
Sbjct: 293 GKAYIIVLLIVSVFVLTLFFIYEVHYAASPLLPRVITQNRHMVMILMALFLGWGSFGIFS 352

Query: 354 FYYVSFQLNLRHYSPVWTGGTYFVFVIFGSIAAFFVAFSIKRLGPAILLCFALMAFDAGS 413
           FYY +F LNLRHYS VW GGTYF+F I+G +A+  V  SI+++  +I+L F+++AFD G 
Sbjct: 353 FYYFAFLLNLRHYSTVWAGGTYFMFAIWGVVASVVVGLSIRKISASIILFFSMIAFDVGI 412

Query: 414 IMFSVLPVEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINY 473
           IM SV PV+Q+Y+++N     IL FGMD+SFPA++IILSD LP QYQGMAGSL NT++NY
Sbjct: 413 IMLSVTPVKQTYFRMNLGTMIILSFGMDMSFPAAAIILSDSLPNQYQGMAGSLANTMVNY 472

Query: 474 SASLCLGMGVTVERQINKSGQNLLKGYRXXXXXXXXXXXXXXXXXVTYMLENFWNKHKES 533
           S SLCLGMG TVE QIN++G++LLKGYR                 + YM E  W   KE 
Sbjct: 473 SMSLCLGMGSTVESQINQNGKDLLKGYRAAEYLGIGIASLAVILSLIYMCERLWIDRKER 532

Query: 534 EKKRLEAETS 543
            +   E   S
Sbjct: 533 MESTSETNLS 542

>NDAI0E00280 Chr5 (37676..39325) [1650 bp, 549 aa] {ON} Anc_8.843
          Length = 549

 Score =  546 bits (1407), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/489 (54%), Positives = 337/489 (68%)

Query: 55  SPWQDPIYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSESNNQAWLMAS 114
           S WQ+P YF +  +E +FI +CM++QLLNQA     L IMN+++ SF SE   + WL+AS
Sbjct: 61  SKWQNPDYFQNKWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITDSFKSEGGKETWLIAS 120

Query: 115 FPLAAGSFILISGRLGDIYGLKKMXXXXXXXXXXXXXXXXXXKYSNSDAFFITCRAFQGL 174
           FPL +GSFILISGR+GDIYGLKK                    YS++D FFI  RAFQGL
Sbjct: 121 FPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSLISGFTDYSHNDIFFIISRAFQGL 180

Query: 175 GIAFILPNIMGLVGHVYKVGSLRKNLVISVIGACAPAXXXXXXXXXXLIVTEDPEQWPWV 234
           GIAFILPN+MG+VG++YK  + RKN+VIS+IGA AP           LI TE+P+QWPW 
Sbjct: 181 GIAFILPNVMGIVGNIYKPDTQRKNIVISMIGASAPIGAFMGSLFAGLIGTENPKQWPWA 240

Query: 235 FYAFSIATFISLLMAWYSIPNNVPTNVHGLSMDWTGSTLAVLGLILFNFVWNQAPIAGWG 294
           FYAF+IA+ I+L ++ YSIPNN+PTN+HG +MDW GS +AV+GLIL NFVWNQ PI GW 
Sbjct: 241 FYAFAIASAINLAISIYSIPNNIPTNIHGFAMDWIGSIMAVIGLILLNFVWNQGPIVGWQ 300

Query: 295 EAYXXXXXXXXXXXXXXXXXYEIKYAEVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTF 354
           +AY                 YEIKYA+ P+LP  VTKNRH+IMIL A+FLGWGSFGI++F
Sbjct: 301 KAYIIVLLIISIIALVLFFTYEIKYAKSPILPVEVTKNRHIIMILAALFLGWGSFGIFSF 360

Query: 355 YYVSFQLNLRHYSPVWTGGTYFVFVIFGSIAAFFVAFSIKRLGPAILLCFALMAFDAGSI 414
           YY SF LNLRHYS +W G TYF+F I+G++AA  V   IKR+  +++L F+++AF+ G I
Sbjct: 361 YYFSFLLNLRHYSALWAGTTYFMFAIWGTVAAVIVGAFIKRISASVILFFSMIAFNIGLI 420

Query: 415 MFSVLPVEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYS 474
           M SV PV+Q+Y+++N     IL FGMD+SFPA++IILSDGL MQYQGMAGSL NT++NYS
Sbjct: 421 MLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAIILSDGLTMQYQGMAGSLANTMVNYS 480

Query: 475 ASLCLGMGVTVERQINKSGQNLLKGYRXXXXXXXXXXXXXXXXXVTYMLENFWNKHKESE 534
            SLCLGMG TVERQINKSG+ +LKGYR                   YM E  W K KE  
Sbjct: 481 MSLCLGMGTTVERQINKSGKEILKGYRAAEYLGVGLAGLGIVISGIYMAEVLWAKRKERL 540

Query: 535 KKRLEAETS 543
               + + S
Sbjct: 541 SSNRDHDMS 549

>Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W
           (REAL)
          Length = 553

 Score =  541 bits (1395), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/484 (54%), Positives = 336/484 (69%), Gaps = 3/484 (0%)

Query: 57  WQDPIYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSESNNQAWLMASFP 116
           WQ+P YF    +E +FI TCM++QLLNQ+G T  L IMN+L+ SF S++N+++WLMASFP
Sbjct: 67  WQNPNYFKYPWQEYLFIFTCMISQLLNQSGTTQTLSIMNILADSFGSDANSRSWLMASFP 126

Query: 117 LAAGSFILISGRLGDIYGLKKMXXXXXXXXXXXXXXXXXXKYSNSDAFFITCRAFQGLGI 176
           L +GSFILISGR+GDI+GLK M                  KYS SD FFI  RAFQGLGI
Sbjct: 127 LVSGSFILISGRMGDIFGLKNMLLIGYVMIIIWSLICGLTKYSGSDTFFIVSRAFQGLGI 186

Query: 177 AFILPNIMGLVGHVYKVGSLRKNLVISVIGACAPAXXXXXXXXXXLIVTEDPEQWPWVFY 236
           AF+LPN++G++G+VY  G+ RKN+VIS IGA AP           LI T +P QWPW FY
Sbjct: 187 AFVLPNVLGIIGNVYVGGTFRKNIVISFIGAMAPIGATLGCFFAGLIGTMNPNQWPWAFY 246

Query: 237 AFSIATFISLLMAWYSIPNNVPTNVHGLSMDWTGSTLAVLGLILFNFVWNQAPIAGWGEA 296
           A++I   I+L+++ Y+IPNN+PTNVH  SMDW GS L V+GL+L N VWNQAPI+GW +A
Sbjct: 247 AYTITAVINLILSIYAIPNNIPTNVHRFSMDWIGSGLGVIGLVLLNLVWNQAPISGWNQA 306

Query: 297 YXXXXXXXXXXXXXXXXXYEIKYAEVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYY 356
           Y                 YEI +A+ PLLP AV K+RHMI I+L++F GWGSFGI+TFYY
Sbjct: 307 YIIVLLIISVLFLVLFGVYEIHFAKSPLLPQAVMKDRHMIQIMLSLFFGWGSFGIFTFYY 366

Query: 357 VSFQLNLRHYSPVWTGGTYFVFVIFGSIAAFFVAFSIKRLGPAILLCFALMAFDAGSIMF 416
             FQLN+RHY+P+W GG+YF+F+I+G IAA  V FSIKR+ P++ L FA++AF+ GSIM 
Sbjct: 367 FQFQLNIRHYTPLWAGGSYFMFLIWGIIAALLVGFSIKRVSPSVFLFFAMVAFNVGSIMA 426

Query: 417 SVLPVEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSAS 476
           SV PV ++Y+++      IL FGMDLSFPASSII SD LPM+YQGMAGSLVNTV+NYS S
Sbjct: 427 SVTPVHETYFRMQMGTMIILSFGMDLSFPASSIIFSDYLPMEYQGMAGSLVNTVVNYSMS 486

Query: 477 LCLGMGVTVERQINKSGQNLLKGYRXXXXXXXXXXXXXXXXXVTYMLENFWNKHKE---S 533
           LCLGMG TVE Q++  G+++LKGYR                   YM+E +   H+    +
Sbjct: 487 LCLGMGATVEMQLDPDGKHILKGYRGAQYLGIGLASLACIISGLYMVECYIKDHRAKAVA 546

Query: 534 EKKR 537
           E KR
Sbjct: 547 EDKR 550

>Skud_13.25 Chr13 (37872..39485) [1614 bp, 537 aa] {ON} YML116W
           (REAL)
          Length = 537

 Score =  540 bits (1391), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/481 (53%), Positives = 327/481 (67%)

Query: 57  WQDPIYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSESNNQAWLMASFP 116
           WQ+P YF +   E +FI TCM++QLLNQAG T  L IMN+++ SF S  N++ WLMASFP
Sbjct: 57  WQNPNYFKNSWHEYLFIFTCMISQLLNQAGTTQTLSIMNIIANSFGSNENSRTWLMASFP 116

Query: 117 LAAGSFILISGRLGDIYGLKKMXXXXXXXXXXXXXXXXXXKYSNSDAFFITCRAFQGLGI 176
           L +GSFILISGRLGDIYGLKKM                  KYS SD FFI  RAFQGLGI
Sbjct: 117 LVSGSFILISGRLGDIYGLKKMLTIGYVVIIIWSLICGLTKYSGSDTFFIISRAFQGLGI 176

Query: 177 AFILPNIMGLVGHVYKVGSLRKNLVISVIGACAPAXXXXXXXXXXLIVTEDPEQWPWVFY 236
           AF+LPN++G++G++Y  G+ RKN+VIS++GA AP           LI T++P+QWPW FY
Sbjct: 177 AFVLPNVLGIIGNIYVSGTFRKNIVISLVGAMAPVGATLGCLFAGLIGTKNPKQWPWAFY 236

Query: 237 AFSIATFISLLMAWYSIPNNVPTNVHGLSMDWTGSTLAVLGLILFNFVWNQAPIAGWGEA 296
           A++I + I+L ++ YSIPNN+PTN+   SMDW GS L V+GL+L NFVWNQAPI+GW +A
Sbjct: 237 AYTITSIINLALSVYSIPNNIPTNIQHFSMDWIGSALGVIGLVLMNFVWNQAPISGWDQA 296

Query: 297 YXXXXXXXXXXXXXXXXXYEIKYAEVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYY 356
           Y                 YE ++A+ PLLP AV K+RHMI I+LA+F GWGSFGI+TFYY
Sbjct: 297 YIIVLLVISVVFLVVFIIYENRFAKSPLLPRAVLKDRHMIQIMLALFFGWGSFGIFTFYY 356

Query: 357 VSFQLNLRHYSPVWTGGTYFVFVIFGSIAAFFVAFSIKRLGPAILLCFALMAFDAGSIMF 416
             FQLN+RHYS VW GGTYF+F+I+G IAA  V   IK++ P++ L  ++MAF+ GSIM 
Sbjct: 357 FQFQLNIRHYSAVWAGGTYFMFLIWGIIAALLVGIYIKKVSPSVFLFLSMMAFNIGSIMA 416

Query: 417 SVLPVEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSAS 476
           SV PV ++Y++       IL FGMD SFPASSII SD LPM+YQGMAGSLVNTV+NYS S
Sbjct: 417 SVTPVHETYFRTQLGTMIILSFGMDFSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMS 476

Query: 477 LCLGMGVTVERQINKSGQNLLKGYRXXXXXXXXXXXXXXXXXVTYMLENFWNKHKESEKK 536
           LCLGMG TVE  ++  G+++LKGYR                   YM+E     HK   + 
Sbjct: 477 LCLGMGATVETHVDPDGKHVLKGYRGAQYLGIGLASLACIISGLYMVERIIKDHKAKARG 536

Query: 537 R 537
           R
Sbjct: 537 R 537

>TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa]
           {ON} Anc_8.843 YMR279C
          Length = 556

 Score =  525 bits (1351), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 252/486 (51%), Positives = 325/486 (66%)

Query: 58  QDPIYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSESNNQAWLMASFPL 117
           Q P YFSS   E  FI TC++ QLLNQAG T ++ IMN++++ F SE++ QAWL ASFPL
Sbjct: 66  QKPQYFSSKLHEWAFIFTCLMGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPL 125

Query: 118 AAGSFILISGRLGDIYGLKKMXXXXXXXXXXXXXXXXXXKYSNSDAFFITCRAFQGLGIA 177
            +GSFIL+ GR GDIYGLKKM                   Y++SD FFI  +AFQGLG++
Sbjct: 126 VSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLGVS 185

Query: 178 FILPNIMGLVGHVYKVGSLRKNLVISVIGACAPAXXXXXXXXXXLIVTEDPEQWPWVFYA 237
           FILPNI+GLVG +Y+ GS++KN+ IS IGA AP           ++V +D + WPW FYA
Sbjct: 186 FILPNIIGLVGTIYEPGSMKKNITISFIGAMAPLGATFGGLFSGIVVVKDDKNWPWTFYA 245

Query: 238 FSIATFISLLMAWYSIPNNVPTNVHGLSMDWTGSTLAVLGLILFNFVWNQAPIAGWGEAY 297
           F+I +F+  +  ++ +P+NVPTN + L MDW GS + V+GL+LF+FVWNQAP+ GW +AY
Sbjct: 246 FAIVSFLVGVTCYFFVPDNVPTNTNNLKMDWIGSAVGVVGLLLFSFVWNQAPMDGWDKAY 305

Query: 298 XXXXXXXXXXXXXXXXXYEIKYAEVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYV 357
                            YEI YAEVPLLP A+T NRH+IMILLA+F+GWG+FGIW+FYY 
Sbjct: 306 IIVLLVISVILIIAFFIYEINYAEVPLLPKAITGNRHIIMILLAIFMGWGTFGIWSFYYF 365

Query: 358 SFQLNLRHYSPVWTGGTYFVFVIFGSIAAFFVAFSIKRLGPAILLCFALMAFDAGSIMFS 417
           SF LNLRH+SPVWTGG YF F++ G   A  V F IK + P+I+L  ++  F  G+++F+
Sbjct: 366 SFSLNLRHFSPVWTGGAYFAFILSGFTIASCVGFLIKIIRPSIILVISITGFTMGNLIFA 425

Query: 418 VLPVEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASL 477
           V P +Q+YW+  F M  +L  GMDLSFPASSIILSD LP +YQGMAGSLVNT++NYS S 
Sbjct: 426 VTPADQTYWRNTFGMMLLLPLGMDLSFPASSIILSDQLPPEYQGMAGSLVNTMVNYSQSF 485

Query: 478 CLGMGVTVERQINKSGQNLLKGYRXXXXXXXXXXXXXXXXXVTYMLENFWNKHKESEKKR 537
           CLG+  TVE+QIN SG +LLKGYR                   YM E FW  +KE  K  
Sbjct: 486 CLGVATTVEKQINSSGDDLLKGYRAAFYTGVGIGTLGISIASLYMFETFWTDYKEKTKLA 545

Query: 538 LEAETS 543
            + E+S
Sbjct: 546 NDIESS 551

>KAFR0A02840 Chr1 complement(588197..589759) [1563 bp, 520 aa] {ON}
           Anc_8.843 YMR279C
          Length = 520

 Score =  520 bits (1339), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/447 (57%), Positives = 311/447 (69%)

Query: 55  SPWQDPIYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSESNNQAWLMAS 114
           S WQDP YF +  +E +F+ +CM  QLLNQA     L IMNVLS SFNS  +NQ WL+AS
Sbjct: 35  SKWQDPGYFKNSFQEYLFVGSCMTTQLLNQATTPQTLSIMNVLSDSFNSSRSNQTWLVAS 94

Query: 115 FPLAAGSFILISGRLGDIYGLKKMXXXXXXXXXXXXXXXXXXKYSNSDAFFITCRAFQGL 174
           FPL AGSFILISGR+GDIYGLKK                    YS SD F I  RAFQGL
Sbjct: 95  FPLVAGSFILISGRIGDIYGLKKTLIGGYIFLIIWSLICGFTYYSKSDTFLIIARAFQGL 154

Query: 175 GIAFILPNIMGLVGHVYKVGSLRKNLVISVIGACAPAXXXXXXXXXXLIVTEDPEQWPWV 234
           GIAF LPN++G +G++Y VGSLRKN+VIS+I A AP           LIVTE P QWPW 
Sbjct: 155 GIAFTLPNVVGTIGNIYHVGSLRKNMVISLIAASAPVGAAIGGAFAGLIVTESPSQWPWS 214

Query: 235 FYAFSIATFISLLMAWYSIPNNVPTNVHGLSMDWTGSTLAVLGLILFNFVWNQAPIAGWG 294
           FYAF+IA   +LL++ YSIP+N+PTNV+G  MDW GS L V GLILFNF WNQ PI GW 
Sbjct: 215 FYAFAIACSFNLLISIYSIPSNIPTNVNGFKMDWIGSALIVTGLILFNFAWNQGPIVGWD 274

Query: 295 EAYXXXXXXXXXXXXXXXXXYEIKYAEVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTF 354
            AY                 YEI +A  PL+   +T +R+MI+ +  +FLGWGS+GIW+F
Sbjct: 275 IAYIIVLLIISVIFILAFLTYEINFAPSPLIAREITHSRNMIITIFTLFLGWGSYGIWSF 334

Query: 355 YYVSFQLNLRHYSPVWTGGTYFVFVIFGSIAAFFVAFSIKRLGPAILLCFALMAFDAGSI 414
           YY SF LNLRHYSPVW GG+YF+F IFG +A+ FV  SIK++   ++L F+++ F  G+ 
Sbjct: 335 YYFSFVLNLRHYSPVWAGGSYFIFGIFGVLASAFVGISIKKITAPVILLFSMVLFCVGTT 394

Query: 415 MFSVLPVEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYS 474
           + SV PV+QSY+KL  A  AIL  G+D SFPA++IILSDGLPM+YQGMAGSL  T++NYS
Sbjct: 395 LLSVAPVDQSYFKLTLAGMAILGVGLDTSFPAATIILSDGLPMEYQGMAGSLALTMVNYS 454

Query: 475 ASLCLGMGVTVERQINKSGQNLLKGYR 501
            SLCLGMG TVERQINK GQ++LKGYR
Sbjct: 455 MSLCLGMGNTVERQINKDGQDVLKGYR 481

>TDEL0B00550 Chr2 (105483..107096) [1614 bp, 537 aa] {ON} Anc_8.843
           YMR279C
          Length = 537

 Score =  511 bits (1317), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 249/486 (51%), Positives = 322/486 (66%)

Query: 54  DSPWQDPIYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSESNNQAWLMA 113
           +SPWQDP YF     E++F+ +CM+ QLLNQAG T  L  M VL +  +S S   +WLMA
Sbjct: 48  ESPWQDPNYFKGKWDEVLFVLSCMMGQLLNQAGSTMTLSTMKVLERELDSSSAKSSWLMA 107

Query: 114 SFPLAAGSFILISGRLGDIYGLKKMXXXXXXXXXXXXXXXXXXKYSNSDAFFITCRAFQG 173
           SFPL +GSFILISGRLGDIYGLKKM                   +S++D FFIT RAFQG
Sbjct: 108 SFPLVSGSFILISGRLGDIYGLKKMLLLGYIWLTIWSLICGLSSFSHNDTFFITSRAFQG 167

Query: 174 LGIAFILPNIMGLVGHVYKVGSLRKNLVISVIGACAPAXXXXXXXXXXLIVTEDPEQWPW 233
           LGI+F+LPN++G+VG++YK G+ RKN+VIS+IG CAP           ++V      WPW
Sbjct: 168 LGISFVLPNLLGIVGNIYKPGTRRKNIVISLIGMCAPIGATFGGLFAGVVVIRKDSDWPW 227

Query: 234 VFYAFSIATFISLLMAWYSIPNNVPTNVHGLSMDWTGSTLAVLGLILFNFVWNQAPIAGW 293
            FYA++IA F++ +++++ IPN++P NV+  +MDW GS L V GL+LFNFVWNQ+ + GW
Sbjct: 228 AFYAYTIAAFLTTIISYFVIPNSIPVNVNKFAMDWIGSALGVSGLVLFNFVWNQSTVVGW 287

Query: 294 GEAYXXXXXXXXXXXXXXXXXYEIKYAEVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWT 353
              Y                 +EIKYA+VPLLP  VT++R +IMIL ++  GWGSFGIW 
Sbjct: 288 ATGYIIALLIVSIFLIALFFIFEIKYAKVPLLPKEVTESRSIIMILASLMAGWGSFGIWI 347

Query: 354 FYYVSFQLNLRHYSPVWTGGTYFVFVIFGSIAAFFVAFSIKRLGPAILLCFALMAFDAGS 413
           FYY  F L LR+YSPVW GGT+F+  I G IAA  V FSIKR+GPA+LL F+++AF  GS
Sbjct: 348 FYYFQFVLTLRNYSPVWAGGTFFMVSIVGCIAALTVGFSIKRVGPAVLLFFSMIAFTCGS 407

Query: 414 IMFSVLPVEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINY 473
           I+ SV PV ++Y++       IL FGMDLSFPA+SIILSD L MQYQGMAGSLVNTV+NY
Sbjct: 408 IILSVTPVHETYFRSCLGAMVILSFGMDLSFPAASIILSDELSMQYQGMAGSLVNTVVNY 467

Query: 474 SASLCLGMGVTVERQINKSGQNLLKGYRXXXXXXXXXXXXXXXXXVTYMLENFWNKHKES 533
           S SL LG+G T+ERQINKSG  LL+G+R                   ++L+    + K  
Sbjct: 468 SMSLFLGIGGTIERQINKSGDRLLEGFRAALYFAIGVGSLGILISGVFVLQKELMRSKSR 527

Query: 534 EKKRLE 539
           ++  LE
Sbjct: 528 KENELE 533

>TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {ON}
           Anc_8.843 YMR279C
          Length = 550

 Score =  511 bits (1317), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 250/492 (50%), Positives = 323/492 (65%), Gaps = 2/492 (0%)

Query: 54  DSPWQDPIYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSESNNQAWLMA 113
            S +Q+P YF +  +E  FI + M+ QLL+QAG T  L IMNVL+K  +S S+ QAWLM+
Sbjct: 59  SSSYQNPDYFKNKYQEFGFIFSGMIGQLLSQAGLTQTLSIMNVLAKELDSTSSRQAWLMS 118

Query: 114 SFPLAAGSFILISGRLGDIYGLKKMXXXXXXXXXXXXXXXXXXKYSNSDAFFITCRAFQG 173
           SFPLA GSFIL+SGRLGDIYGLKK+                   Y+++DAFFIT RAFQG
Sbjct: 119 SFPLALGSFILVSGRLGDIYGLKKILLGGYIITTVWSIICGLSSYAHNDAFFITARAFQG 178

Query: 174 LGIAFILPNIMGLVGHVYKVGSLRKNLVISVIGACAPAXXXXXXXXXXLIVTEDPEQWPW 233
           LG+AF LPN++GL+G +Y+ G  RKN++IS+IGA +P           L V  D   WPW
Sbjct: 179 LGLAFALPNMIGLIGTIYRPGCFRKNMIISIIGAMSPTGATLGGLFAGLTVKYDKSNWPW 238

Query: 234 VFYAFSIATFISLLMAWYSIPNNVPTNVHGLSMDWTGSTLAVLGLILFNFVWNQAPIAGW 293
            FYAF + +F++L+++WY IPN++PTN+HGL MDW GS L V GLI+ NFV+NQAPI GW
Sbjct: 239 SFYAFGLISFVNLIISWYCIPNSIPTNIHGLKMDWLGSVLGVFGLIILNFVFNQAPIVGW 298

Query: 294 GEAYXXXXXXXXXXXXXXXXXYEIKYAEVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWT 353
             AY                 YE+KYA+ PL+P A++ NR M+MIL ++F GWGSFGIWT
Sbjct: 299 QSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFSLFCGWGSFGIWT 358

Query: 354 FYYVSFQLNLRHYSPVWTGGTYFVFVIFGSIAAFFVAFSIKRLGPAILLCFALMAFDAGS 413
           FYY SF+LNLRHYSP+W G +YF+FVI GS  A     +IK++ P++L C ++M F  G+
Sbjct: 359 FYYFSFELNLRHYSPLWAGSSYFIFVISGSTVAIVCGLTIKKIKPSVLFCCSMMGFLGGN 418

Query: 414 IMFSVLPVEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINY 473
           I+F+  PV Q++++       +L  GMD SFPASSIILSD LPMQYQGMAGSLVNTVINY
Sbjct: 419 IIFAATPVNQTFFRNMLGCMFLLPLGMDFSFPASSIILSDSLPMQYQGMAGSLVNTVINY 478

Query: 474 SASLCLGMGVTVERQINKSGQNLLKGYRXXXXXXXXXXXXXXXXXVTYMLENFWNKHKES 533
           S S+CLGM  TVE + N  G++LL GYR                   YM+E  W     S
Sbjct: 479 STSICLGMAGTVEMKHNSHGKDLLNGYRAAIYFAIGLAGLAVCVSGGYMIECLWKDRVLS 538

Query: 534 --EKKRLEAETS 543
             E K+ + E+S
Sbjct: 539 LEENKQTDIESS 550

>SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON}
           uniprot|Q875S7 Saccharomyces kluyveri ATR1
          Length = 521

 Score =  508 bits (1307), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 253/488 (51%), Positives = 324/488 (66%), Gaps = 4/488 (0%)

Query: 54  DSPW---QDPIYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSESNNQAW 110
           D  W   QDP YFS+  KE +FI   M++QLLNQAG T  L ++N+LSK+F+S ++ Q W
Sbjct: 35  DKKWPSIQDPTYFSAPWKEYLFIFASMMSQLLNQAGTTQTLSLINILSKNFDSSTSQQTW 94

Query: 111 LMASFPLAAGSFILISGRLGDIYGLKKMXXXXXXXXXXXXXXXXXXKYSNSDAFFITCRA 170
           LMASFPL +GSFIL+SG++GDIYGLKK                    Y++S  FFI  RA
Sbjct: 95  LMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTIIWSLICGLTSYTSSVEFFIISRA 154

Query: 171 FQGLGIAFILPNIMGLVGHVYKVGSLRKNLVISVIGACAPAXXXXXXXXXXLIVTEDPEQ 230
           FQGLGIAFILPNIMG+VG++Y  G+ RKN+VIS+IGACAP           LI T   E+
Sbjct: 155 FQGLGIAFILPNIMGIVGNIYVAGTTRKNMVISLIGACAPIGATMGVLFSGLIGTLS-ER 213

Query: 231 WPWVFYAFSIATFISLLMAWYSIPNNVPTNVHGLSMDWTGSTLAVLGLILFNFVWNQAPI 290
           W W FYA++I   I++ ++ + IPN +PTNV G SMDW GS + +LG+ILFNFVWNQ PI
Sbjct: 214 WAWTFYAYTITAAINMGLSIWVIPNTIPTNVRGSSMDWIGSGIGLLGMILFNFVWNQGPI 273

Query: 291 AGWGEAYXXXXXXXXXXXXXXXXXYEIKYAEVPLLPHAVTKNRHMIMILLAVFLGWGSFG 350
            GW  AY                 YE KYA  PL+P     N  ++M LLAVF GWGSFG
Sbjct: 274 VGWDTAYIIVLLIVSVAAIVAFFLYETKYANDPLIPRPAMHNHRLLMTLLAVFFGWGSFG 333

Query: 351 IWTFYYVSFQLNLRHYSPVWTGGTYFVFVIFGSIAAFFVAFSIKRLGPAILLCFALMAFD 410
           IWTFYY  F LNLR Y+P+W GG+YF+F+I+G IAA  V ++IKR+ P+++L  +++AFD
Sbjct: 334 IWTFYYFCFVLNLREYTPLWAGGSYFMFLIWGIIAAISVGYTIKRIPPSLILFLSMLAFD 393

Query: 411 AGSIMFSVLPVEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTV 470
            G IM SV PV+Q+Y+++   M  IL FGMDLSFPASSIILSD LPM+ QGMAGSLV+T+
Sbjct: 394 CGCIMLSVTPVDQTYFRMILGMMIILSFGMDLSFPASSIILSDELPMENQGMAGSLVSTM 453

Query: 471 INYSASLCLGMGVTVERQINKSGQNLLKGYRXXXXXXXXXXXXXXXXXVTYMLENFWNKH 530
           INYS S+CLG+  TVE QINK+G +LLKGYR                   +MLEN+    
Sbjct: 454 INYSMSMCLGIAGTVEHQINKNGDDLLKGYRAALYLGIGLASLGVFISALFMLENYLRMR 513

Query: 531 KESEKKRL 538
           + + K+ +
Sbjct: 514 RRNVKEEV 521

>Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}
           complement(43396..44982) [1587 nt, 529 aa]
          Length = 528

 Score =  508 bits (1307), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 251/486 (51%), Positives = 325/486 (66%)

Query: 54  DSPWQDPIYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSESNNQAWLMA 113
           +S  ++P YF+S  +E  FI +CML+QLLN AG T  L IMNVL++  +S  + + WL+A
Sbjct: 39  NSSLRNPDYFNSTTQEYAFIFSCMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVA 98

Query: 114 SFPLAAGSFILISGRLGDIYGLKKMXXXXXXXXXXXXXXXXXXKYSNSDAFFITCRAFQG 173
           SFPL +GSFIL+SGRLGDIYGLKKM                   YS+S  FFI  RAFQG
Sbjct: 99  SFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQG 158

Query: 174 LGIAFILPNIMGLVGHVYKVGSLRKNLVISVIGACAPAXXXXXXXXXXLIVTEDPEQWPW 233
           LGI+ +LPN++GL+G +YK G+L+KN+VIS++GA +P           L+ TE    WPW
Sbjct: 159 LGISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPW 218

Query: 234 VFYAFSIATFISLLMAWYSIPNNVPTNVHGLSMDWTGSTLAVLGLILFNFVWNQAPIAGW 293
            FYA+++A FI+  +++YSIPNN+PTNV+ LSMDW GS   VLGLILFNFVWNQAP  GW
Sbjct: 219 AFYAYTLAAFINTFISYYSIPNNIPTNVNRLSMDWIGSFTGVLGLILFNFVWNQAPADGW 278

Query: 294 GEAYXXXXXXXXXXXXXXXXXYEIKYAEVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWT 353
             AY                 YE++YAE PLLP  + +NR +IMIL A+  GWGSFGIWT
Sbjct: 279 NSAYLIVLLVISVIALIAFGIYELRYAENPLLPSEIIRNRQLIMILTAMTFGWGSFGIWT 338

Query: 354 FYYVSFQLNLRHYSPVWTGGTYFVFVIFGSIAAFFVAFSIKRLGPAILLCFALMAFDAGS 413
           FYY SF LNLR+YSP+W GG+YF+FVI G+I A    F +K++ PA+LL F+++ F+ G 
Sbjct: 339 FYYFSFVLNLRNYSPLWAGGSYFIFVISGTITAISCGFLMKKIRPAVLLTFSMVGFNLGC 398

Query: 414 IMFSVLPVEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINY 473
           I+FSV PV Q+Y++       IL  GMDLSFPASSIILSD LP Q+QGMAGSLVNTVINY
Sbjct: 399 IIFSVTPVHQTYFRNILGTMIILPLGMDLSFPASSIILSDNLPNQHQGMAGSLVNTVINY 458

Query: 474 SASLCLGMGVTVERQINKSGQNLLKGYRXXXXXXXXXXXXXXXXXVTYMLENFWNKHKES 533
           S SL LG+  TVE+  NK+G +LL+GYR                   YM+E  ++ +K+ 
Sbjct: 459 SNSLFLGIAGTVEQHCNKNGTDLLRGYRGALYFGIACSGVAVLIAGLYMVETIFDSYKDR 518

Query: 534 EKKRLE 539
           ++K  E
Sbjct: 519 KEKDCE 524

>KLTH0C03806g Chr3 (332195..333772) [1578 bp, 525 aa] {ON} similar
           to uniprot|P13090 Saccharomyces cerevisiae YML116W ATR1
           Multidrug efflux pump of the major facilitator
           superfamily required for resistance to aminotriazole and
           4-nitroquinoline-N-oxide
          Length = 525

 Score =  499 bits (1284), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 245/482 (50%), Positives = 320/482 (66%), Gaps = 1/482 (0%)

Query: 55  SPWQDPIYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSESNNQAWLMAS 114
           S  Q+P YF    KE +F+ + ML+QLLNQA    A  + ++LS+   ++++ QAWLMAS
Sbjct: 36  SRLQNPDYFDKQWKEYLFVISSMLSQLLNQAAALQANPLFDLLSEDLKAKASQQAWLMAS 95

Query: 115 FPLAAGSFILISGRLGDIYGLKKMXXXXXXXXXXXXXXXXXXKYSNSDAFFITCRAFQGL 174
           FPL +GSFIL+SG++GDIYGLKK                    Y+++  FFI  R+FQGL
Sbjct: 96  FPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLSSYAHNVDFFIVARSFQGL 155

Query: 175 GIAFILPNIMGLVGHVYKVGSLRKNLVISVIGACAPAXXXXXXXXXXLIVTEDPEQWPWV 234
           GIAF+LPN+ G+VG++YK  +  KN+V S+IGACAP           LI TE  E W W 
Sbjct: 156 GIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGACAPIGATLGCLFSGLIGTES-EAWAWT 214

Query: 235 FYAFSIATFISLLMAWYSIPNNVPTNVHGLSMDWTGSTLAVLGLILFNFVWNQAPIAGWG 294
           FYA++I   ++ L+AWY IP+N+PTNVH   MDW GS L V GLI+FNFVWNQAP  GW 
Sbjct: 215 FYAYTIVAALNGLIAWYVIPDNIPTNVHKFKMDWLGSFLGVCGLIMFNFVWNQAPTDGWD 274

Query: 295 EAYXXXXXXXXXXXXXXXXXYEIKYAEVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTF 354
            AY                 +E ++A+ PLLP AV  NR ++MIL ++FLGWGSFGIWT+
Sbjct: 275 SAYIIVLLVISVILLLIFIIFEARFAKEPLLPRAVLFNRKLMMILASLFLGWGSFGIWTY 334

Query: 355 YYVSFQLNLRHYSPVWTGGTYFVFVIFGSIAAFFVAFSIKRLGPAILLCFALMAFDAGSI 414
           YY++F LNLRHY+P+W GG+YF+F IFG+IAAF V  +I + GPAI+L  +++AFD G I
Sbjct: 335 YYMAFVLNLRHYTPLWAGGSYFMFAIFGTIAAFLVGHTIHKTGPAIILLASVIAFDVGCI 394

Query: 415 MFSVLPVEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYS 474
           M SV PV+Q+Y++++     IL FGMDLSFPASSIILSD LP QYQGMAGSLVNT+INYS
Sbjct: 395 MLSVTPVDQTYFRMSLGTMVILSFGMDLSFPASSIILSDQLPSQYQGMAGSLVNTMINYS 454

Query: 475 ASLCLGMGVTVERQINKSGQNLLKGYRXXXXXXXXXXXXXXXXXVTYMLENFWNKHKESE 534
            SLCLG+  T ERQ+NK G +LLKGYR                   Y +E++W + +E  
Sbjct: 455 MSLCLGVSGTAERQVNKDGTDLLKGYRAALYVGIGLASVGIFVSGAYAIEDWWTRRRERS 514

Query: 535 KK 536
            +
Sbjct: 515 VR 516

>CAGL0B02343g Chr2 complement(222130..223743) [1614 bp, 537 aa] {ON}
           similar to uniprot|P13090 Saccharomyces cerevisiae
           YML116w ATR1 Aminotriazole resistance protein or
           uniprot|Q03263 Saccharomyces cerevisiae YMR279c
          Length = 537

 Score =  487 bits (1254), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 236/449 (52%), Positives = 312/449 (69%), Gaps = 1/449 (0%)

Query: 54  DSPWQDPIYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSESNNQAWLMA 113
           +  WQ+P YF S  KE +F+ +C ++QLLNQAG      IMN+++ S +S++  QAWLMA
Sbjct: 47  NQKWQNPEYFDSTLKEYLFLCSCFVSQLLNQAGAIQTQPIMNIVADSLDSQNGKQAWLMA 106

Query: 114 SFPLAAGSFILISGRLGDIYGLKKMXXXXXXXXXXXXXXXXXXKYSNSDAFFITCRAFQG 173
           +FPL +GSFILISGR+GDIYGLKK                   KY++SD+FFI  RAFQG
Sbjct: 107 AFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVSRAFQG 166

Query: 174 LGIAFILPNIMGLVGHVYKVGSLRKNLVISVIGACAPAXXXXXXXXXXLIVTEDPEQWPW 233
           LGI+ ILPNI+G+VG +Y  GS RKN+VIS+IG  AP           LI TED  QWPW
Sbjct: 167 LGISLILPNILGIVGSIYIAGSKRKNMVISLIGCMAPIGATLGAVFSGLIGTEDANQWPW 226

Query: 234 VFYAFSIATFISLLMAWYSIPNNVPTNVHGLSMDWTGSTLAVLGLILFNFVWNQAPIAGW 293
            FY+++I   I+ +++ + IPN +PTNVHG  MDW GS L V+GLI+ NFVWNQAPI GW
Sbjct: 227 AFYSYAITAAINFVLSIWLIPNTIPTNVHGHKMDWIGSGLGVVGLIMLNFVWNQAPIDGW 286

Query: 294 GEAYXXXXXXXXXXXXXXXXXYEIKYAE-VPLLPHAVTKNRHMIMILLAVFLGWGSFGIW 352
             AY                 YE+ +    PLLP  V K+   I++L A+F GWGSFGI+
Sbjct: 287 DSAYLIVLLIISVLLLIAFFIYELHFVNGNPLLPKEVLKSPKTIIVLFALFFGWGSFGIF 346

Query: 353 TFYYVSFQLNLRHYSPVWTGGTYFVFVIFGSIAAFFVAFSIKRLGPAILLCFALMAFDAG 412
           +FYY +FQLNLRHY+P+W GGTYF+F+I+G +AA  V F+IK++ P+I+L  +++AF+ G
Sbjct: 347 SFYYFTFQLNLRHYTPLWAGGTYFMFLIWGIVAALVVGFTIKKVYPSIILFLSMVAFNCG 406

Query: 413 SIMFSVLPVEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVIN 472
           SI+ SV P+ Q+Y++ +  M  IL FGMDLSFPASSI+LSD LP+QYQGMAGSLVNT++N
Sbjct: 407 SIIMSVTPIHQTYFRNHLGMMIILSFGMDLSFPASSILLSDKLPLQYQGMAGSLVNTMVN 466

Query: 473 YSASLCLGMGVTVERQINKSGQNLLKGYR 501
           YS S CLG+   VE+ +N  G+++LKGYR
Sbjct: 467 YSMSFCLGVAGVVEQHVNNHGKDVLKGYR 495

>Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116W
           (ATR1) - predicted protein is very hydrophobic, has many
           membrane-spanning regions, several potential
           glycosylation sites, potential ATP-binding site [contig
           38] FULL
          Length = 515

 Score =  484 bits (1245), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 238/475 (50%), Positives = 317/475 (66%), Gaps = 1/475 (0%)

Query: 58  QDPIYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSESNNQAWLMASFPL 117
           Q+P YF    KE +F+ + ML+QLLNQA  T    + +VLSK  N++ + Q WLMASFPL
Sbjct: 39  QNPDYFDKPWKEYIFVLSSMLSQLLNQAATTQTNPLFDVLSKDLNAKVSQQPWLMASFPL 98

Query: 118 AAGSFILISGRLGDIYGLKKMXXXXXXXXXXXXXXXXXXKYSNSDAFFITCRAFQGLGIA 177
            +GSFIL+SG++GDIYGLKK                    Y+++  FF+  R+FQGLGIA
Sbjct: 99  VSGSFILVSGKVGDIYGLKKTLLGGYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIA 158

Query: 178 FILPNIMGLVGHVYKVGSLRKNLVISVIGACAPAXXXXXXXXXXLIVTEDPEQWPWVFYA 237
           F+LPN+MG+VG++YK  +  KNLV S+IGACAP           LI     + W W FYA
Sbjct: 159 FVLPNVMGIVGNIYKPNTEAKNLVFSLIGACAPIGATLGCVFSGLIGART-DLWGWTFYA 217

Query: 238 FSIATFISLLMAWYSIPNNVPTNVHGLSMDWTGSTLAVLGLILFNFVWNQAPIAGWGEAY 297
           ++I   ++ L+A + IPNN+PTNV+   MDW GS + V GLILFNFVWNQAPIAGWG AY
Sbjct: 218 YAITAALNGLVALWIIPNNIPTNVNEYKMDWIGSAIGVFGLILFNFVWNQAPIAGWGSAY 277

Query: 298 XXXXXXXXXXXXXXXXXYEIKYAEVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYV 357
                            YEI++A+ PLLPH+V  NR ++MIL ++F GWGSFGIWTFYY+
Sbjct: 278 IIVLLIVAVVALIAFITYEIRFAKQPLLPHSVLFNRKLMMILSSLFFGWGSFGIWTFYYM 337

Query: 358 SFQLNLRHYSPVWTGGTYFVFVIFGSIAAFFVAFSIKRLGPAILLCFALMAFDAGSIMFS 417
           SF LNLRHYSP+W GGTYF+F I+G +A+  V ++I + GPA++L  +++AFD G IM +
Sbjct: 338 SFMLNLRHYSPLWAGGTYFMFAIWGIVASLLVGYTIHKTGPAVILFLSMVAFDCGCIMLA 397

Query: 418 VLPVEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASL 477
           V PV Q+Y+++   +  IL FGMDLSFPA+SIILSD LP QYQGMAGSLV+T+I+YS SL
Sbjct: 398 VTPVHQTYFRMTLGIMIILSFGMDLSFPAASIILSDQLPSQYQGMAGSLVSTMISYSMSL 457

Query: 478 CLGMGVTVERQINKSGQNLLKGYRXXXXXXXXXXXXXXXXXVTYMLENFWNKHKE 532
           CLG+  T E Q+NK+G +LLKGY+                   +M+E++W   ++
Sbjct: 458 CLGISGTAEHQVNKNGIDLLKGYQAALYVGIGLASLGVVISGAFMIEDWWTSRRK 512

>TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {ON} 
          Length = 580

 Score =  480 bits (1236), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 229/489 (46%), Positives = 319/489 (65%), Gaps = 4/489 (0%)

Query: 59  DPIYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSESNNQAWLMASFPLA 118
            P YF +   E +FI +CM++Q ++QAG T AL IMN+L++  N+E + QAWLMASF L+
Sbjct: 88  SPKYFKNRTHEYLFIISCMVSQFMSQAGLTQALSIMNILAEELNAEKSRQAWLMASFTLS 147

Query: 119 AGSFILISGRLGDIYGLKKMXXXXXXXXXXXXXXXXXXKYSNSDAFFITCRAFQGLGIAF 178
            GSFIL+SGRLGDIYGLKK+                   YS++DAFFIT RAFQGLG+AF
Sbjct: 148 MGSFILVSGRLGDIYGLKKVLLGGYAILTIWSLICGFSSYSHNDAFFITSRAFQGLGLAF 207

Query: 179 ILPNIMGLVGHVYKVGSLRKNLVISVIGACAPAXXXXXXXXXXLIVTEDPEQWPWVFYAF 238
           +LPN +GL+G +Y+ GS++KN++I  +GA +P           +I T+DP+QWPW FY+F
Sbjct: 208 VLPNSLGLIGVIYEPGSMKKNMIIGTLGAMSPIGATLGGLFAGIIGTKDPKQWPWSFYSF 267

Query: 239 SIATFISLLMAWYSIPNNVPTNVHGLSMDWTGSTLAVLGLILFNFVWNQAPIAGWGEAYX 298
            I +F +++++WYSIPNN+PTN++ LSMDW G+ L + GL++ NFV+NQAPI GW  AY 
Sbjct: 268 GIVSFCNMILSWYSIPNNIPTNIYNLSMDWIGAILGIFGLLILNFVFNQAPIVGWQSAYI 327

Query: 299 XXXXXXXXXXXXXXXXYEIKYAEVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYVS 358
                           YE+KYA+ PL+P A++ NR M+MIL A+F GWG+FG WTFYY S
Sbjct: 328 IVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFALFCGWGAFGTWTFYYFS 387

Query: 359 FQLNLRHYSPVWTGGTYFVFVIFGSIAAFFVAFSIKRLGPAILLCFALMAFDAGSIMFSV 418
           F LN+R Y+  W GG+YF+F++ G   A    F +K++ P+++L  +++ F  G +M +V
Sbjct: 388 FVLNVRGYTAAWAGGSYFIFIVSGCAIATLCGFMMKKVPPSVILYISMIGFMGGCVMLTV 447

Query: 419 LPVEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLC 478
            P+ QSY++    +  +L  G+DLSFPA+SIILSD LP+QYQGMAGSLV T+ NYS S+C
Sbjct: 448 TPIHQSYFQNILGIMFVLPIGIDLSFPAASIILSDALPIQYQGMAGSLVYTITNYSTSIC 507

Query: 479 LGMGVTVERQINKSGQNLLKGYRXXXXXXXXXXXXXXXXXVTYMLENF----WNKHKESE 534
           LGM  +VE   N +GQN+LKGYR                   YM+ N      N    ++
Sbjct: 508 LGMAGSVEAYHNDNGQNILKGYRNAMIFADALAGLGIIVSGIYMVINLITIRENSKSTNK 567

Query: 535 KKRLEAETS 543
            K LE  ++
Sbjct: 568 PKHLETYST 576

>TBLA0C01160 Chr3 complement(246034..247836) [1803 bp, 600 aa] {ON} 
          Length = 600

 Score =  376 bits (966), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 184/480 (38%), Positives = 269/480 (56%)

Query: 58  QDPIYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSESNNQAWLMASFPL 117
           + P  F +  +E  F+   ++ Q L+Q G T  L  MN+L++  ++    Q WLMA+FPL
Sbjct: 111 RRPDIFKNRFQEFGFVLVGVIGQFLSQVGLTQVLSTMNILAEELHTTKMRQPWLMAAFPL 170

Query: 118 AAGSFILISGRLGDIYGLKKMXXXXXXXXXXXXXXXXXXKYSNSDAFFITCRAFQGLGIA 177
             G  ILISGRLGDI+GLKK+                   Y++SD  FI  R FQGLG+A
Sbjct: 171 GLGCTILISGRLGDIFGLKKVLLLGYIITTIWTLICGFSSYAHSDDLFIVSRTFQGLGLA 230

Query: 178 FILPNIMGLVGHVYKVGSLRKNLVISVIGACAPAXXXXXXXXXXLIVTEDPEQWPWVFYA 237
             LPN+  L+G +YK    +KN++  +IGA +P           L V  + + WPW FY+
Sbjct: 231 CALPNMFELIGIIYKPHCFKKNMIFCIIGAMSPIGATLGGIFAGLSVKYNIKNWPWSFYS 290

Query: 238 FSIATFISLLMAWYSIPNNVPTNVHGLSMDWTGSTLAVLGLILFNFVWNQAPIAGWGEAY 297
           F+I  F++ ++AW+ IPN++  N  GL MDW GS L + GL++ NFV+NQ PI GW  AY
Sbjct: 291 FAIVAFLNGIIAWFCIPNDIEKNPQGLKMDWIGSALGLFGLVVLNFVFNQTPIDGWSSAY 350

Query: 298 XXXXXXXXXXXXXXXXXYEIKYAEVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYV 357
                            YE+  A  PL+P  +  N  +I+ILL +F GWG F IWTFYY 
Sbjct: 351 LIVLLVVSVVALILFVIYELTMANFPLIPKGIHSNYRLILILLTLFCGWGGFAIWTFYYF 410

Query: 358 SFQLNLRHYSPVWTGGTYFVFVIFGSIAAFFVAFSIKRLGPAILLCFALMAFDAGSIMFS 417
           +FQLNLRHYSP+W   + FV +I G+I       +++R+ P ILL F+++ F  G+I+F+
Sbjct: 411 AFQLNLRHYSPLWASSSNFVLIISGTIYTIICCLAVQRMKPPILLFFSMLGFLGGNILFA 470

Query: 418 VLPVEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASL 477
           V P+ Q++++  F    +   GM  SFP++S++ ++ LP  Y+ MAGSLVN  INY+ S+
Sbjct: 471 VTPIHQTFFRNMFGSMFLFPLGMVFSFPSASMMTAETLPTHYKSMAGSLVNVAINYATSI 530

Query: 478 CLGMGVTVERQINKSGQNLLKGYRXXXXXXXXXXXXXXXXXVTYMLENFWNKHKESEKKR 537
           C+GM  +     N  GQ+LL G+R                   YM+ + W    +  K+ 
Sbjct: 531 CVGMAGSANVNHNNHGQDLLHGFRAASYLAIGLSGFSVFLSGLYMIGSIWTDRNQKMKEN 590

>Skud_15.545 Chr15 (988549..990099) [1551 bp, 516 aa] {ON} YOR378W
           (REAL)
          Length = 516

 Score =  288 bits (737), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 169/480 (35%), Positives = 245/480 (51%), Gaps = 17/480 (3%)

Query: 69  ELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSESNNQ-AWLMASFPLAAGSFILISG 127
           E  F+     AQL+ QAG   +L  ++++ KSF + +  Q +W  +++ L  G+FILI+G
Sbjct: 43  ETAFVGVLCSAQLMTQAGLGQSLAPLHIIGKSFGTTNPGQLSWFASAYSLTVGTFILIAG 102

Query: 128 RLGDIYGLKKMXXXXXXXXXXXXXXXXXXKYSNSDAFFITCRAFQGLGIAFILPNIMGLV 187
           RLGDI+G KK                    YSN   FF  CRAFQG+G AF+LPN + ++
Sbjct: 103 RLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSN-KIFFDCCRAFQGMGPAFLLPNAIAIL 161

Query: 188 GHVYKVGSLRKNLVISVIGACAPAXXXXXXXXXXLIVTEDPEQWPWVFYAFSIATFISLL 247
           G  YK G  RKN+V S+ GACAP           L+       WPW ++   IA F   +
Sbjct: 162 GRTYKSGK-RKNMVFSLFGACAPGGFVLGAVFSSLL--GQLAWWPWAYWIMGIACFFLAI 218

Query: 248 MAWYSIPNNVPTNVHGLS------MDWTGSTLAVLGLILFNFVWNQAPIAGWGEAYXXXX 301
             ++ IP+    + H  S      +D+ GS   V+GLILFNF WNQ P+ GW   Y    
Sbjct: 219 AGYFIIPHTAMPSRHASSFKLLERVDFAGSVTGVIGLILFNFAWNQGPVVGWQTPYTYIL 278

Query: 302 XXXXXXXXXXXXXYEIKYAEVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYVSFQL 361
                         E + A  PLLP A   +     +L  +  GW SFGIW FY   F  
Sbjct: 279 LIVGTVFLAIFAFIESR-AAFPLLPFAALSS-DTAFVLSCIAAGWASFGIWIFYTWQFME 336

Query: 362 NLRHYSPVWTGGTYFVFVIFGSIAAFFVAFSIKRLGPAILLCFALMAFDAGSIMFSVLPV 421
           + R  +P+ +   +    + G  AA    + + R  P+ ++ FA+ AF AG+I+ +  PV
Sbjct: 337 DSRGQTPLLSSAQFSPVAVSGFCAALTTGYLLSRTPPSTVMLFAMTAFTAGTILIATAPV 396

Query: 422 EQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGM 481
            Q+YW   F    ++ +GMD+SFPA++I+LSD +P ++QG+A SLVNTV+NYS S+ LG+
Sbjct: 397 HQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGI 456

Query: 482 GVTVERQINKSGQNLLKGYRXXXXXXXXXXXXXXXXXVTYMLENFWNKHKESEKKRLEAE 541
             T+E  +N  G   LKGYR                   Y     W+  K+S+K+  E +
Sbjct: 457 AGTIESNVNDGGAKPLKGYRCSWYMGIGLSGLGIFVAAIYA----WSTFKKSKKRTSEKQ 512

>Smik_15.560 Chr15 (995453..997003) [1551 bp, 516 aa] {ON} YOR378W
           (REAL)
          Length = 516

 Score =  282 bits (721), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 167/476 (35%), Positives = 240/476 (50%), Gaps = 13/476 (2%)

Query: 69  ELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSESNNQ-AWLMASFPLAAGSFILISG 127
           E  F+     AQL+ QAG   +L  ++++  SF + +  Q +W  +++ L  G+FILI+G
Sbjct: 43  ESAFVGVLCSAQLMTQAGLGQSLAPLHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAG 102

Query: 128 RLGDIYGLKKMXXXXXXXXXXXXXXXXXXKYSNSDAFFITCRAFQGLGIAFILPNIMGLV 187
           RLGDI+G KK                    YSN   FF  CRAFQG+G AF+LPN + ++
Sbjct: 103 RLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSN-QIFFDCCRAFQGMGPAFLLPNAIAIL 161

Query: 188 GHVYKVGSLRKNLVISVIGACAPAXXXXXXXXXXLIVTEDPEQWPWVFYAFSIATFISLL 247
           G  YK G  RKN+V S+ GA AP           ++       WPW ++   IA F+  +
Sbjct: 162 GRTYKPGR-RKNMVFSLFGASAPGGFVLGAVFSSML--GQLAWWPWAYWLMGIACFLLAV 218

Query: 248 MAWYSIPNNVPTNVHGLS------MDWTGSTLAVLGLILFNFVWNQAPIAGWGEAYXXXX 301
             +Y IP+    N    S      +D+ GS   V+GLILFNF WNQ P+ GW   Y    
Sbjct: 219 AGYYLIPHTPMPNRDVASFKLLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYAL 278

Query: 302 XXXXXXXXXXXXXYEIKYAEVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYVSFQL 361
                         E + A  PLLP A   +     +L  +  GW SFGIW FY   F  
Sbjct: 279 LIVGTVFLIIFAFIESR-AAFPLLPFAALSS-DTAFVLSCIAAGWASFGIWIFYTWQFME 336

Query: 362 NLRHYSPVWTGGTYFVFVIFGSIAAFFVAFSIKRLGPAILLCFALMAFDAGSIMFSVLPV 421
           + R  +P+ +   +    I G  AA    F +    P+ ++ FA+ AF  G+I+ +  PV
Sbjct: 337 DSRGQTPLLSSAQFSPVAISGFCAALMTGFLLSHTPPSTVMFFAMTAFTVGTILIATAPV 396

Query: 422 EQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGM 481
            Q+YW   F    ++ +GMD+SFPA++I+LSD +P ++QG+A SLVNTV+NYS S+ LG+
Sbjct: 397 HQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGI 456

Query: 482 GVTVERQINKSGQNLLKGYRXXXXXXXXXXXXXXXXXVTYMLENFWNKHKESEKKR 537
             T+E  +N  G N+LKGYR                  TY +  F    K   +K+
Sbjct: 457 AGTIESNVNDGGANVLKGYRCSWYLGIGLSGFGIFVAATYAVSTFMKSKKRVSEKQ 512

>YOR378W Chr15 (1049511..1051058) [1548 bp, 515 aa] {ON} Putative
           paralog of ATR1, but not required for boron tolerance;
           member of the DHA2 family of drug:H+ antiporters;
           YOR378W is not an essential gene
          Length = 515

 Score =  275 bits (704), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 164/476 (34%), Positives = 238/476 (50%), Gaps = 13/476 (2%)

Query: 69  ELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSESNNQ-AWLMASFPLAAGSFILISG 127
           E  F+     AQL+ QAG   +L  ++++  SF + +  Q +W  +++ L  G+FILI+G
Sbjct: 42  ESAFVGVLCSAQLMTQAGLGQSLAPLHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAG 101

Query: 128 RLGDIYGLKKMXXXXXXXXXXXXXXXXXXKYSNSDAFFITCRAFQGLGIAFILPNIMGLV 187
           RLGDI+G KK                    YSN   FF  CRAFQG+G AF+LPN + ++
Sbjct: 102 RLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSN-QIFFDCCRAFQGMGPAFLLPNAIAIL 160

Query: 188 GHVYKVGSLRKNLVISVIGACAPAXXXXXXXXXXLIVTEDPEQWPWVFYAFSIATFISLL 247
           G  YK G  RKN+V S+ GA AP           ++       WPW ++   IA F+  +
Sbjct: 161 GRTYKPGR-RKNMVFSLFGASAPGGFFLGAVFSSML--GQLAWWPWAYWIMGIACFVLAV 217

Query: 248 MAWYSIPNNVPTNVHGLS------MDWTGSTLAVLGLILFNFVWNQAPIAGWGEAYXXXX 301
             ++ IP+    +    S      +D+ GS   V+GLILFNF WNQ P+ GW   Y    
Sbjct: 218 AGYFVIPHTPMPSRDASSFKLLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYAL 277

Query: 302 XXXXXXXXXXXXXYEIKYAEVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYVSFQL 361
                         E + A  PLLP A   +     +L  +  GW SFGIW FY   F  
Sbjct: 278 LIVGTFFLVIFAYIESR-AAFPLLPFAALSS-DTAFVLSCIAAGWASFGIWIFYTWQFME 335

Query: 362 NLRHYSPVWTGGTYFVFVIFGSIAAFFVAFSIKRLGPAILLCFALMAFDAGSIMFSVLPV 421
           + R  +P+ +   +    I G  AA    F +    P+ ++ FA+ AF  G+I+ +  PV
Sbjct: 336 DSRGQTPLLSSAQFSPVAISGFCAAVTTGFLLSHTPPSTVMLFAMTAFTVGTILIATAPV 395

Query: 422 EQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGM 481
            Q+YW   F    ++ +GMD+SFPA++I+LSD +P ++QG+A SLVNTV+NYS S+ LG+
Sbjct: 396 HQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGI 455

Query: 482 GVTVERQINKSGQNLLKGYRXXXXXXXXXXXXXXXXXVTYMLENFWNKHKESEKKR 537
             T+E ++N  G   LKGYR                  TY    F    K   +K+
Sbjct: 456 AGTIESRVNDGGAKPLKGYRCSWYMGIGLSGLGIFVAATYAWSTFMKSKKRISEKQ 511

>Suva_8.435 Chr8 (786917..788464) [1548 bp, 515 aa] {ON} YOR378W
           (REAL)
          Length = 515

 Score =  273 bits (699), Expect = 9e-85,   Method: Compositional matrix adjust.
 Identities = 167/479 (34%), Positives = 241/479 (50%), Gaps = 14/479 (2%)

Query: 69  ELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSESNNQ-AWLMASFPLAAGSFILISG 127
           E  F+     AQL+ QAG   ++  ++++  SF + +  Q +W  +S+ L  G+FILI+G
Sbjct: 43  EAAFVGVLCSAQLMTQAGLGQSIAPLHIIGDSFGTTNPGQLSWFASSYSLTVGTFILIAG 102

Query: 128 RLGDIYGLKKMXXXXXXXXXXXXXXXXXXKYSNSDAFFITCRAFQGLGIAFILPNIMGLV 187
           RLGDI+G +K                    YSN   FF  CRAFQG+G AF+LPN + ++
Sbjct: 103 RLGDIFGHRKFFILGFFWYALWSLLAGFSVYSN-KIFFDCCRAFQGMGPAFLLPNAIAIL 161

Query: 188 GHVYKVGSLRKNLVISVIGACAPAXXXXXXXXXXLIVTEDPEQWPWVFYAFSIATFISLL 247
           G  YK G  RKN+V S+ GA AP           ++       WPW ++   IA F+  +
Sbjct: 162 GRTYKPGK-RKNMVFSLFGASAPGGFVLGAVFSSML--GQLAWWPWAYWIMGIACFLLAV 218

Query: 248 MAWYSIPN------NVPTNVHGLSMDWTGSTLAVLGLILFNFVWNQAPIAGWGEAYXXXX 301
             ++ IP+      + P+      +D+ GS   V+GLILFNF WNQ P+ GW   Y    
Sbjct: 219 AGYFVIPHVQMPSRDSPSFNMLERVDFAGSVTGVIGLILFNFAWNQGPVVGWETPYTYVL 278

Query: 302 XXXXXXXXXXXXXYEIKYAEVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYVSFQL 361
                         E + A  PLLP A   +     +L  +  GW SFGIW FY   F  
Sbjct: 279 LIVGTVFLGVFVFIESR-AAYPLLPFAALSS-DAAFVLGCIAAGWSSFGIWIFYTWQFME 336

Query: 362 NLRHYSPVWTGGTYFVFVIFGSIAAFFVAFSIKRLGPAILLCFALMAFDAGSIMFSVLPV 421
             R  SP+ +   +    I G  AA    F +     + ++ FA+ AF  G I+ +  PV
Sbjct: 337 ESRKQSPLLSSAQFAPVAISGFCAAVTTGFLLSHTPASTVMLFAMTAFTVGIILIATAPV 396

Query: 422 EQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGM 481
            Q+YW   F    ++ +GMD+SFPA++I+LS+ +P ++QG+A SLVNTV+NYS S+ LG+
Sbjct: 397 HQTYWAQTFVSIIVMPWGMDMSFPAATIMLSNSMPHEHQGLAASLVNTVVNYSISIGLGI 456

Query: 482 GVTVERQINKSGQNLLKGYRXXXXXXXXXXXXXXXXXVTYMLENFW-NKHKESEKKRLE 539
             T+E Q+N  G N LKGYR                   Y    F  +K K SEK+ +E
Sbjct: 457 AGTIESQVNDGGANALKGYRCSWYMGIGLSGLGIFVAAVYASSTFLKSKKKASEKQYIE 515

>KLLA0B00352g Chr2 (22476..23972) [1497 bp, 498 aa] {ON} highly
           similar to uniprot|Q08902 Saccharomyces cerevisiae
           YOR378W
          Length = 498

 Score =  269 bits (688), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 160/451 (35%), Positives = 236/451 (52%), Gaps = 14/451 (3%)

Query: 58  QDPIYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSESNNQ-AWLMASFP 116
           Q+   ++S  KE   I     AQL+ QAG   ++  + ++  SF  ++  Q +W  ++F 
Sbjct: 18  QNSREWTSLLKEGFAIMVLCSAQLMTQAGLAQSIVPLQIIGDSFGIKNPGQLSWFASAFS 77

Query: 117 LAAGSFILISGRLGDIYGLKKMXXXXXXXXXXXXXXXXXXKYSNSDAFFITCRAFQGLGI 176
           L  G+FILI+GRLGD +G KK                    YSN   FF  CRAFQG+G 
Sbjct: 78  LTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGFSVYSN-QIFFDCCRAFQGIGP 136

Query: 177 AFILPNIMGLVGHVYKVGSLRKNLVISVIGACAPAXXXXXXXXXXLIVTEDPEQWPWVFY 236
           AF LPN + ++   Y+ G  ++N++ S+ GACAP+          L+   +   WPW ++
Sbjct: 137 AFTLPNAIAIIARTYRPGR-KQNMIFSLFGACAPSGFVVGAVFSSLL--SEFAWWPWAYW 193

Query: 237 AFSIATFISLLMAWYSIPNNVPTNVHGL-----SMDWTGSTLAVLGLILFNFVWNQAPIA 291
              I  F+  +  +  IP++ P +          +D  GS   V+GLILFNF WNQ P+ 
Sbjct: 194 IMGITCFLLGVAGYLVIPHHPPIHPDEKCSLVERIDVAGSVTGVVGLILFNFAWNQGPVV 253

Query: 292 GWGEAYXXXXXXXXXXXXXXXXXYEIKYAEVPLLPHAVTK-NRHMIMILLAVFLGWGSFG 350
           GW  +Y                  E + A+ PLLP  V K +   I ++  +  GW SFG
Sbjct: 254 GWETSYTYALLIVGSAFLAAFGFIESR-AKHPLLP--VRKLSSDTIFVMGCIAAGWSSFG 310

Query: 351 IWTFYYVSFQLNLRHYSPVWTGGTYFVFVIFGSIAAFFVAFSIKRLGPAILLCFALMAFD 410
           IW +Y      NLR   P+ +   +    I G  AA    F + R  P+ ++  A++AF 
Sbjct: 311 IWVYYTWQLMANLRDQPPLLSSAQFVPVAISGLCAAMSTEFLLTRTSPSTVMIIAMIAFT 370

Query: 411 AGSIMFSVLPVEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTV 470
            GSI+ + +PV Q+YW   F    ++ +GMD+SFPA++IILS  +P  +QG+A SLVNT+
Sbjct: 371 VGSILVATVPVSQTYWAQTFVSIIVMPWGMDMSFPAATIILSTAMPASHQGLAASLVNTI 430

Query: 471 INYSASLCLGMGVTVERQINKSGQNLLKGYR 501
           INYS S+ LG   T+E QI+    +LLKGYR
Sbjct: 431 INYSISIGLGFAGTIESQISDGEDDLLKGYR 461

>KLTH0C10560g Chr3 (875216..876763) [1548 bp, 515 aa] {ON} similar
           to uniprot|Q08902 Saccharomyces cerevisiae YOR378W
           Hypothetical ORF
          Length = 515

 Score =  265 bits (678), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 160/439 (36%), Positives = 229/439 (52%), Gaps = 12/439 (2%)

Query: 69  ELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSESNNQ-AWLMASFPLAAGSFILISG 127
           E  F+     AQL+ QAG   ++  ++++  SF + +  Q +W  A++ L  G+FILI+G
Sbjct: 45  EAAFVGVICGAQLMTQAGLGQSIAPLHIIGDSFGTRNPGQLSWFAAAYSLTVGTFILIAG 104

Query: 128 RLGDIYGLKKMXXXXXXXXXXXXXXXXXXKYSNSDAFFITCRAFQGLGIAFILPNIMGLV 187
           RLGD+YG KK                    YSN   FF  CRAFQG+G A +LPN + ++
Sbjct: 105 RLGDVYGHKKFFIIGFFWYALWSLLAGFSVYSN-QIFFDCCRAFQGIGPALLLPNAIAIL 163

Query: 188 GHVYKVGSLRKNLVISVIGACAPAXXXXXXXXXXLIVTEDPEQWPWVFYAFSIATFISLL 247
           G  Y  G  RK +++S+ GA APA          +        WPW ++A  I  F   +
Sbjct: 164 GRTYVPGR-RKAMILSLFGATAPAGFVLGAVFSSIF--GQLTWWPWAYWAMGIVCFFLAV 220

Query: 248 MAWYSIPN----NVPTNVHGLS-MDWTGSTLAVLGLILFNFVWNQAPIAGWGEAYXXXXX 302
                IP      + T+V     +D  GS   V+GL+L NF WNQ P+ GW   Y     
Sbjct: 221 AGILVIPRMPLPELDTSVSTYQRLDIPGSVTGVIGLVLLNFAWNQGPVVGWQTPYTYSLL 280

Query: 303 XXXXXXXXXXXXYEIKYAEVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYVSFQLN 362
                        E + A  PLLP +   +     +L  V  GW SFGIW +Y+  F   
Sbjct: 281 IVSAVFLCVFAFIESR-APHPLLPLSALSS-DAAFVLGCVGAGWSSFGIWIYYFWLFLEE 338

Query: 363 LRHYSPVWTGGTYFVFVIFGSIAAFFVAFSIKRLGPAILLCFALMAFDAGSIMFSVLPVE 422
           LR +SP+ T   +    I G  AA    F I R+  ++++ FA+ AF  G I+ +  PV+
Sbjct: 339 LRGHSPLLTSAQFAPVAISGLCAALTTGFVITRVRASLVMLFAMTAFTVGGILIATAPVK 398

Query: 423 QSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGMG 482
           Q YW   F    ++ +GMD+SFPA++I+LSD +P ++QG+A SLVN V+NYS S+ LG+ 
Sbjct: 399 QVYWAQAFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNVVVNYSISIGLGLA 458

Query: 483 VTVERQINKSGQNLLKGYR 501
            TVE ++N  G NLLKGYR
Sbjct: 459 GTVEGRVNNGGANLLKGYR 477

>Kwal_23.6547 s23 (1635677..1637212) [1536 bp, 511 aa] {ON} YOR378W
           - Hypothetical ORF [contig 358] FULL
          Length = 511

 Score =  259 bits (661), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 156/485 (32%), Positives = 238/485 (49%), Gaps = 16/485 (3%)

Query: 65  SFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSESNNQ-AWLMASFPLAAGSFI 123
           S  +E +F+     AQL+ QAG   ++  + ++  SF   +  Q +W  A++ L  G+FI
Sbjct: 35  SLMREALFVGILSCAQLMTQAGLAQSIAPVRIIGNSFGISNPGQLSWFSAAYSLTVGTFI 94

Query: 124 LISGRLGDIYGLKKMXXXXXXXXXXXXXXXXXXKYSNSDAFFITCRAFQGLGIAFILPNI 183
           LI+GRLGD++G KK+                   YSN   FF  CRA QG+G AF+LPN 
Sbjct: 95  LIAGRLGDLFGHKKLFVVGFLWYSLWSLLAGFSVYSN-QIFFDCCRALQGIGPAFLLPNS 153

Query: 184 MGLVGHVYKVGSLRKNLVISVIGACAPAXXXXXXXXXXLIVTEDPEQWPWVFYAFSIATF 243
           + ++G  Y  G  RK +V S+ GA AP           +        WPW ++A   A  
Sbjct: 154 IAILGRTYTPGK-RKQMVFSIFGATAPGGFVLGSVFSSIF--SQLAWWPWAYWAMGTACL 210

Query: 244 ISLLMAWYSIPNNVPTNVH---GL--SMDWTGSTLAVLGLILFNFVWNQAPIAGWGEAYX 298
           +  +     IP   P  +    G+   +D  G+T  +LGL L NF WNQ P+ GW   Y 
Sbjct: 211 VLGVAGIIVIPQAPPPKIDISAGILERIDAAGATTGILGLALVNFAWNQGPVVGWQTPYT 270

Query: 299 XXXXXXXXXXXXXXXXYEIKYAEVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYVS 358
                            E + A  PLLP A      +  +L  +  GW SFGIW FY+  
Sbjct: 271 YALLIVGFVFLLVFSLIESR-ARFPLLPFAALST-DLAYVLGCIAAGWSSFGIWIFYFWQ 328

Query: 359 FQLNLRHYSPVWTGGTYFVFVIFGSIAAFFVAFSIKRLGPAILLCFALMAFDAGSIMFSV 418
           F  + R  SP+ T   +    I G  AA    + +  +    ++  A++AF  G ++ + 
Sbjct: 329 FLEDSRSQSPLLTSAQFVPVAISGLCAALTTGYILSHVPACAVMLIAMIAFTVGGVLVAT 388

Query: 419 LPVEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLC 478
            P+ Q+YW   F    I+ +GMD+SFPA++I++S+ +P ++QG+A SLVNTV+NYS SL 
Sbjct: 389 APINQTYWAQTFVSLIIMPWGMDMSFPAATIMISNAMPHEHQGLAASLVNTVVNYSISLA 448

Query: 479 LGMGVTVERQINKSGQNLLKGYRXXXXXXXXXXXXXXXXXVTYMLENFWNKHKESEKKRL 538
           LG   T+E ++N  G N L+GYR                 + Y     W+  K+ ++++L
Sbjct: 449 LGFAGTIETRVNNKGANRLEGYRGAWYMGIGLSGLGVLVAIVYA----WSTLKKFKEEQL 504

Query: 539 EAETS 543
             ++S
Sbjct: 505 SEKSS 509

>TDEL0G04950 Chr7 complement(922428..923966) [1539 bp, 512 aa] {ON} 
          Length = 512

 Score =  248 bits (633), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 146/451 (32%), Positives = 233/451 (51%), Gaps = 17/451 (3%)

Query: 57  WQDPIYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSESNNQAWLMASFP 116
           W     F    KE  F+ T ++AQ  NQAG T  L ++NVLS SF+ +     +L+ S+P
Sbjct: 38  WLKSSNFHFLCKEYAFVFTGVMAQAFNQAGGTMILPLVNVLSDSFHGK-----FLLNSYP 92

Query: 117 LAAGSFILISGRLGDIYGLKKMXXXXXXXXXXXXXXXXXXKYSNSDAFFITCRAFQGLGI 176
           +  GSF+LI GRLG+++G K+                   +YS S  F++ CRAFQG+G+
Sbjct: 93  MVCGSFMLIGGRLGEVHGYKETLLGGYIILILSSLLGGLSRYSKSSIFYVICRAFQGVGM 152

Query: 177 AFILPNIMGLVGHVYK--VGSLRKNLVISVIGACAPAXXXXXXXXXXLIVTEDPEQWPWV 234
           A ILPN      + Y+    + RK ++ ++IG  A            + VT     W W 
Sbjct: 153 ALILPNFSAAYDYRYQSQAKAHRKTILSTIIGCGASTGAFLGTFLSGICVTRSESNWSWA 212

Query: 235 FYAFSIATFISLLMAWYSIPNNVPTN----VHGLSMDWTGSTLAVLGLILFNFVWNQAPI 290
           +Y ++IA  ++L +++YS+P+N+       ++GL   W  +     GL++ N   N A +
Sbjct: 213 YYTYTIAATLTLALSYYSVPDNITKKNKPCLNGL--GWFSNR--SCGLLMLNVACNLAAV 268

Query: 291 AGWGEAYXXXXXXXXXXXXXXXXXYEIKYAEVPLLPHAVTKNRHMIMILLAVFLGWGSFG 350
           A    ++                 +E+K++E P+    +  N  + ++L ++F GWG++G
Sbjct: 269 ASSNWSHIIVLLVVFVCLLLLFLVFELKFSEDPVFSKELFTNASVSLVLASIFFGWGTYG 328

Query: 351 IWTFYYVSFQLNLRHYSPVWTGGTYFVFVIFGSIAAFFVAFSIKRLGPAILLCFALMAFD 410
           IW+ Y+  F LNLR+YSP+  G TY   VI G +A   ++  +KR GP + L F+ + F 
Sbjct: 329 IWSGYFFRFLLNLRNYSPLAAGSTYLTLVIGGYVAEIGISMLVKRTGPKLFLLFSSLGFT 388

Query: 411 AGSIMFSVLPVEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTV 470
              I+ SV P+ QSY++        L  G+D SFP+S+IIL + LP +Y  M   L N +
Sbjct: 389 CSIIILSVTPIHQSYFRSTLGSMIFLALGLDFSFPSSAIILQNELPSKYHEMTAVLTNGI 448

Query: 471 INYSASLCLGMGVTVERQINKSGQNLLKGYR 501
            NY+ S   G+  +  R +  S   L+K YR
Sbjct: 449 FNYAISFWPGICNSALRSL--SSIELIKYYR 477

>KNAG0D00130 Chr4 complement(6264..7961) [1698 bp, 565 aa] {ON}
           YOR378W
          Length = 565

 Score =  171 bits (434), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 118/426 (27%), Positives = 199/426 (46%), Gaps = 14/426 (3%)

Query: 69  ELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFN-SESNNQAWLMASFPLAAGSFILISG 127
           E++F+     +Q+L  AG    +  M+V+ + F  +  ++  W    +    GSF+LI+G
Sbjct: 78  EIIFVLLVSSSQVLGLAGAVQGIPQMDVIVEWFKLTHPSDSGWCNGGYATTYGSFVLIAG 137

Query: 128 RLGDIYGLKKMXXXXXXXXXXXXXXXXXXKYSNSDAFFITCRAFQGLGIAFILPNIMGLV 187
           ++GD+ G K M                  +Y  S  FF  CRA QG+G AF   + + ++
Sbjct: 138 KMGDMNGHKSMFLIGYAWLALWSLLTGFSRYCPSSHFFFFCRAAQGIGAAFTFTSALSIL 197

Query: 188 GHVYKVGSLRKNLVISVIGACAPAXXXXXXXXXXLIVTEDPEQWPWVFYAFSIATFISLL 247
           G  Y     RKN + S  GAC             L        W W +++ +IA  + ++
Sbjct: 198 GKSYPPCK-RKNFIFSFFGACGSFGVVLGMVFSALFT--QLAHWSWAYWSMAIACVVIII 254

Query: 248 MAWYSIPNNVPTNVHGLS----MDWTGSTLAVLGLILFNFVWNQAPIAGWGEAYXXXXXX 303
           ++ + IP +V    H  S     D+ G+ L V GL+LF+  WNQAP  G+G  Y      
Sbjct: 255 LSIFFIPGDV-VEKHETSNVFYFDYLGAFLFVTGLVLFSVAWNQAPTYGFGRTYVYVLLI 313

Query: 304 XXXXXXXXXXXYEIKYAEVPLLP-HAVTKNRHMIMILLAVFLGWGSFGIWTFYYVSFQLN 362
                       E K  + PLLP   ++ N   + +LLA+F  + SF +W  Y   F L 
Sbjct: 314 VSVVILALAMYVETKVDD-PLLPWTHISANT--LKVLLAIFFAYASFTMWAAYTFRFNLM 370

Query: 363 LRHYSPVWTGGTYFVFVIFGSIAAFFVAFSIK-RLGPAILLCFALMAFDAGSIMFSVLPV 421
            +  + +          + G  AA F A  +   +   I +  +L+AF    I+ + +  
Sbjct: 371 AKGDTLLLAAAKMTPMAVSGVFAALFSALLLNIHVQVQIRMLISLLAFLVPPILMATMGA 430

Query: 422 EQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGM 481
            Q+YW   F    ++ FG+D+SFP+++++LS+ +P +++G+  SLV  V+NY+ +L    
Sbjct: 431 GQTYWGEVFVTTIVISFGLDISFPSATLLLSNRIPDKFKGLGASLVGAVLNYATALGPPT 490

Query: 482 GVTVER 487
             +V R
Sbjct: 491 AASVLR 496

>KAFR0C04860 Chr3 (964552..966156) [1605 bp, 534 aa] {ON}  YOR378W
          Length = 534

 Score =  144 bits (362), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 115/426 (26%), Positives = 198/426 (46%), Gaps = 13/426 (3%)

Query: 68  KELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSESNNQ---AWLMASFPLAAGSFIL 124
           KE++ +      Q ++  G    +  M  ++ +F+   +      W  A++   A +F++
Sbjct: 47  KEIIIVLLISSGQFISLLGAVQGIPQMASIASTFSLRPDQNLELGWCNAAYATTATTFVI 106

Query: 125 ISGRLGDIYGLKKMXXXXXXXXXXXXXXXXXXKYSNSDA-FFITCRAFQGLGIAFILPNI 183
           I+G+LGDI G K M                  KY+ ++A FF  CR  QG+G AF+ P  
Sbjct: 107 IAGKLGDINGHKNMFIFGYAWLTLWSLLTGFSKYAKANAVFFYFCRGAQGIGSAFLTPTG 166

Query: 184 MGLVGHVYKVGSLRKNLVISVIGACAPAXXXXXXXXXXLIVTEDPEQWPWVFYAFSIATF 243
           + L+G  Y     RKN V S  GAC P           L        W W +++ ++   
Sbjct: 167 LALLGKHYPPCK-RKNYVFSFYGACGPFGIVAGSVFSALFT--QLTTWAWTYWSMAVTCL 223

Query: 244 ISLLMAWYSIP-NNVPTNVHG--LSMDWTGSTLAVLGLILFNFVWNQAPIAGWGEAYXXX 300
           I  ++++  IP +N P        S D+ G    + G+ILF+ VWNQAP++ +   Y   
Sbjct: 224 IITILSYIFIPKDNTPKRERSAFYSFDYVGGFCGITGMILFSVVWNQAPLSHFKAPYVYS 283

Query: 301 XXXXXXXXXXXXXXYEIKYAEVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYVSFQ 360
                          + +  + PL+P   +   ++I  L+ VF G+  F IW FY   F 
Sbjct: 284 LLIVSVVFMTMALIIDSRVKD-PLIPWK-SMCSNVIKALIVVFFGFLGFTIWLFYSWRFY 341

Query: 361 LNLRHYSPVWTGGTYFVFVIFGSIAAFFVAFSIKRLGPAIL-LCFALMAFDAGSIMFSVL 419
           L  ++ S +     +    I G  AA F    + +  P  L L  A+ AF   +I+ S +
Sbjct: 342 LVAKNDSLLLAAAKFIPLGISGIFAACFSVLLLNKKVPVQLRLLTAVCAFLICAILISTM 401

Query: 420 PVEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCL 479
            ++++YW   F    I+  G+D++FP+++++LS+G+  + QG+A +L  T +NY  +L  
Sbjct: 402 TLQETYWGNAFVATVIIAIGLDVAFPSATLLLSNGVLNEQQGLAAALAATALNYGTALGP 461

Query: 480 GMGVTV 485
           G+   +
Sbjct: 462 GVATLI 467

>SAKL0C06116g Chr3 complement(571813..572370) [558 bp, 185 aa] {ON}
           some similarities with uniprot|P13090 Saccharomyces
           cerevisiae YML116W ATR1 Multidrug efflux pump of the
           major facilitator superfamily required for resistance to
           aminotriazole and 4-nitroquinoline-N-oxide
          Length = 185

 Score =  135 bits (339), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 73/190 (38%), Positives = 105/190 (55%), Gaps = 34/190 (17%)

Query: 77  MLAQLLNQAGQTHALCIMNVLSKSFNSESNNQAWLMASFPLAAGSFILISGRLGDIYGLK 136
           M++QLLNQ G T  L ++NVLS+ F S +  Q  L+AS PL +GSFIL+SG++GDIYGLK
Sbjct: 1   MMSQLLNQVGTTQTLPLINVLSRGFESSTAEQTRLVASIPLVSGSFILVSGKVGDIYGLK 60

Query: 137 KMXXXXXXXXXXXXXXXXXXKYSNSDAFFITCRAFQGLGIAFILPNIMGLVGHVYKVGSL 196
                               +Y+ S  FF+  RAFQGLG+AF+LPN+MG V +VY  GS+
Sbjct: 61  NTLLFGYATVIVWSFICGLTRYAGSVQFFVIARAFQGLGLAFVLPNVMGTVSNVYIAGSI 120

Query: 197 RKNLVISVIGACAPAXXXXXXXXXXLIVTEDPEQWPWVFYAFSIATFISLLMAWYSIPNN 256
           RKN+V                                  YA+++A  +++ +  +++P N
Sbjct: 121 RKNMV----------------------------------YAYTVAVSLNMALCVWALPWN 146

Query: 257 VPTNVHGLSM 266
           +PTNV G +M
Sbjct: 147 IPTNVRGQAM 156

>NCAS0A05720 Chr1 (1117491..1119182) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  134 bits (337), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 114/438 (26%), Positives = 190/438 (43%), Gaps = 25/438 (5%)

Query: 68  KELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFN---SESNNQAWLMASFPLAAGSFIL 124
           +E MFI     +Q ++ A  + A+  M+ ++  F      S    W  A+F +  G+FI+
Sbjct: 70  RECMFIVIIASSQFISLAAASQAILQMDAITAWFQLPADRSLEAGWANAAFAITCGTFII 129

Query: 125 ISGRLGDIYGLKKMXXXXXXXXXXXXXXXXXXKYS--NSDAFFITCRAFQGLGIAFILPN 182
            +G+L D+ G K +                  +Y+      FF   R  QG+G A + P+
Sbjct: 130 PAGKLCDLIGSKTVFIFGYAWYTLWSLLVGISRYAPKGQATFFFFGRGCQGIGAAALFPS 189

Query: 183 IMGLVGHVYKVGSLRKNLVISVIGACAPAXXXXXXXXXXLIVTEDPEQWPWVFYAFSIAT 242
            + L+G  Y   S +KN+V S+ G C P           +        W W +++ +I +
Sbjct: 190 SLALLGKYYP-PSCKKNIVFSLYGFCVPLGVVVGGVFSAIFT--QLAHWSWNYWSMAIVS 246

Query: 243 -FISLLMAWYSIPNNVPTN---------VHGLSMDWTGSTLAVLGLILFNFVWNQAPIAG 292
            F +L+  +Y  P+ +  +          H    D+ G+ L V  L+LF   WNQA    
Sbjct: 247 AFFTLISCFYIPPDEIIKSEEQKKKRAWFHLPKFDYLGTFLYVASLLLFAVCWNQATGFK 306

Query: 293 WGEAYXXXXXXXXXXXXXXXXXYEIKYAEVPLLPHAVTKNRHMIMILLAVFLGWGSFGIW 352
           +                      E  Y + P++P A   +   I  LL VF  + SF IW
Sbjct: 307 FKSVQVYVTLIVSLVCFVAMVIVEF-YVDDPIIP-ARKIHPQTIKALLVVFFSYLSFTIW 364

Query: 353 TFYYVSFQLNLRHYSPVWTGGTYFVFVIFGSIAAFFVAFSIKRLGPA-ILLCFALMAFDA 411
            FY   +   +R+ + +     +    I G IAA F    I    P  I L     +F  
Sbjct: 365 LFYLWKYFTVVRNDTVLLGAAKFVPLSIAGFIAALFSILLISTAVPVQIRLLAGACSFLL 424

Query: 412 GSIMFSVLPVEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVI 471
             I+F  L   +SYW   F    I+  G+D+SFP+++++LS+G+P + +G++ +LV T +
Sbjct: 425 AHILFITLSRTESYWARPFLTIIIISIGLDISFPSATLLLSNGVPQELRGISAALVGTAL 484

Query: 472 NYSASLCLGMGVTVERQI 489
           NY      G+G  + + I
Sbjct: 485 NYGT----GIGPPIAQTI 498

>CAGL0L02519g Chr12 complement(297555..299144) [1590 bp, 529 aa]
           {ON} similar to uniprot|Q08902 Saccharomyces cerevisiae
           YOR378w
          Length = 529

 Score =  120 bits (301), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 100/423 (23%), Positives = 183/423 (43%), Gaps = 20/423 (4%)

Query: 68  KELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSESNNQA---WLMASFPLAAGSFIL 124
           +E+  +   + +QL+   G    + I   L + +  E        W  AS+ L +   +L
Sbjct: 37  REIFLVIILISSQLVTLIGAVQGVPIAAYLRERYRIEPAKGGLVGWANASYMLGSAVMVL 96

Query: 125 ISGRLGDIYGLKKMXXXXXXXXXXXXXXXXXXKYSNSD-AFFITCRAFQGLGIAFILPNI 183
           I+G+LGD+ G K+M                   Y   + AF+ T RA QG+G  FI+PN 
Sbjct: 97  IAGKLGDLNGHKRMVVFGWIWLTIWSLITGFSYYDRGNQAFYYTARALQGIGSGFIVPNS 156

Query: 184 MGLVGHVYKVGSLRKNLVISVIGACAPAXXXXXXXXXXLIVTEDPEQWPWVFYAFSIATF 243
           + ++G  Y    L+K ++ S+ G               L       +W W ++A +    
Sbjct: 157 LAIMGRTYFEPGLKKTIIFSIFGMMTSTGFVIGTTFSSLF--AQLTKWAWNYWALACVCV 214

Query: 244 ISLLMAWYSIPNNVPTN-VHGLS-------MDWTGSTLAVLGLILFNFVWNQAPIAGWGE 295
           +  + A   IP   P N VH  +        D+ G+   V GL+LF+  + QA   GW  
Sbjct: 215 LYTVGAILFIP---PDNIVHKPNSKPLYKRFDYLGAITGVSGLVLFDVAFTQASALGWSP 271

Query: 296 AYXXXXXXXXXXXXXXXXXYEIKYAEVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFY 355
            +                  + +  + PL+P    +   +++IL+ V+ G+ SF IW  +
Sbjct: 272 PHTYITLIIGVILILIAMFVDWRVDD-PLVPLQHLR-ADVVVILICVYFGFLSFVIWANW 329

Query: 356 YVSFQLNLRHYSPVWTGGTYFVFVIFGSIAAFFVAFSIK-RLGPAILLCFALMAFDAGSI 414
           +  F   + + SP+          I    AA F    ++  +    ++  +++ F   +I
Sbjct: 330 FWQFYELVHNDSPLRIAAKLVPLAIGSIPAAIFTVTCLQLNIKAPTMMVISMVCFLVPNI 389

Query: 415 MFSVLPVEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYS 474
           + + +    +YW   F    I  F +D++ P ++++ SD +  + QG+A SL+ TVI+Y+
Sbjct: 390 LMATVTPNTTYWAQPFVSSIIAPFAVDITVPTATLLFSDSVRKESQGIAASLIITVISYA 449

Query: 475 ASL 477
            S+
Sbjct: 450 ISI 452

>NDAI0K02730 Chr11 complement(612590..614404) [1815 bp, 604 aa] {ON}
           
          Length = 604

 Score =  109 bits (273), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 107/476 (22%), Positives = 194/476 (40%), Gaps = 68/476 (14%)

Query: 64  SSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFN---SESNNQAWLMASFPLAAG 120
           +S+  +++FI     +Q +  A  + A+  M+ LS  F    + +    W+ ASF +  G
Sbjct: 66  NSYLNDIIFIFLICSSQFITLASASQAILQMDSLSVWFKIPPTSTLQLGWVNASFAMTCG 125

Query: 121 SFILISGRLGDIYGLKKMXXXXXXXXXXXXXXXXXXKYSNSDAFFI-TCRAFQGLGIAFI 179
           +FI+++G+L DI   + +                   Y   +  F+  CR  QG+G A +
Sbjct: 126 AFIILAGKLCDILNPRIIFISGYVWFSLWTLITGFASYVPKNMIFLYICRGCQGIGGALL 185

Query: 180 LPNIMGLVGHVYKV---------------------GSLRKNL------------------ 200
            P+ + L+   Y V                       + KNL                  
Sbjct: 186 FPSALILLNQYYTVPEPSPSQSQSKSPTTSAPSPSHDIEKNLSSDDDNDGDSSIADDSDI 245

Query: 201 -------VISVIGACAPAXXXXXXXXXXLIVTEDPEQWPWVFYAFSIATFISLLMAWYSI 253
                    S+ GACAP           +        WPW +++ SI T +  +++++ +
Sbjct: 246 ICTSKSIAFSLYGACAPLGIVIGGIFSAIF--TQLATWPWNYWSMSIVTTLLSILSYFYV 303

Query: 254 PNNVP-----TNVHGL----SMDWTGSTLAVLGLILFNFVWNQAPIAGWGEAYXXXXXXX 304
              +P     +N + L    + D+ G  L +  LILF   W+QA +  +   +       
Sbjct: 304 VVPIPVEKLDSNPNSLKNWKNFDFLGVILGISALILFGVSWDQATMYKFKTIHVYLTLLF 363

Query: 305 XXXXXXXXXXYEIKYAEVPLLPHAVTKNRH--MIMILLAVFLGWGSFGIWTFYYVSFQLN 362
                     +E  Y   P++P    +  H   I  LL VF  + SF  W FY       
Sbjct: 364 SLVSFIAMIIWE-YYFNNPIIP---IRQIHPGTIKALLVVFFSYISFTQWLFYTWKLFTE 419

Query: 363 LRHYSPVWTGGTYFVFVIFGSIAAFF-VAFSIKRLGPAILLCFALMAFDAGSIMFSVLPV 421
           ++  SP+     +    + G I+A F +   +KR+   I L     +F    I+     +
Sbjct: 420 VKDNSPILGSVKFIPLSVAGIISATFSILLIVKRVPVQIRLLAGASSFLLSHILLLTCKL 479

Query: 422 EQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASL 477
           + SYW   F     +  G+D+SFP+++++L++G+P + QG+  +LV +V+NY  ++
Sbjct: 480 DSSYWTYQFFSIISISIGLDISFPSATLLLTNGIPPEIQGICAALVGSVLNYGTAI 535

>Skud_6.16 Chr6 (26284..27933) [1650 bp, 549 aa] {ON} YOR378W (REAL)
          Length = 549

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 96/458 (20%), Positives = 166/458 (36%), Gaps = 50/458 (10%)

Query: 80  QLLNQAGQTHALCIMNVLSKSFNSESNNQAWLMASFPLAAGSFILISGRLGDIYGLKKMX 139
            LLN A     + +++ L+K++N      +W + S+ +    FI   GRLGDI G   + 
Sbjct: 41  DLLNVASM---ISLIDDLAKTYNISYTTASWSLTSYAVTFAGFIACMGRLGDIIGNSVLF 97

Query: 140 XXXXXXXXXXXXXXXXXKYSNSDAFFITCRAFQGLGIAFILPNIMGLVGHVYKVGSLRKN 199
                                + A F   RA QG+  A ++P    L+  +     ++K 
Sbjct: 98  TISCSCFAVLSLLCAVMPNFPAFAVF---RAIQGICAAGLVPCAYALIPILAPKEKVQKY 154

Query: 200 LVISVIGACAPAXXXXXXXXXXLIVTEDPEQWPWVFY-AFSIATFISLLMAWYSI----- 253
             I    +C  +                   +  +FY  F++ T IS++  +++      
Sbjct: 155 FSIV---SCGFSSTIGLGLIIGGAFATTKIGYRGIFYLTFAVMTLISIIAFFFTYGVEKL 211

Query: 254 ---PNNVPTNVHGLSMDWTGSTLAVLGLILF-------NFVWNQAPIA------------ 291
              P     +    S+D+ GS + V G IL           WN+ P+             
Sbjct: 212 NKKPQKDQASTSVKSLDFIGSLIFVAGSILIVVGLTEGGESWNR-PVTYVTLVIGIILFF 270

Query: 292 ---GWGEAYXXXXXXXXXXXXXXXXXYEIKYAEVPLL-PHAVTKNRHMIMILLAVFLGWG 347
               W   Y                 +E    +V LL P  V   ++ I I+LA  L   
Sbjct: 271 GFFVWNCTYTKIVRGFKYCGIDTSKYFE----KVQLLIPIDVLFMKNFIPIVLAFALNNA 326

Query: 348 SFGIWTFYYVSFQLNLRHYSPVWTGGTYFVFVIFGSIAAFFVAFSIKRLGPAILLCFALM 407
                 +    +       SP+  G      +I   I     AF   +L P + +     
Sbjct: 327 CLFSCLYIIDQYSQYAERNSPLLAGVKLVPLIICMVIGNALCAFESTKLRPRVGVAIGFF 386

Query: 408 AFDAGSIMFSVLPV--EQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGS 465
              AGSI+   L +  E  +WK+ F+ QA++ FG+ + +P +  I   G P + +G+A  
Sbjct: 387 LALAGSIILIQLHLVKEDLFWKIFFSAQALVGFGVAIFYPYALQIAVGGAPDESRGIASG 446

Query: 466 LVNTVINYSASLCLGMGVTVERQIN--KSGQNLLKGYR 501
           +  T       +   +  +V   IN  K   N ++ +R
Sbjct: 447 VAQTFGQLGIEITFSVMASVLGNINEMKGKSNAIQKFR 484

>Smik_6.24 Chr6 (39520..41154) [1635 bp, 544 aa] {ON} YMR279C (REAL)
          Length = 544

 Score = 47.0 bits (110), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 88/454 (19%), Positives = 162/454 (35%), Gaps = 42/454 (9%)

Query: 80  QLLNQAGQTHALCIMNVLSKSFNSESNNQAWLMASFPLAAGSFILISGRLGDIYGLKKMX 139
            LLN A     + +++ L+K +N      +W + S+ +    FI   GRLGDI G   + 
Sbjct: 41  DLLNVASM---ISLIDDLAKKYNISYTTASWSLTSYAVTFAGFIACMGRLGDIVGNSVLF 97

Query: 140 XXXXXXXXXXXXXXXXXKYSNSDAFFITCRAFQGLGIAFILPNIMGLVGHVYKVGSLRKN 199
                                + A F   RA QG+  A ++P    L+  +     ++K 
Sbjct: 98  TISCSCFAILSLLCAVMPNFPAFAVF---RAIQGICAAGLVPCAYALIPILAPKEKVQKY 154

Query: 200 LVISVIGACAPAXXXXXXXXXXLIVTEDPEQWPWVFY-AFSIATFISLLMAWYSI----- 253
             I    +C  +                   +  +FY  F++ + IS++  +++      
Sbjct: 155 FSIV---SCGFSSTIGLGLIIGGAFAATKIGYRGIFYLTFAVMSLISVIAFFFTYNVENF 211

Query: 254 ---PNNVPTNVHGLSMDWTGSTLAVLGLILFNFVWNQAPIAGWGEAYXXXXXXXXXXXXX 310
              P  +       S+D+ GS + V G IL      +     W                 
Sbjct: 212 DKKPQKIQAQTSVKSLDFIGSLIFVAGSILIVVGLTEGG-ESWNRPVTYVTLIIGILLFF 270

Query: 311 XXXXYEIKYAEVP-------------------LLPHAVTKNRHMIMILLAVFLGWGSFGI 351
               +   YA++                    L+P  V   ++ I I+LA  L       
Sbjct: 271 GFFVWNCTYAKIVRGIRFVGIDTSKYFEKVQLLIPVDVLFMKNFIPIVLAFALNNACLFS 330

Query: 352 WTFYYVSFQLNLRHYSPVWTGGTYFVFVIFGSIAAFFVAFSIKRLGPAILLCFALMAFDA 411
             +    +       SP+  G      +I   +     AF   +L P + +        A
Sbjct: 331 CLYIIDQYSQYAEKDSPLLAGVKLVPLIICMVVGNALCAFESTKLKPRVGVALGFSLALA 390

Query: 412 GSIMFSVLPV--EQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNT 469
           GSI+   L +  +  +WK+ F+ QA++ FG+ + +P +  I   G P Q +G+A  +  T
Sbjct: 391 GSIILIQLHLIKDNVFWKIFFSSQALVGFGVAIFYPYALQIAVGGAPDQSKGIASGVAQT 450

Query: 470 VINYSASLCLGMGVTVERQIN--KSGQNLLKGYR 501
                  +   +  +V   IN  K  ++ ++ +R
Sbjct: 451 FGQLGIEITFSVMASVLGDINEMKGKEDAIQNFR 484

>Suva_10.11 Chr10 (18934..20556) [1623 bp, 540 aa] {ON} YOR378W
           (REAL)
          Length = 540

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 87/423 (20%), Positives = 153/423 (36%), Gaps = 46/423 (10%)

Query: 80  QLLNQAGQTHALCIMNVLSKSFNSESNNQAWLMASFPLAAGSFILISGRLGDIYGLKKMX 139
            LLN A     + +++ L++ ++      +W + S+ +    FI   GRLGDI G   + 
Sbjct: 41  DLLNVASM---ISLIDDLAQKYDISYTTASWSLTSYAVTFAGFIAFMGRLGDIVGNSILF 97

Query: 140 XXXXXXXXXXXXXXXXXKYSNSDAFFITCRAFQGLGIAFILPNIMGLVGHVYKVGSLRKN 199
                                + A F   RA QG+  A ++P    L+  +     ++K 
Sbjct: 98  TVSCFFFAILSLLCAVMPNFPAFAVF---RAIQGISAAGLVPCAYALIPMLAPEEEVQKY 154

Query: 200 LVISVIGACAPAXXXXXXXXXXLIVTEDPEQWPWVFY-AFSIATFISLLMAWYSI----- 253
             I    +C  +                   +  +FY  F++   IS++  +++      
Sbjct: 155 FSIV---SCGFSSTIGLGLIIGGAFAATKIGYKGIFYLTFAVMFLISIVAFFFTYGVENL 211

Query: 254 ---PNNVPTNVHGLSMDW-------TGSTLAVLGLILFNFVWNQAPI------------- 290
              P          S+D+       TGS L V+GL      WN+                
Sbjct: 212 SEPPRKDQATNRVRSLDFIGSLIFVTGSILIVVGLTEGGESWNRPATYVTLVIGIILFFG 271

Query: 291 -AGWGEAYXXXXXXXXXXXXXXXXXYEIKYAEVPLL-PHAVTKNRHMIMILLAVFLGWGS 348
              W  +Y                 +E    +V LL P  V   ++ I I+LA  L    
Sbjct: 272 FFFWNCSYARIVRGIRCCGIDTSRYFE----KVQLLIPVDVLFMKNFIPIVLAFALNNAC 327

Query: 349 FGIWTFYYVSFQLNLRHYSPVWTGGTYFVFVIFGSIAAFFVAFSIKRLGPAILLCFALMA 408
                +    +       SP++ G      +I   I     AF   +L P + +      
Sbjct: 328 LFSCIYIIDQYSQYEEKNSPLYAGVKLVPLIICMVIGNGLCAFESTKLKPKVGVVLGFSL 387

Query: 409 FDAGSIMFSVLPV--EQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSL 466
             AGSI+ + L +  E  +WK+ F+ QA++ FG+ + +P +  I   G P + +G+A  +
Sbjct: 388 ALAGSIILTQLHLIKEDMFWKIFFSSQALVGFGVAIFYPYALQIAVGGAPDRSKGIASGV 447

Query: 467 VNT 469
             T
Sbjct: 448 AQT 450

>SAKL0F00440g Chr6 complement(36452..38086) [1635 bp, 544 aa] {ON}
           conserved hypothetical protein
          Length = 544

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 41/175 (23%), Positives = 78/175 (44%), Gaps = 3/175 (1%)

Query: 324 LLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYVSFQLNLRHYSPVWTGGTYFVFVIFGS 383
           L+P  V   ++ I I +AVF  +G      +    +   +   SP+         V+   
Sbjct: 303 LIPKDVLMMKNFIPITVAVFANYGCLFSNLYIVNQYCQYVSKNSPLLAAVKLLPLVVSML 362

Query: 384 IAAFFVAFSIKRLGP--AILLCFALMAFDAGSIMFSVLPVEQSYWKLNFAMQAILCFGMD 441
           I    +A     + P  A++L F +M   +  ++   L  +  YWK+ F  Q+++ FG  
Sbjct: 363 IPNVVIAIKSDLISPRKAVVLGFFIMFIGSIILIQLHLITDNLYWKIFFCSQSLIAFGAA 422

Query: 442 LSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGMGVTVERQINK-SGQN 495
           + FP S  IL    P +Y+G+A  ++ T   +   +   +  ++   IN+ SG++
Sbjct: 423 IFFPYSLNILIGFAPDEYKGIASGVMQTFGQFGVEVTFSVMTSILGNINELSGKS 477

>TPHA0G03150 Chr7 (670343..672145) [1803 bp, 600 aa] {ON} Anc_2.473
           YMR088C
          Length = 600

 Score = 36.6 bits (83), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 42/85 (49%), Gaps = 4/85 (4%)

Query: 54  DSPWQDPI--YFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSESNNQAWL 111
           + P  DPI  Y  S  K  + + +  L   L+    T    IMN +++ FN+ SN + W+
Sbjct: 49  NKPKLDPITKYNLSLSKGPI-LTSLWLGSFLSALDATIVAVIMNRVAEDFNA-SNQKQWI 106

Query: 112 MASFPLAAGSFILISGRLGDIYGLK 136
             S+ L   +F  + GRL DI G K
Sbjct: 107 ATSYLLTNTAFQPLYGRLSDIIGRK 131

>KLLA0C18931g Chr3 (1680133..1681794) [1662 bp, 553 aa] {ON}
           uniprot|Q874B4 Kluyveromyces lactis KLLA0C18931g Drug
           efflux permease KNQ1
          Length = 553

 Score = 36.6 bits (83), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 39/144 (27%), Positives = 62/144 (43%), Gaps = 6/144 (4%)

Query: 68  KELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSESNNQAWLMASFPLAAGSFILISG 127
           K L FI   ++A  L+ A     + ++  +   FN       W + S+ +    FI   G
Sbjct: 21  KHLKFICI-LIACGLDLASVGAMIVLVTDIETRFNVSHTQSGWALTSYVITFAGFIAFFG 79

Query: 128 RLGDIYGLKKMXXXXXXXXXXXXXXXXXXKYSNSDAFFITCRAFQGLGIAFILPNIMGLV 187
           R+GDI G   M                     N  AF +  RAFQG+  A I+P    LV
Sbjct: 80  RVGDIVGNGIMMCVFSVIFGIFSLLCAVVP--NFIAFTVF-RAFQGMAGAGIVPCAYALV 136

Query: 188 GHVYKVGSLRK--NLVISVIGACA 209
             +++  +L++  +++ SVI A A
Sbjct: 137 NKMFQGPNLQRYFSILSSVISAMA 160

>YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON}
           VBA1Permease of basic amino acids in the vacuolar
           membrane
          Length = 562

 Score = 34.3 bits (77), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 31/59 (52%), Gaps = 1/59 (1%)

Query: 78  LAQLLNQAGQTHALCIMNVLSKSFNSESNNQAWLMASFPLAAGSFILISGRLGDIYGLK 136
           L   L+    T    IMN +++ F SES+ + W+  SF L   +F  + G+L DI G K
Sbjct: 44  LGSFLSSLDSTIVANIMNRVAEEF-SESSKKQWIATSFLLTNTAFQPLYGKLSDITGRK 101

>Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {ON}
           YMR088C (REAL)
          Length = 562

 Score = 34.3 bits (77), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 31/59 (52%), Gaps = 1/59 (1%)

Query: 78  LAQLLNQAGQTHALCIMNVLSKSFNSESNNQAWLMASFPLAAGSFILISGRLGDIYGLK 136
           L   L+    T    IMN +++ F SES+ + W+  SF L   +F  + G+L DI G K
Sbjct: 44  LGSFLSSLDSTIVANIMNRVAEDF-SESSRKQWIATSFLLTNTAFQPLYGKLSDITGRK 101

>Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 31/59 (52%), Gaps = 1/59 (1%)

Query: 78  LAQLLNQAGQTHALCIMNVLSKSFNSESNNQAWLMASFPLAAGSFILISGRLGDIYGLK 136
           L   L+    T    IMN +++ F SES+ + W+  SF L   +F  + G+L DI G K
Sbjct: 44  LGSFLSSLDGTIVANIMNRVAEEF-SESSRKQWIATSFLLTNTAFQPLYGKLSDITGRK 101

>Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 31/59 (52%), Gaps = 1/59 (1%)

Query: 78  LAQLLNQAGQTHALCIMNVLSKSFNSESNNQAWLMASFPLAAGSFILISGRLGDIYGLK 136
           L   L+    T    IMN +++ F SES+ + W+  SF L   +F  + G+L DI G +
Sbjct: 44  LGSFLSSLDSTIVANIMNRVAEEF-SESSKKQWIATSFLLTNTAFQPLYGKLSDIIGRR 101

>NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa]
           {ON} Anc_2.473
          Length = 568

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 30/59 (50%), Gaps = 1/59 (1%)

Query: 78  LAQLLNQAGQTHALCIMNVLSKSFNSESNNQAWLMASFPLAAGSFILISGRLGDIYGLK 136
           L   L+    T    IMN +++ F  ES+ + W+  SF L   +F  + G+L DI G K
Sbjct: 48  LGSFLSSLDSTIVANIMNKVAEEFE-ESDKKQWIATSFLLTNTAFQPLYGKLSDITGRK 105

>Kpol_467.24 s467 (55523..56632) [1110 bp, 370 aa] {ON}
           (55523..56632) [1110 nt, 370 aa]
          Length = 370

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 29/59 (49%), Gaps = 1/59 (1%)

Query: 78  LAQLLNQAGQTHALCIMNVLSKSFNSESNNQAWLMASFPLAAGSFILISGRLGDIYGLK 136
           L   L+    T    IMN +++ F  ES  + W+  SF L   +F  + G+L DI G K
Sbjct: 42  LGSFLSSIDSTIVANIMNKVAEEFQ-ESQEKQWIATSFLLTNTAFQPLYGKLSDITGRK 99

>KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 593

 Score = 32.7 bits (73), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 48/229 (20%), Positives = 89/229 (38%), Gaps = 11/229 (4%)

Query: 266 MDWTGSTLAVLGLILFNFVWNQAPIA-GWGEAYXXXXXXXXXXXXXXXXXYEIKYAEVPL 324
           +DW G+T  +  L LF    +    +  +G                     E++ A  P+
Sbjct: 279 LDWAGATSLIAFLFLFMLTSSMGGSSVAYGSRLFAAMCAATLVFGAVFVYVELRVAADPV 338

Query: 325 LPHAVTKNRHMIMILLAVFLGWGSFGIWTFY---YVSFQLNLRHYSPVWTGGTYFVFVIF 381
           LP    ++R ++   LA +    S     FY   Y S  L ++           F  V F
Sbjct: 339 LPVTFLRDRSVLGSSLANWFCMMSMMTTNFYLPVYWSSVLGMKATDVGKRAMPSFFSVAF 398

Query: 382 GSIAAFFVAFSIKRLGP--AILLCFALMAFDAGSIMFSVLPVEQSYWKLNFAMQAILCFG 439
           GS+ A      +KR G     LL F ++A  AG +   ++  +   W+  + +Q +  FG
Sbjct: 399 GSLGA---GLYMKRTGKYYYFLLAFCVLAI-AGQVQIVLITPQMPVWR-QYLLQVVPGFG 453

Query: 440 MDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGMGVTVERQ 488
           + +    + + +   +P ++     S+     +  A+L + +G  V R 
Sbjct: 454 VSVLITVTLLAMIAAVPHEHHAATTSISYAFRSTGATLGVSVGAAVFRS 502

>TDEL0A02490 Chr1 (446429..448093) [1665 bp, 554 aa] {ON} Anc_2.473
           YMR088C
          Length = 554

 Score = 32.7 bits (73), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 27/44 (61%), Gaps = 1/44 (2%)

Query: 93  IMNVLSKSFNSESNNQAWLMASFPLAAGSFILISGRLGDIYGLK 136
           IMN +++ F SES+ + W+  SF L   +F  + G+L D+ G K
Sbjct: 58  IMNRVAEEF-SESDKKQWIATSFLLTNTAFQPLYGKLSDVTGRK 100

>NDAI0H02200 Chr8 complement(536385..538100) [1716 bp, 571 aa] {ON} 
           YGR224W
          Length = 571

 Score = 32.0 bits (71), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 27/44 (61%), Gaps = 1/44 (2%)

Query: 93  IMNVLSKSFNSESNNQAWLMASFPLAAGSFILISGRLGDIYGLK 136
           IMN +++ F +ES+ + W+  SF L   +F  + G+L DI G K
Sbjct: 66  IMNRVAEEF-AESDKKQWIATSFLLTNTAFQPLYGKLSDITGRK 108

>TPHA0M00120 Chr13 (23458..25317) [1860 bp, 619 aa] {ON} 
          Length = 619

 Score = 32.0 bits (71), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 46/92 (50%), Gaps = 7/92 (7%)

Query: 315 YEIKYAEVPLLPHAVTKNRHMIMILLAVF---LGWGSFG--IWTFYYVSFQLNLRHYSPV 369
           +EIK++  PL P A+ K+R +I  +   F     W   G  ++T   VS   +++  + +
Sbjct: 335 WEIKFSRHPLTPWALIKDRGIIFAIFIAFHINFCWYMQGDYMYTVLIVSVHESVKSATRI 394

Query: 370 WTGGTYFVFVIFGSIAAFFVAFSIKRLGPAIL 401
            T    FV VI G+I   F+   I+R  P I+
Sbjct: 395 -TSLYSFVSVITGTILGMFIT-KIRRTKPFIV 424

>SAKL0E02992g Chr5 complement(243652..245364) [1713 bp, 570 aa] {ON}
           similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 570

 Score = 32.0 bits (71), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 26/44 (59%), Gaps = 1/44 (2%)

Query: 93  IMNVLSKSFNSESNNQAWLMASFPLAAGSFILISGRLGDIYGLK 136
           IMN +++ F  ES+ + W+  SF L   +F  + G+L DI G K
Sbjct: 74  IMNRVAEEFQ-ESDKKQWIATSFLLTNTAFQPLYGKLSDITGRK 116

>KLTH0H16214g Chr8 complement(1398230..1399885) [1656 bp, 551 aa]
           {ON} conserved hypothetical protein
          Length = 551

 Score = 32.0 bits (71), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 3/55 (5%)

Query: 80  QLLNQAGQTHALCIMNVLSKSFNSESNNQAWLMASFPLAAGSFILISGRLGDIYG 134
            LLN AG    + ++  L +++  E    +W + S+ +     I   GRLGDI G
Sbjct: 44  DLLNVAG---VISVIEDLGETYGLEYTTASWALTSYAITFAGLIAFMGRLGDIIG 95

 Score = 32.0 bits (71), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 29/127 (22%), Positives = 52/127 (40%), Gaps = 2/127 (1%)

Query: 367 SPVWTGGTYFVFVIFGSIAAFFVAFSIKRLGPAILLCFALMAFDAGSIMFSVLPV--EQS 424
           SP+  G      +I   I     A    +L P I +    ++   GSI+   L +  E  
Sbjct: 353 SPLLAGVKLVPLIITMVIGNTICASKSVKLRPRIGVALGFLSMVCGSIILIQLHLVEENL 412

Query: 425 YWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGMGVT 484
           YWK+ F  Q ++ FG  + +P +  ++    P   +G+A  +  T       +   + V+
Sbjct: 413 YWKIMFCSQILVGFGAAIFYPYALKLVVGDAPSGAKGIASGVTQTFAQLGIEMTFSVMVS 472

Query: 485 VERQINK 491
           V   I +
Sbjct: 473 VLGNITQ 479

>Ecym_7399 Chr7 complement(820280..821971) [1692 bp, 563 aa] {ON}
           similar to Ashbya gossypii ABL040W
          Length = 563

 Score = 32.0 bits (71), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 40/87 (45%), Gaps = 9/87 (10%)

Query: 58  QDPIYFSS--FGK------ELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSESNNQA 109
           QD   F S  FGK       L  + +  +A  L    +T    IMN +++ F  ES+   
Sbjct: 27  QDCKIFDSDEFGKLQEVMPRLPMLLSLWMANFLASMDRTIIANIMNSVTEEFK-ESHRIQ 85

Query: 110 WLMASFPLAAGSFILISGRLGDIYGLK 136
           W+  SF L +  F  I G+L D+ G +
Sbjct: 86  WVATSFLLTSTVFQPIYGKLSDVTGRR 112

>Kwal_34.15746 s34 (37757..39313) [1557 bp, 518 aa] {ON} YGR224W
           (AZR1) - MFS-MDR [contig 274] FULL
          Length = 518

 Score = 31.6 bits (70), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 41/102 (40%), Gaps = 6/102 (5%)

Query: 80  QLLNQAGQTHALCIMNVLSKSFNSESNNQAWLMASFPLAAGSFILISGRLGDIYGLKKMX 139
            LLN AG    + ++  L +++       +W + S+ +    FI   GRLGDI G   + 
Sbjct: 40  DLLNVAG---VISVIEDLGETYKLGYTGASWALTSYAITFAGFIAFMGRLGDIVGNSVLF 96

Query: 140 XXXXXXXXXXXXXXXXXKYSNSDAFFITCRAFQGLGIAFILP 181
                            +   + A F   RA QG+  A I+P
Sbjct: 97  TISCFLFTLFSLLCAVVRDFPTFAVF---RALQGISAAGIVP 135

>KLLA0F13684g Chr6 complement(1267367..1269082) [1716 bp, 571 aa]
           {ON} similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 571

 Score = 31.6 bits (70), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 1/59 (1%)

Query: 78  LAQLLNQAGQTHALCIMNVLSKSFNSESNNQAWLMASFPLAAGSFILISGRLGDIYGLK 136
           +   L     T    IMN +++ F  ES+ + W++ SF L   +F  + G+L D+ G K
Sbjct: 48  MGSFLGSLDSTIVANIMNKVAEEFE-ESDKKQWIVTSFLLTNTAFQPLYGKLSDLAGRK 105

>ZYRO0G03234g Chr7 (247798..249486) [1689 bp, 562 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 562

 Score = 31.6 bits (70), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 26/44 (59%), Gaps = 1/44 (2%)

Query: 93  IMNVLSKSFNSESNNQAWLMASFPLAAGSFILISGRLGDIYGLK 136
           IMN +++ F  ES+ + W+  SF L   +F  + G+L DI G +
Sbjct: 56  IMNRVAEEFE-ESDKKQWIATSFLLTNTAFQPLYGKLSDITGRR 98

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.326    0.139    0.437 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 45,289,281
Number of extensions: 1557655
Number of successful extensions: 4713
Number of sequences better than 10.0: 87
Number of HSP's gapped: 4654
Number of HSP's successfully gapped: 97
Length of query: 543
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 428
Effective length of database: 40,294,809
Effective search space: 17246178252
Effective search space used: 17246178252
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 68 (30.8 bits)