Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_13.4918.840ON62262233640.0
YMR278W (PGM3)8.840ON62261730030.0
Suva_13.4668.840ON62262228800.0
Skud_13.4508.840ON62262227810.0
TDEL0B005708.840ON63061921130.0
KNAG0J002708.840ON62562221020.0
NCAS0C004108.840ON62561821010.0
SAKL0D01474g8.840ON62462320920.0
ZYRO0G14190g8.840ON61060620820.0
Kpol_1068.88.840ON63262120650.0
TPHA0I002508.840ON62962120510.0
CAGL0M02981g8.840ON61761620400.0
TBLA0B032508.840ON64363820370.0
NDAI0K004108.840ON62661520050.0
KAFR0B039208.840ON62461819670.0
Kwal_27.102588.840ON62062318850.0
KLTH0C03872g8.840ON62163118420.0
ABL126W8.840ON62462618180.0
Ecym_46118.840ON63062818140.0
KLLA0D01573g8.840ON60762517610.0
KLTH0D04796g2.445ON5705651128e-05
KNAG0E023902.445ON569578950.007
CAGL0B03597g6.11ON54030930.013
NCAS0F002006.11ON54928920.017
TBLA0G009806.11ON55828910.022
NDAI0K028906.11ON56130900.025
TDEL0G046006.11ON52828880.043
KAFR0L003406.11ON54037870.068
KAFR0D030102.445ON569516870.072
NCAS0F014702.445ON569441870.072
Kpol_1032.26.11ON53928870.072
Smik_13.2912.445ON569565860.078
Suva_13.2822.445ON569522860.084
ZYRO0F00506g6.11ON55024860.090
Skud_13.2632.445ON569566850.11
Smik_5.296.11ON55528850.12
YEL058W (PCM1)6.11ON55728850.12
TDEL0E00210singletonON570293850.13
Skud_5.316.11ON55728850.13
YMR105C (PGM2)2.445ON569566850.13
Suva_5.106.11ON55328840.13
KNAG0E009406.11ON53821840.15
TBLA0B090102.445ON569140840.16
NDAI0H023502.445ON569469830.20
ZYRO0G02508g2.445ON569604810.31
KLLA0D00858g6.11ON54119800.40
SAKL0E00902g6.11ON54419800.40
Kwal_56.223556.11ON54125800.46
KLTH0C11506g6.11ON54420800.48
TDEL0A022102.445ON572541780.74
ACR015W6.11ON55226780.78
TPHA0M002106.11ON54580780.89
KLLA0B12694g2.445ON568548771.0
CAGL0K07480g2.445ON567125761.4
Kwal_26.76282.445ON570526751.6
NCAS0A043502.445ON569125751.7
SAKL0E03630g2.445ON571170752.0
Suva_11.982.445ON570141742.2
Ecym_30146.11ON55119742.4
CAGL0K03421g2.445ON568126732.9
Smik_11.1122.445ON570142733.3
TPHA0G029002.445ON569293733.4
TPHA0E015605.463ON24790713.9
KNAG0A062802.445ON57082724.1
KAFR0A042008.740ON26059714.1
TPHA0B011601.229ON392147706.1
Smik_4.7525.609ON87742707.2
AEL006W3.211ON249145708.1
TPHA0G024702.445ON569140699.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_13.491
         (622 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_13.491 Chr13 (805767..807635) [1869 bp, 622 aa] {ON} YMR278...  1300   0.0  
YMR278W Chr13 (822763..824631) [1869 bp, 622 aa] {ON}  PGM3Phosp...  1161   0.0  
Suva_13.466 Chr13 (805414..807282) [1869 bp, 622 aa] {ON} YMR278...  1113   0.0  
Skud_13.450 Chr13 (796030..797898) [1869 bp, 622 aa] {ON} YMR278...  1075   0.0  
TDEL0B00570 Chr2 complement(109270..111162) [1893 bp, 630 aa] {O...   818   0.0  
KNAG0J00270 Chr10 complement(39750..41627) [1878 bp, 625 aa] {ON...   814   0.0  
NCAS0C00410 Chr3 complement(62893..64770) [1878 bp, 625 aa] {ON}...   813   0.0  
SAKL0D01474g Chr4 complement(117178..119052) [1875 bp, 624 aa] {...   810   0.0  
ZYRO0G14190g Chr7 (1131206..1133038) [1833 bp, 610 aa] {ON} simi...   806   0.0  
Kpol_1068.8 s1068 complement(13542..15440) [1899 bp, 632 aa] {ON...   800   0.0  
TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840...   794   0.0  
CAGL0M02981g Chr13 (335863..337716) [1854 bp, 617 aa] {ON} simil...   790   0.0  
TBLA0B03250 Chr2 (757928..759859) [1932 bp, 643 aa] {ON} Anc_8.8...   789   0.0  
NDAI0K00410 Chr11 complement(91807..93687) [1881 bp, 626 aa] {ON...   776   0.0  
KAFR0B03920 Chr2 (814394..816268) [1875 bp, 624 aa] {ON} Anc_8.8...   762   0.0  
Kwal_27.10258 s27 complement(265612..267474) [1863 bp, 620 aa] {...   730   0.0  
KLTH0C03872g Chr3 complement(337765..339630) [1866 bp, 621 aa] {...   714   0.0  
ABL126W Chr2 (159207..161081) [1875 bp, 624 aa] {ON} Syntenic ho...   704   0.0  
Ecym_4611 Chr4 (1191367..1193259) [1893 bp, 630 aa] {ON} similar...   703   0.0  
KLLA0D01573g Chr4 complement(139183..141006) [1824 bp, 607 aa] {...   682   0.0  
KLTH0D04796g Chr4 (437416..439128) [1713 bp, 570 aa] {ON} highly...    48   8e-05
KNAG0E02390 Chr5 (475467..477176) [1710 bp, 569 aa] {ON} Anc_2.4...    41   0.007
CAGL0B03597g Chr2 complement(359018..360640) [1623 bp, 540 aa] {...    40   0.013
NCAS0F00200 Chr6 complement(30474..32123) [1650 bp, 549 aa] {ON}...    40   0.017
TBLA0G00980 Chr7 complement(248484..250160) [1677 bp, 558 aa] {O...    40   0.022
NDAI0K02890 Chr11 (655311..656996) [1686 bp, 561 aa] {ON} Anc_6....    39   0.025
TDEL0G04600 Chr7 (838381..839967) [1587 bp, 528 aa] {ON} Anc_6.1...    39   0.043
KAFR0L00340 Chr12 complement(62157..63779) [1623 bp, 540 aa] {ON...    38   0.068
KAFR0D03010 Chr4 (594118..595827) [1710 bp, 569 aa] {ON} Anc_2.4...    38   0.072
NCAS0F01470 Chr6 complement(293218..294927) [1710 bp, 569 aa] {O...    38   0.072
Kpol_1032.2 s1032 complement(1049..2668) [1620 bp, 539 aa] {ON} ...    38   0.072
Smik_13.291 Chr13 complement(460399..462108) [1710 bp, 569 aa] {...    38   0.078
Suva_13.282 Chr13 complement(457565..459274) [1710 bp, 569 aa] {...    38   0.084
ZYRO0F00506g Chr6 complement(49579..51231) [1653 bp, 550 aa] {ON...    38   0.090
Skud_13.263 Chr13 complement(451194..452903) [1710 bp, 569 aa] {...    37   0.11 
Smik_5.29 Chr5 (45538..47205) [1668 bp, 555 aa] {ON} YEL058W (REAL)    37   0.12 
YEL058W Chr5 (43252..44925) [1674 bp, 557 aa] {ON}  PCM1Essentia...    37   0.12 
TDEL0E00210 Chr5 (28244..29956) [1713 bp, 570 aa] {ON} Anc_2.445...    37   0.13 
Skud_5.31 Chr5 (42262..43935) [1674 bp, 557 aa] {ON} YEL058W (REAL)    37   0.13 
YMR105C Chr13 complement(475897..477606) [1710 bp, 569 aa] {ON} ...    37   0.13 
Suva_5.10 Chr5 (19280..20941) [1662 bp, 553 aa] {ON} YEL058W (REAL)    37   0.13 
KNAG0E00940 Chr5 (176887..178503) [1617 bp, 538 aa] {ON} Anc_6.1...    37   0.15 
TBLA0B09010 Chr2 complement(2135961..2137670) [1710 bp, 569 aa] ...    37   0.16 
NDAI0H02350 Chr8 complement(571624..573333) [1710 bp, 569 aa] {O...    37   0.20 
ZYRO0G02508g Chr7 (192411..194120) [1710 bp, 569 aa] {ON} highly...    36   0.31 
KLLA0D00858g Chr4 complement(80327..81952) [1626 bp, 541 aa] {ON...    35   0.40 
SAKL0E00902g Chr5 complement(68682..70316) [1635 bp, 544 aa] {ON...    35   0.40 
Kwal_56.22355 s56 complement(62955..64580) [1626 bp, 541 aa] {ON...    35   0.46 
KLTH0C11506g Chr3 (944869..946503) [1635 bp, 544 aa] {ON} simila...    35   0.48 
TDEL0A02210 Chr1 (400375..402093) [1719 bp, 572 aa] {ON} Anc_2.4...    35   0.74 
ACR015W Chr3 (383130..384788) [1659 bp, 552 aa] {ON} Syntenic ho...    35   0.78 
TPHA0M00210 Chr13 complement(42336..43973) [1638 bp, 545 aa] {ON...    35   0.89 
KLLA0B12694g Chr2 (1107696..1109402) [1707 bp, 568 aa] {ON} high...    34   1.0  
CAGL0K07480g Chr11 complement(740462..742165) [1704 bp, 567 aa] ...    34   1.4  
Kwal_26.7628 s26 (449302..451014) [1713 bp, 570 aa] {ON} YMR105C...    33   1.6  
NCAS0A04350 Chr1 (878688..880397) [1710 bp, 569 aa] {ON} Anc_2.4...    33   1.7  
SAKL0E03630g Chr5 complement(294321..296036) [1716 bp, 571 aa] {...    33   2.0  
Suva_11.98 Chr11 (189966..191678) [1713 bp, 570 aa] {ON} YMR105C...    33   2.2  
Ecym_3014 Chr3 complement(28261..29916) [1656 bp, 551 aa] {ON} s...    33   2.4  
CAGL0K03421g Chr11 complement(314680..316386) [1707 bp, 568 aa] ...    33   2.9  
Smik_11.112 Chr11 (189511..191223) [1713 bp, 570 aa] {ON} YKL127...    33   3.3  
TPHA0G02900 Chr7 (622303..624012) [1710 bp, 569 aa] {ON}               33   3.4  
TPHA0E01560 Chr5 (318471..319214) [744 bp, 247 aa] {ON} Anc_5.46...    32   3.9  
KNAG0A06280 Chr1 (955994..957706) [1713 bp, 570 aa] {ON}               32   4.1  
KAFR0A04200 Chr1 complement(842429..843211) [783 bp, 260 aa] {ON...    32   4.1  
TPHA0B01160 Chr2 complement(263016..264194) [1179 bp, 392 aa] {O...    32   6.1  
Smik_4.752 Chr4 complement(1328812..1331445) [2634 bp, 877 aa] {...    32   7.2  
AEL006W Chr5 (621384..628859) [7476 bp, 2491 aa] {ON} Syntenic h...    32   8.1  
TPHA0G02470 Chr7 (507445..509154) [1710 bp, 569 aa] {ON} Anc_2.4...    31   9.1  

>Smik_13.491 Chr13 (805767..807635) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score = 1300 bits (3364), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 622/622 (100%), Positives = 622/622 (100%)

Query: 1   MSLQFLEAVPSNLKEAISLWFEQDQNPETIEEVTALCKKSDWNELHRRFDSRIQFGTAGL 60
           MSLQFLEAVPSNLKEAISLWFEQDQNPETIEEVTALCKKSDWNELHRRFDSRIQFGTAGL
Sbjct: 1   MSLQFLEAVPSNLKEAISLWFEQDQNPETIEEVTALCKKSDWNELHRRFDSRIQFGTAGL 60

Query: 61  RSQMQAGFNRMNTLVIIQASQGLATYAKQQFPNNLVAVVGHDHRFHSKEFARATATAFLL 120
           RSQMQAGFNRMNTLVIIQASQGLATYAKQQFPNNLVAVVGHDHRFHSKEFARATATAFLL
Sbjct: 61  RSQMQAGFNRMNTLVIIQASQGLATYAKQQFPNNLVAVVGHDHRFHSKEFARATATAFLL 120

Query: 121 KGFKVHYLNPDHEFVHTPLVPFAVDKLKASVGVMVTASHNPKMDNGYKVYYSNGCQIIPP 180
           KGFKVHYLNPDHEFVHTPLVPFAVDKLKASVGVMVTASHNPKMDNGYKVYYSNGCQIIPP
Sbjct: 121 KGFKVHYLNPDHEFVHTPLVPFAVDKLKASVGVMVTASHNPKMDNGYKVYYSNGCQIIPP 180

Query: 181 HDHAISDSIDMNLEPWANVWNFDDVLNKGLKQGKLMYSREEILKLYLGEVSKNLVGTDPL 240
           HDHAISDSIDMNLEPWANVWNFDDVLNKGLKQGKLMYSREEILKLYLGEVSKNLVGTDPL
Sbjct: 181 HDHAISDSIDMNLEPWANVWNFDDVLNKGLKQGKLMYSREEILKLYLGEVSKNLVGTDPL 240

Query: 241 KFEVKAKPWFVYTPMHGVGFDIFSTIVKKTMSLVEGKDYLCVPEQQEPDPSFPTVAFPNP 300
           KFEVKAKPWFVYTPMHGVGFDIFSTIVKKTMSLVEGKDYLCVPEQQEPDPSFPTVAFPNP
Sbjct: 241 KFEVKAKPWFVYTPMHGVGFDIFSTIVKKTMSLVEGKDYLCVPEQQEPDPSFPTVAFPNP 300

Query: 301 EEKGALDLGINLAENHGINLLIANDPDADRFSVAIKDIRSGEWRQLTGNEIGFLFAIFEF 360
           EEKGALDLGINLAENHGINLLIANDPDADRFSVAIKDIRSGEWRQLTGNEIGFLFAIFEF
Sbjct: 301 EEKGALDLGINLAENHGINLLIANDPDADRFSVAIKDIRSGEWRQLTGNEIGFLFAIFEF 360

Query: 361 QKFKSMEKQFQHAHPLAMLSSTVSSQMIKKMAEVEGFHYEETLTGFKWIGNRAILLEKEG 420
           QKFKSMEKQFQHAHPLAMLSSTVSSQMIKKMAEVEGFHYEETLTGFKWIGNRAILLEKEG
Sbjct: 361 QKFKSMEKQFQHAHPLAMLSSTVSSQMIKKMAEVEGFHYEETLTGFKWIGNRAILLEKEG 420

Query: 421 YYVPFGFEEAIGYMFPAMEHDKDGLSASIVFLQAYCQWKIDHNLDPISILEDGFKKYGVF 480
           YYVPFGFEEAIGYMFPAMEHDKDGLSASIVFLQAYCQWKIDHNLDPISILEDGFKKYGVF
Sbjct: 421 YYVPFGFEEAIGYMFPAMEHDKDGLSASIVFLQAYCQWKIDHNLDPISILEDGFKKYGVF 480

Query: 481 KEYNGYYIVSSPIVTNEIFDYIRNAYTPKGVSYPSSIGKEIEVLNYRDLTIGYQSDTSNH 540
           KEYNGYYIVSSPIVTNEIFDYIRNAYTPKGVSYPSSIGKEIEVLNYRDLTIGYQSDTSNH
Sbjct: 481 KEYNGYYIVSSPIVTNEIFDYIRNAYTPKGVSYPSSIGKEIEVLNYRDLTIGYQSDTSNH 540

Query: 541 KPTLPIDPSSQMITVSAKPSDGNEGEHIRFTIRGSGTEPKIKVYIEACADEEQRATFLAK 600
           KPTLPIDPSSQMITVSAKPSDGNEGEHIRFTIRGSGTEPKIKVYIEACADEEQRATFLAK
Sbjct: 541 KPTLPIDPSSQMITVSAKPSDGNEGEHIRFTIRGSGTEPKIKVYIEACADEEQRATFLAK 600

Query: 601 LTWNVLKREWFRPEKMDIVTHF 622
           LTWNVLKREWFRPEKMDIVTHF
Sbjct: 601 LTWNVLKREWFRPEKMDIVTHF 622

>YMR278W Chr13 (822763..824631) [1869 bp, 622 aa] {ON}
           PGM3Phosphoglucomutase, catalyzes interconversion of
           glucose-1-phosphate and glucose-6-phospate;
           transcription induced in response to stress; green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm and nucleus; non-essential
          Length = 622

 Score = 1161 bits (3003), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 537/617 (87%), Positives = 590/617 (95%)

Query: 6   LEAVPSNLKEAISLWFEQDQNPETIEEVTALCKKSDWNELHRRFDSRIQFGTAGLRSQMQ 65
           LE VPS+LK+ ISLWF+QD+NP+TIEEVTALCKKSDWNELH+RFDSRIQFGTAGLRSQMQ
Sbjct: 6   LETVPSDLKDPISLWFKQDRNPKTIEEVTALCKKSDWNELHKRFDSRIQFGTAGLRSQMQ 65

Query: 66  AGFNRMNTLVIIQASQGLATYAKQQFPNNLVAVVGHDHRFHSKEFARATATAFLLKGFKV 125
           AGF+RMNTLV+IQASQGLATY +QQFP+NLVAVVGHDHRFHSKEFARATA AFLLKGFKV
Sbjct: 66  AGFSRMNTLVVIQASQGLATYVRQQFPDNLVAVVGHDHRFHSKEFARATAAAFLLKGFKV 125

Query: 126 HYLNPDHEFVHTPLVPFAVDKLKASVGVMVTASHNPKMDNGYKVYYSNGCQIIPPHDHAI 185
           HYLNPDHEFVHTPLVPFAVDKLKASVGVM+TASHNPKMDNGYKVYYSNGCQIIPPHDHAI
Sbjct: 126 HYLNPDHEFVHTPLVPFAVDKLKASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHDHAI 185

Query: 186 SDSIDMNLEPWANVWNFDDVLNKGLKQGKLMYSREEILKLYLGEVSKNLVGTDPLKFEVK 245
           SDSID NLEPWANVW+FDDVLNK LKQGKLMYSREE+LKLYL EVSKNLV  +PLK EVK
Sbjct: 186 SDSIDANLEPWANVWDFDDVLNKALKQGKLMYSREEMLKLYLEEVSKNLVEINPLKLEVK 245

Query: 246 AKPWFVYTPMHGVGFDIFSTIVKKTMSLVEGKDYLCVPEQQEPDPSFPTVAFPNPEEKGA 305
           AKPWFVYTPMHGVGFDIFSTIVKKT+ LVEGKDYLCVPEQQ PDPSFPTV FPNPEEKGA
Sbjct: 246 AKPWFVYTPMHGVGFDIFSTIVKKTLCLVEGKDYLCVPEQQNPDPSFPTVGFPNPEEKGA 305

Query: 306 LDLGINLAENHGINLLIANDPDADRFSVAIKDIRSGEWRQLTGNEIGFLFAIFEFQKFKS 365
           LD+GINLAE H I+LL+ANDPDADRFSVA+KD++SGEWRQLTGNEIGFLFA +E+QK+KS
Sbjct: 306 LDIGINLAEKHDIDLLVANDPDADRFSVAVKDMQSGEWRQLTGNEIGFLFAFYEYQKYKS 365

Query: 366 MEKQFQHAHPLAMLSSTVSSQMIKKMAEVEGFHYEETLTGFKWIGNRAILLEKEGYYVPF 425
           M+K+FQH HPLAML+STVSSQMIKKMAE+EGFHYE+TLTGFKWIGNRAILLEK+GYYVPF
Sbjct: 366 MDKEFQHVHPLAMLNSTVSSQMIKKMAEIEGFHYEDTLTGFKWIGNRAILLEKKGYYVPF 425

Query: 426 GFEEAIGYMFPAMEHDKDGLSASIVFLQAYCQWKIDHNLDPISILEDGFKKYGVFKEYNG 485
           GFEEAIGYMFPAMEHDKDG+SASIVFLQAYC+WKIDHNLDP+++LE+GFKKYGVFKEYNG
Sbjct: 426 GFEEAIGYMFPAMEHDKDGISASIVFLQAYCKWKIDHNLDPLNVLENGFKKYGVFKEYNG 485

Query: 486 YYIVSSPIVTNEIFDYIRNAYTPKGVSYPSSIGKEIEVLNYRDLTIGYQSDTSNHKPTLP 545
           YY+V +P VT +IFDYIRN YTP+G SYPSSIG+EIEVL YRDLT GYQSDT NHKPTLP
Sbjct: 486 YYVVPNPTVTKDIFDYIRNVYTPEGASYPSSIGEEIEVLYYRDLTTGYQSDTINHKPTLP 545

Query: 546 IDPSSQMITVSAKPSDGNEGEHIRFTIRGSGTEPKIKVYIEACADEEQRATFLAKLTWNV 605
           +DP+SQMITVSA+PS+G+E EHIRFTIRGSGTEPK+KVYIEACA+EEQRA+FLAKLTWNV
Sbjct: 546 VDPTSQMITVSARPSNGSENEHIRFTIRGSGTEPKLKVYIEACANEEQRASFLAKLTWNV 605

Query: 606 LKREWFRPEKMDIVTHF 622
           L+REWFRP++M+IVT F
Sbjct: 606 LRREWFRPDEMNIVTKF 622

>Suva_13.466 Chr13 (805414..807282) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score = 1113 bits (2880), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 517/622 (83%), Positives = 571/622 (91%)

Query: 1   MSLQFLEAVPSNLKEAISLWFEQDQNPETIEEVTALCKKSDWNELHRRFDSRIQFGTAGL 60
           M  Q LE VPS+LK  ISLWF+QD+NPETIEEVT LCK SDW+ELH+RFD+RIQFGTAGL
Sbjct: 1   MYQQLLETVPSDLKGPISLWFDQDRNPETIEEVTTLCKNSDWDELHKRFDTRIQFGTAGL 60

Query: 61  RSQMQAGFNRMNTLVIIQASQGLATYAKQQFPNNLVAVVGHDHRFHSKEFARATATAFLL 120
           RS+MQAGF+RMNTLVIIQA+QGLATY KQQFP+NLV VVGHDHRFHSKEFARATATAFLL
Sbjct: 61  RSEMQAGFSRMNTLVIIQATQGLATYIKQQFPDNLVVVVGHDHRFHSKEFARATATAFLL 120

Query: 121 KGFKVHYLNPDHEFVHTPLVPFAVDKLKASVGVMVTASHNPKMDNGYKVYYSNGCQIIPP 180
           KGFKVHYLNPDHEFVHTPLVPFAVDKLKASVGVM+TASHNPKMDNGYKVYYSNGCQIIPP
Sbjct: 121 KGFKVHYLNPDHEFVHTPLVPFAVDKLKASVGVMITASHNPKMDNGYKVYYSNGCQIIPP 180

Query: 181 HDHAISDSIDMNLEPWANVWNFDDVLNKGLKQGKLMYSREEILKLYLGEVSKNLVGTDPL 240
           HDHAISDSIDMNLEPWANVW F DVLNK LKQGKLMYSREE+L LY  EVSK LV T+PL
Sbjct: 181 HDHAISDSIDMNLEPWANVWKFSDVLNKALKQGKLMYSREEMLNLYSKEVSKTLVETNPL 240

Query: 241 KFEVKAKPWFVYTPMHGVGFDIFSTIVKKTMSLVEGKDYLCVPEQQEPDPSFPTVAFPNP 300
           K E+KAKPWFVYTPMHGVGF+IFSTIVKKTMSLVEG+DYLCVPEQQ PDPSFPTV FPNP
Sbjct: 241 KLEIKAKPWFVYTPMHGVGFNIFSTIVKKTMSLVEGEDYLCVPEQQNPDPSFPTVGFPNP 300

Query: 301 EEKGALDLGINLAENHGINLLIANDPDADRFSVAIKDIRSGEWRQLTGNEIGFLFAIFEF 360
           EEKGALD+G+ LAE H INLL+ANDPDADRFS+A+KD +S +WRQLTGNEIGFLFA FEF
Sbjct: 301 EEKGALDIGMRLAEEHDINLLVANDPDADRFSIAVKDTQSSKWRQLTGNEIGFLFAFFEF 360

Query: 361 QKFKSMEKQFQHAHPLAMLSSTVSSQMIKKMAEVEGFHYEETLTGFKWIGNRAILLEKEG 420
           Q++K+ +++FQ +HPLAMLSSTVSSQMIKKMAEVEGF YE+TLTGFKWIGNRAI+LEKEG
Sbjct: 361 QRYKNKDEEFQRSHPLAMLSSTVSSQMIKKMAEVEGFLYEDTLTGFKWIGNRAIILEKEG 420

Query: 421 YYVPFGFEEAIGYMFPAMEHDKDGLSASIVFLQAYCQWKIDHNLDPISILEDGFKKYGVF 480
           YYVPFGFEEAIGYMFPAMEHDKDG+SA++V LQAYC+WKID NLDPI ILE+GF+KYGVF
Sbjct: 421 YYVPFGFEEAIGYMFPAMEHDKDGISAAVVLLQAYCKWKIDSNLDPIDILENGFQKYGVF 480

Query: 481 KEYNGYYIVSSPIVTNEIFDYIRNAYTPKGVSYPSSIGKEIEVLNYRDLTIGYQSDTSNH 540
           KEYNGYY+V SP+VT EIF+YIRN YTP GV YP SIG+EIEV+ YRDLT GYQSDT +H
Sbjct: 481 KEYNGYYVVPSPLVTTEIFEYIRNVYTPTGVPYPPSIGEEIEVVYYRDLTTGYQSDTPDH 540

Query: 541 KPTLPIDPSSQMITVSAKPSDGNEGEHIRFTIRGSGTEPKIKVYIEACADEEQRATFLAK 600
           KP LP+DP+SQMIT+S KPSDGN  EHIRFTIRGSGTEPK+KVYIEACAD E+RA++LAK
Sbjct: 541 KPVLPVDPTSQMITLSGKPSDGNGNEHIRFTIRGSGTEPKLKVYIEACADNEKRASYLAK 600

Query: 601 LTWNVLKREWFRPEKMDIVTHF 622
           LTW+VL+R WFRPE M+I T F
Sbjct: 601 LTWDVLRRGWFRPEIMNITTDF 622

>Skud_13.450 Chr13 (796030..797898) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score = 1075 bits (2781), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 512/622 (82%), Positives = 573/622 (92%)

Query: 1   MSLQFLEAVPSNLKEAISLWFEQDQNPETIEEVTALCKKSDWNELHRRFDSRIQFGTAGL 60
           MS QFL  +PS+LK  ISLWF+QD++PETIEEVTALCKKSDW+ELH+RFD+RIQFGTAGL
Sbjct: 1   MSQQFLGTIPSDLKGPISLWFDQDRDPETIEEVTALCKKSDWDELHKRFDTRIQFGTAGL 60

Query: 61  RSQMQAGFNRMNTLVIIQASQGLATYAKQQFPNNLVAVVGHDHRFHSKEFARATATAFLL 120
           RSQMQAGF+RMN LVIIQASQGLATY +QQFPNNLVAVVGHDHRFHSK+FARATATAFLL
Sbjct: 61  RSQMQAGFSRMNNLVIIQASQGLATYIRQQFPNNLVAVVGHDHRFHSKKFARATATAFLL 120

Query: 121 KGFKVHYLNPDHEFVHTPLVPFAVDKLKASVGVMVTASHNPKMDNGYKVYYSNGCQIIPP 180
           KGFKVHYLNP  EFVHTPLVPFAVD+L ASVGVM+TASHNPKMDNGYKVYYSNGCQIIPP
Sbjct: 121 KGFKVHYLNPGQEFVHTPLVPFAVDELNASVGVMITASHNPKMDNGYKVYYSNGCQIIPP 180

Query: 181 HDHAISDSIDMNLEPWANVWNFDDVLNKGLKQGKLMYSREEILKLYLGEVSKNLVGTDPL 240
           HD AIS++IDMNLEPWAN WNFDD+L+K LKQGKLMYSREE+LKLYL ++S NLV T PL
Sbjct: 181 HDQAISNAIDMNLEPWANAWNFDDILSKNLKQGKLMYSREEMLKLYLEKISDNLVETTPL 240

Query: 241 KFEVKAKPWFVYTPMHGVGFDIFSTIVKKTMSLVEGKDYLCVPEQQEPDPSFPTVAFPNP 300
           K EV++KPWFVYTPMHGVGFDIFSTIVKK+M LVEGKDYLCVPEQQ PDPSFPTV FPNP
Sbjct: 241 KLEVRSKPWFVYTPMHGVGFDIFSTIVKKSMCLVEGKDYLCVPEQQNPDPSFPTVGFPNP 300

Query: 301 EEKGALDLGINLAENHGINLLIANDPDADRFSVAIKDIRSGEWRQLTGNEIGFLFAIFEF 360
           EEKGAL++G+ LAE H I+LLIANDPDADRFSVAIKD++SG W+QLTGNEIGFLFA FEF
Sbjct: 301 EEKGALNIGMRLAEKHDISLLIANDPDADRFSVAIKDMQSGMWQQLTGNEIGFLFAFFEF 360

Query: 361 QKFKSMEKQFQHAHPLAMLSSTVSSQMIKKMAEVEGFHYEETLTGFKWIGNRAILLEKEG 420
           +KFKSM++QFQ  HPLAMLSSTVSSQMIK+MAEVEGFHYE+TLTGFKWIGNRAI+LEKEG
Sbjct: 361 EKFKSMDEQFQQTHPLAMLSSTVSSQMIKRMAEVEGFHYEDTLTGFKWIGNRAIILEKEG 420

Query: 421 YYVPFGFEEAIGYMFPAMEHDKDGLSASIVFLQAYCQWKIDHNLDPISILEDGFKKYGVF 480
           YYVPFGFEEAIGYMFPAMEHDKDG+SAS+VFLQAYC+WK+ +NLDPI++LE+GFKKYGVF
Sbjct: 421 YYVPFGFEEAIGYMFPAMEHDKDGISASVVFLQAYCKWKLANNLDPINVLENGFKKYGVF 480

Query: 481 KEYNGYYIVSSPIVTNEIFDYIRNAYTPKGVSYPSSIGKEIEVLNYRDLTIGYQSDTSNH 540
           KEYNGYYIV +PIVT EIF YIR+ YTP+ V YP  IG+EI VL YRDLT GYQSDT +H
Sbjct: 481 KEYNGYYIVPNPIVTKEIFKYIRDVYTPRNVPYPPYIGEEIRVLCYRDLTTGYQSDTLDH 540

Query: 541 KPTLPIDPSSQMITVSAKPSDGNEGEHIRFTIRGSGTEPKIKVYIEACADEEQRATFLAK 600
           KPTLP+DP+SQMITV A+P+D N  EHIRFTIRGSGTEPK+KVYIE  A+EE+RA+FLAK
Sbjct: 541 KPTLPVDPTSQMITVFARPNDSNGNEHIRFTIRGSGTEPKLKVYIETRANEERRASFLAK 600

Query: 601 LTWNVLKREWFRPEKMDIVTHF 622
           LTW+VL+REWFRPEK +I T+F
Sbjct: 601 LTWDVLRREWFRPEKTNITTNF 622

>TDEL0B00570 Chr2 complement(109270..111162) [1893 bp, 630 aa] {ON}
           Anc_8.840 YMR278W
          Length = 630

 Score =  818 bits (2113), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/619 (60%), Positives = 482/619 (77%)

Query: 4   QFLEAVPSNLKEAISLWFEQDQNPETIEEVTALCKKSDWNELHRRFDSRIQFGTAGLRSQ 63
           + + +VP++L + ++ W  QD N +T  E+  LCK  DW ELH+R D+RI FGTAGLRS+
Sbjct: 12  EVINSVPTDLSQLVASWLSQDGNKQTRLEILNLCKAKDWLELHKRLDTRILFGTAGLRSR 71

Query: 64  MQAGFNRMNTLVIIQASQGLATYAKQQFPNNLVAVVGHDHRFHSKEFARATATAFLLKGF 123
           M+AGF+RMNTLV++QA+QGLA + K+QFP+ L AVVGHDHRF+S+EFA AT   FL  GF
Sbjct: 72  MEAGFSRMNTLVVLQATQGLAQHIKKQFPDALTAVVGHDHRFNSQEFALATVATFLQAGF 131

Query: 124 KVHYLNPDHEFVHTPLVPFAVDKLKASVGVMVTASHNPKMDNGYKVYYSNGCQIIPPHDH 183
           KV +LN   +FVHTP+VPF V+++ ASVGVM+TASHNPKMDNGYKVYYSNGCQIIPPHD 
Sbjct: 132 KVIFLNDGDKFVHTPIVPFTVNEVGASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHDS 191

Query: 184 AISDSIDMNLEPWANVWNFDDVLNKGLKQGKLMYSREEILKLYLGEVSKNLVGTDPLKFE 243
            I+ SI+ NL  W   W +D++L +GL    L+Y+ EE+++ Y  ++ ++LV    +  E
Sbjct: 192 EIAQSIEENLTLWPKAWKWDELLKEGLDTKCLVYAGEEMIERYTKKMGQSLVDRTTISAE 251

Query: 244 VKAKPWFVYTPMHGVGFDIFSTIVKKTMSLVEGKDYLCVPEQQEPDPSFPTVAFPNPEEK 303
            + KPWFVYTP+HGVG+DIF  I ++TM+L+ G+DYLCV EQQ PDPSFPTV FPNPEEK
Sbjct: 252 KEGKPWFVYTPIHGVGYDIFRQIAEETMNLINGRDYLCVKEQQLPDPSFPTVPFPNPEEK 311

Query: 304 GALDLGINLAENHGINLLIANDPDADRFSVAIKDIRSGEWRQLTGNEIGFLFAIFEFQKF 363
           GALD+ I++A+ +GI+L++ANDPDADRFS A+KD ++G WRQLTGNEIG LFA +EFQK+
Sbjct: 312 GALDMAISVADKNGISLVLANDPDADRFSAAVKDNKTGTWRQLTGNEIGALFAFYEFQKY 371

Query: 364 KSMEKQFQHAHPLAMLSSTVSSQMIKKMAEVEGFHYEETLTGFKWIGNRAILLEKEGYYV 423
           +   ++++  HPLAML+STVSSQ+I KMAE+E FHY +TLTGFKWIGNR + LE   YYV
Sbjct: 372 QKKNEEYKEKHPLAMLNSTVSSQLIMKMAEIEQFHYIDTLTGFKWIGNRTLDLEAMNYYV 431

Query: 424 PFGFEEAIGYMFPAMEHDKDGLSASIVFLQAYCQWKIDHNLDPISILEDGFKKYGVFKEY 483
           PFGFEEAIGYMFP MEHDKDG+SA+ VFLQ Y +W +      +++LED F+KYGVFKEY
Sbjct: 432 PFGFEEAIGYMFPVMEHDKDGISAASVFLQMYRKWLVGSKKTLLTVLEDIFEKYGVFKEY 491

Query: 484 NGYYIVSSPIVTNEIFDYIRNAYTPKGVSYPSSIGKEIEVLNYRDLTIGYQSDTSNHKPT 543
           NGYY V+ P V  E+FD+IRN Y+     YPS IG+E++V  +RDLT+GYQSDT N +P 
Sbjct: 492 NGYYSVNDPKVIKEVFDFIRNDYSETHDPYPSRIGEELKVNKFRDLTLGYQSDTVNQRPD 551

Query: 544 LPIDPSSQMITVSAKPSDGNEGEHIRFTIRGSGTEPKIKVYIEACADEEQRATFLAKLTW 603
           LP+DP+SQMIT   K +     E +RFTIRGSGTEPK+KVYIEAC+  E+RA+ LA+LTW
Sbjct: 552 LPVDPNSQMITAWTKVNGAKPYESVRFTIRGSGTEPKLKVYIEACSKSEERASELAQLTW 611

Query: 604 NVLKREWFRPEKMDIVTHF 622
            VLKREWFRP+   + T F
Sbjct: 612 RVLKREWFRPDVTGLTTTF 630

>KNAG0J00270 Chr10 complement(39750..41627) [1878 bp, 625 aa] {ON}
           Anc_8.840 YMR278W
          Length = 625

 Score =  814 bits (2102), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/622 (61%), Positives = 471/622 (75%), Gaps = 2/622 (0%)

Query: 2   SLQFLEAVPSNLKEAISLWFEQDQNPETIEEVTALCKKSDWNELHRRFDSRIQFGTAGLR 61
           +L  L+  P  L+  I  W   D+N ET  EV  LC++ DW+EL+ RF  RI FGTAGLR
Sbjct: 5   TLHILQNAPEGLQHRILEWLRLDKNEETRREVLDLCQRQDWSELNSRFSQRILFGTAGLR 64

Query: 62  SQMQAGFNRMNTLVIIQASQGLATYAKQQFPNNLVAVVGHDHRFHSKEFARATATAFLLK 121
           S+M+AG NR+N+LVI+QA+QGLA Y   QFP N VAVVGHDHRFHSKEFA  TA  FL  
Sbjct: 65  SRMEAGTNRLNSLVILQATQGLARYIASQFPKNKVAVVGHDHRFHSKEFATVTAAVFLRA 124

Query: 122 GFKVHYLNPDHEFVHTPLVPFAVDKLKASVGVMVTASHNPKMDNGYKVYYSNGCQIIPPH 181
           GFKV YLNP    VHTPLVPF VD L ASVGVM+TASHNPKMDNGYKVY++NGCQIIPPH
Sbjct: 125 GFKVLYLNPGDTLVHTPLVPFTVDHLNASVGVMITASHNPKMDNGYKVYFANGCQIIPPH 184

Query: 182 DHAISDSIDMNLEPWANVWNFDDVLNKGLKQGKLMYSREEILKLYLGEVSKNLVGTDPLK 241
           D  I+ SID NLEPW   W++  V+    K+ +++Y ++++ +LY       L+G   + 
Sbjct: 185 DLNIARSIDQNLEPWEPSWDWPTVIQAAEKEDRIVYVKDQMTQLYTKTAELQLIGGRKVL 244

Query: 242 FEVKAKPWFVYTPMHGVGFDIFSTIVKKTMSLVEGKDYLCVPEQQEPDPSFPTVAFPNPE 301
               + PWFVYTPMHGVG +IFS I +  + + E +DYLCVPEQ+ PDPSFPTV+FPNPE
Sbjct: 245 RNPGSGPWFVYTPMHGVGSEIFSRISEDVLGIKENEDYLCVPEQKHPDPSFPTVSFPNPE 304

Query: 302 EKGALDLGINLAENHGINLLIANDPDADRFSVAIKDIRSGEWRQLTGNEIGFLFAIFEFQ 361
           EKGALD  I LA  +GINL+IANDPDADRFS+A+ D ++  WRQLTGNEIGFLFA  +F+
Sbjct: 305 EKGALDKAIELASQNGINLVIANDPDADRFSLAVFDSKTANWRQLTGNEIGFLFAYQQFE 364

Query: 362 KFKSMEKQFQHAHPLAMLSSTVSSQMIKKMAEVEGFHYEETLTGFKWIGNRAILLEKEGY 421
            +K+M+  FQ  HPL +L+STVSSQMIKKMAEVEGFHYE+TLTGFKWIGNRA  LEK+G+
Sbjct: 365 MYKAMDDIFQKEHPLVLLNSTVSSQMIKKMAEVEGFHYEDTLTGFKWIGNRARDLEKKGF 424

Query: 422 YVPFGFEEAIGYMFPAMEHDKDGLSASIVFLQAYCQWKIDHNLDPISILEDGFKKYGVFK 481
           + PFG+EEAIGYMF  MEHDKDG+SAS++FL +Y  W  D +  P+ ILEDG+KKYGVFK
Sbjct: 425 FAPFGYEEAIGYMFTQMEHDKDGISASLMFLLSYYHWVYDAHKFPLDILEDGYKKYGVFK 484

Query: 482 EYNGYYIVSSPIVTNEIFDYIRNAYTPKGVSYPSSIGKEIEVLNYRDLTIGYQSDTSNHK 541
           EYNGYYIV +P +  E FDYIRN   P G  YP +IG E +V+++RDLT+G+QSDTS+H 
Sbjct: 485 EYNGYYIVDNPKIMKETFDYIRNDRKP-GTQYPEAIGSEFQVVSFRDLTLGFQSDTSDHI 543

Query: 542 PTLPIDPSSQMITVSAKPSDGN-EGEHIRFTIRGSGTEPKIKVYIEACADEEQRATFLAK 600
           PTLP+DP+SQMITV AKP+  N E +H+RFTIRGSGTEPK+KVYIEAC+  E  A  LAK
Sbjct: 544 PTLPVDPNSQMITVCAKPTHDNVERDHVRFTIRGSGTEPKLKVYIEACSGSETGAQQLAK 603

Query: 601 LTWNVLKREWFRPEKMDIVTHF 622
             W+ L+  WFRP+   +VT F
Sbjct: 604 QMWDTLQEVWFRPQTTGLVTDF 625

>NCAS0C00410 Chr3 complement(62893..64770) [1878 bp, 625 aa] {ON}
           Anc_8.840 YMR278W
          Length = 625

 Score =  813 bits (2101), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/618 (60%), Positives = 476/618 (77%), Gaps = 1/618 (0%)

Query: 6   LEAVPSNLKEAISLWFEQDQNPETIEEVTALCKKSDWNELHRRFDSRIQFGTAGLRSQMQ 65
           L   P NL+E I+LW   DQN ET +EV  LC+  +W ELH+RFD+RI FGTAGLRS+M+
Sbjct: 8   LSNCPENLREPINLWLRLDQNEETRKEVLQLCENKNWPELHQRFDTRIVFGTAGLRSRME 67

Query: 66  AGFNRMNTLVIIQASQGLATYAKQQFPNNLVAVVGHDHRFHSKEFARATATAFLLKGFKV 125
           AGF+RMN+L+I+Q++QGLA Y K+QFPNNL AVVGHDHRFHSKEFA  TA+ FL  GFKV
Sbjct: 68  AGFSRMNSLIILQSTQGLANYIKEQFPNNLTAVVGHDHRFHSKEFAIVTASIFLRAGFKV 127

Query: 126 HYLNPDHEFVHTPLVPFAVDKLKASVGVMVTASHNPKMDNGYKVYYSNGCQIIPPHDHAI 185
            YL PD +FVHTPLVPF+V  LKASVGVM+TASHNPKMDNGYKVYY N CQIIPPHD  I
Sbjct: 128 FYLTPDDQFVHTPLVPFSVLNLKASVGVMITASHNPKMDNGYKVYYDNACQIIPPHDKNI 187

Query: 186 SDSIDMNLEPWANVWNFDDVLNKGLKQGKLMYSREEILKLYLGEVSKNLVGTDPLKFEVK 245
           ++ I  NLEPW+  W++D    KGL+  KL++ ++ + + YL ++ + L+ +  L  +  
Sbjct: 188 AEMIQKNLEPWSTSWDWDATFKKGLETNKLVFIKDLMTEKYLMQMKRVLIHSSHLSLKDV 247

Query: 246 AKPWFVYTPMHGVGFDIFSTIVKKTMSLVEGKDYLCVPEQQEPDPSFPTVAFPNPEEKGA 305
             P+FVYTPMHGVG +IF+ +  + ++L E  DYL V EQ+ PDPSFPTV+FPNPEEKGA
Sbjct: 248 KTPFFVYTPMHGVGAEIFAKVSSELLNLHENVDYLVVSEQRLPDPSFPTVSFPNPEEKGA 307

Query: 306 LDLGINLAENHGINLLIANDPDADRFSVAIKDIRSGEWRQLTGNEIGFLFAIFEFQKFKS 365
           L L I LA+ +G++L+IANDPDADRFS A+ + ++G+WRQLTGNEIGFL   +EFQ ++ 
Sbjct: 308 LSLAIKLAQENGLSLVIANDPDADRFSAAVLNKKTGKWRQLTGNEIGFLLGYYEFQLYEQ 367

Query: 366 MEKQFQHAHPLAMLSSTVSSQMIKKMAEVEGFHYEETLTGFKWIGNRAILLEKEGYYVPF 425
            +  F+  HPLAM++STVSSQMIK+MA++ GFHYE+TLTGFKWIGN+AI L +EGYYVPF
Sbjct: 368 QDVAFRKTHPLAMINSTVSSQMIKRMADMNGFHYEDTLTGFKWIGNKAIDLRQEGYYVPF 427

Query: 426 GFEEAIGYMFPAMEHDKDGLSASIVFLQAYCQWKIDHNLDPISILEDGFKKYGVFKEYNG 485
           GFEEAIGYMFP ME DKDG+SA+ VFLQAYC W   + + P  I+E+GF K+GVFKEYNG
Sbjct: 428 GFEEAIGYMFPDMECDKDGISAATVFLQAYCHWMNQYQMSPFDIMEEGFGKFGVFKEYNG 487

Query: 486 YYIVSSPIVTNEIFDYIRNAYTPKGVSYPSSIGKEIEVLNYRDLTIGYQSDTSNHKPTLP 545
           YYI+    +T  +FD+IR+ Y      YPS IG E+ V  +RDLT+GYQS+T ++ P LP
Sbjct: 488 YYILKDLSITKTVFDFIRHEYPSTNKKYPSEIGNELIVTVFRDLTVGYQSNTKDNIPNLP 547

Query: 546 IDPSSQMITVSAKPSD-GNEGEHIRFTIRGSGTEPKIKVYIEACADEEQRATFLAKLTWN 604
           +DP+SQMITV AKPS+  N    +R T+RGSGTEPK+KVYIEAC+  E+ AT LA+ TW+
Sbjct: 548 VDPTSQMITVEAKPSEFSNLEGTVRLTMRGSGTEPKLKVYIEACSKSEESATNLARSTWD 607

Query: 605 VLKREWFRPEKMDIVTHF 622
           +LKREWFRPE   + T F
Sbjct: 608 ILKREWFRPEVTGLTTSF 625

>SAKL0D01474g Chr4 complement(117178..119052) [1875 bp, 624 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 624

 Score =  810 bits (2092), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/623 (60%), Positives = 469/623 (75%), Gaps = 13/623 (2%)

Query: 8   AVPSNLKEAISLWFEQDQNPETIEEVTALCKKSDWNELHRRFDSRIQFGTAGLRSQMQAG 67
            VP +LKE+++LW   D+NPET  E+  L +   W ELH R D RI FGTAGLRS+M+AG
Sbjct: 7   TVPDDLKESVNLWLTYDKNPETRSELLNLVEGKHWEELHGRLDERISFGTAGLRSRMEAG 66

Query: 68  FNRMNTLVIIQASQGLATYAKQQFPNNLVAVVGHDHRFHSKEFARATATAFLLKGFKVHY 127
           F+RMNTL ++QASQGLA+Y K QFP NL  +VGHDHR+HS EFAR T TAFL  GFKV+Y
Sbjct: 67  FSRMNTLTVLQASQGLASYIKSQFPENLSVIVGHDHRYHSNEFARVTVTAFLQLGFKVYY 126

Query: 128 LN-----PDHEFVHTPLVPFAVDKLKASVGVMVTASHNPKMDNGYKVYYSNGCQIIPPHD 182
           LN         FVHTP+VPF +++L AS G+M+TASHNPKMDNGYKVYYSNGCQIIPPHD
Sbjct: 127 LNLSSKDSTETFVHTPMVPFTINQLNASAGIMITASHNPKMDNGYKVYYSNGCQIIPPHD 186

Query: 183 HAISDSIDMNLEPWANVWNFDDVLNKGLKQGKLMYSREEILKLYLGEVSKNLVGTDPLKF 242
             IS++ID NL PW   W+ D+V+   ++ G L   +E++   Y+  VS  LV    L  
Sbjct: 187 RLISETIDQNLVPWNKAWDCDEVIKTAIESGFLFDVKEKVTSKYIKTVSDELVRVPMLDC 246

Query: 243 EVKAKPWFVYTPMHGVGFDIFSTIVKKTMSLVEGKDYLCVPEQQEPDPSFPTVAFPNPEE 302
           +   KPWFVYTPMHGVGF+IF  I    + L EGK Y+CVPEQ+ PDP+FPTV+FPNPEE
Sbjct: 247 D---KPWFVYTPMHGVGFEIFEQIALLALGLKEGKHYVCVPEQRCPDPAFPTVSFPNPEE 303

Query: 303 KGALDLGINLAENHGINLLIANDPDADRFSVAIKDIRSGEWRQLTGNEIGFLFAIFEFQK 362
           KGALDL I LAE   I L+IANDPDADRFSVA+K+     W QLTGNEIGFLFA +++Q 
Sbjct: 304 KGALDLSIALAEEQDIRLVIANDPDADRFSVAVKN--GDRWSQLTGNEIGFLFAYYQWQD 361

Query: 363 FKSMEKQFQHAHPLAMLSSTVSSQMIKKMAEVEGFHYEETLTGFKWIGNRAILLEKEGYY 422
           ++ + + F+  HPLAM++STVSSQMIK +AE E FHYE+TLTGFKW+GNRA  LE +GYY
Sbjct: 362 YQKLGESFKKQHPLAMINSTVSSQMIKSLAEAEKFHYEDTLTGFKWLGNRAFELETQGYY 421

Query: 423 VPFGFEEAIGYMFPAMEHDKDGLSASIVFLQAYCQWKIDHNLDPISILEDGFKKYGVFKE 482
           VPF +EEAIGYMFP +EHDKDG+SA++VFLQ YC+W     + P+ +L++GF KYGVFKE
Sbjct: 422 VPFAYEEAIGYMFPEVEHDKDGISAAVVFLQMYCEWLSKDRMTPLQVLDEGFGKYGVFKE 481

Query: 483 YNGYYIVSSPIVTNEIFDYIRNAYTPKGVSYPSSIGKEIEVLNYRDLTIGYQSDTSNHKP 542
           YNGYYIV    +T E+FDYIR  YTP G +YP +IG E  V+++RDLT GYQSDT ++ P
Sbjct: 482 YNGYYIVPRLSLTKEVFDYIREDYTPSGHAYPPAIGSEFSVISFRDLTTGYQSDTIDNVP 541

Query: 543 TLPIDPSSQMITVSAKPSDGNE---GEHIRFTIRGSGTEPKIKVYIEACADEEQRATFLA 599
            LP+D SSQMIT + +PS+G E   GE +RFTIRGSGTEPK+KVYIEA + +E+RA  LA
Sbjct: 542 NLPVDASSQMITATLRPSNGKESTSGEQVRFTIRGSGTEPKLKVYIEAKSTDEKRAQHLA 601

Query: 600 KLTWNVLKREWFRPEKMDIVTHF 622
           + TW VL+REWFRPE+  + T F
Sbjct: 602 RETWQVLRREWFRPERTGLETKF 624

>ZYRO0G14190g Chr7 (1131206..1133038) [1833 bp, 610 aa] {ON} similar
           to uniprot|Q03262 Saccharomyces cerevisiae YMR278W
           Hypothetical ORF
          Length = 610

 Score =  806 bits (2082), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/606 (62%), Positives = 471/606 (77%), Gaps = 7/606 (1%)

Query: 9   VPSNLKEAISLWFEQDQNPETIEEVTALCKKSDWNELHRRFDSRIQFGTAGLRSQMQAGF 68
           +P NLK+ ISLW  QD+N +T +E+  LC   +W+ELH R +SR+QFGTAGLR++M+AGF
Sbjct: 5   IPENLKQPISLWLAQDRNEKTCKEIAELCDAENWSELHERLNSRLQFGTAGLRARMEAGF 64

Query: 69  NRMNTLVIIQASQGLATYAKQQFPNNLVAVVGHDHRFHSKEFARATATAFLLKGFKVHYL 128
           +RMNTLV+IQA+QGLA Y K+QFP++LVAVVGHDHRF+S +FA+ATAT  L  GF+VHYL
Sbjct: 65  SRMNTLVVIQATQGLAQYIKKQFPDHLVAVVGHDHRFNSMDFAKATATVLLKAGFEVHYL 124

Query: 129 NPDHEFVHTPLVPFAVDKLKASVGVMVTASHNPKMDNGYKVYYSNGCQIIPPHDHAISDS 188
           N    +VHTP+VPF VD++KASVGVM+TASHNPK+DNGYKVYY+NGCQIIPPHD AI+ S
Sbjct: 125 NQGDSYVHTPMVPFTVDRVKASVGVMITASHNPKLDNGYKVYYANGCQIIPPHDSAIARS 184

Query: 189 IDMNLEPWANVWNFDDVLNKGLKQGKLMYSREEILKLYLGEVSKNLVGTDPLKFEVKAKP 248
           I+ NLEP   VW++D  + +   +GKL+Y R+++L+ Y+  V  + V    L    K KP
Sbjct: 185 IESNLEPGNGVWDWDQTMQQAADEGKLIYGRDKMLEQYISCVKDSFVTE--LDSLPKGKP 242

Query: 249 WFVYTPMHGVGFDIFSTIVKKTMSLVEGKDYLCVPEQQEPDPSFPTVAFPNPEEKGALDL 308
           WFVYTPMHGVG+ +F  I  K + L   +D+L V EQ  PDP FPTV FPNPEEKGALDL
Sbjct: 243 WFVYTPMHGVGYQVFDQIASKILQLEVNRDFLVVSEQLNPDPEFPTVQFPNPEEKGALDL 302

Query: 309 GINLAENHGINLLIANDPDADRFSVAIKDIRSGEWRQLTGNEIGFLFAIFEFQKFKSMEK 368
            I LAENHGI L+IA+DPDADRFSVA K      W+QL+GN+IGFLFA +E QK++  + 
Sbjct: 303 AIKLAENHGIKLVIASDPDADRFSVAFKGPHG--WQQLSGNDIGFLFAYYELQKYRGFDA 360

Query: 369 QFQHAHPLAMLSSTVSSQMIKKMAEVEGFHYEETLTGFKWIGNRAILLEKEGYYVPFGFE 428
           ++Q +HPLAML+STVSSQMI  MA +EGFH+E+TLTGFKWIGNRA+ LE  GYYVPFGFE
Sbjct: 361 EYQKSHPLAMLNSTVSSQMINSMAALEGFHHEDTLTGFKWIGNRALELEARGYYVPFGFE 420

Query: 429 EAIGYMFPAMEHDKDGLSASIVFLQAYCQWKIDHNLDPISILEDGFKKYGVFKEYNGYYI 488
           EAIGYMFPA EHDKDG+SA++VFLQAY  W I     P+ IL++   KYGVF+EYNGYY+
Sbjct: 421 EAIGYMFPATEHDKDGISAAVVFLQAYHSW-ISQGKSPLDILDEASAKYGVFREYNGYYL 479

Query: 489 VSSPIVTNEIFDYIRNAYTPKGVSYPSSIGKEIEVLNYRDLTIGYQSDTSNHKPTLPIDP 548
           V  P +TN+ F YIR  YTPKG +YP +IG +++V  +RDLT GYQSDT N+ P L +DP
Sbjct: 480 VDEPSLTNKTFAYIREDYTPKGENYPRTIG-DLQVKTFRDLTTGYQSDTPNNIPNLHVDP 538

Query: 549 SSQMITVSAKPSDGNEGEHIRFTIRGSGTEPKIKVYIEACADEEQRATFLAKLTWNVLKR 608
           SSQMIT+ A+P  G  GEH+RFT+RGSGTEPK+KVYIEA A  + RA  LA+ TW++L+ 
Sbjct: 539 SSQMITIVAQPKGGGSGEHVRFTLRGSGTEPKLKVYIEAGAQSDPRARELARQTWDILRE 598

Query: 609 EWF-RP 613
           EWF RP
Sbjct: 599 EWFNRP 604

>Kpol_1068.8 s1068 complement(13542..15440) [1899 bp, 632 aa] {ON}
           complement(13542..15440) [1899 nt, 633 aa]
          Length = 632

 Score =  800 bits (2065), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/621 (60%), Positives = 478/621 (76%), Gaps = 4/621 (0%)

Query: 6   LEAVPSNLKEAISLWFEQDQNPETIEEVTALCKKSDWNELHRRFDSRIQFGTAGLRSQMQ 65
           LE +P +L++ +  W  QD+NPETI EV  LCK +  NELH+RFD+RI FGTAGLRS+M+
Sbjct: 12  LETLPVDLRDKVGTWLAQDKNPETINEVIRLCKANSLNELHKRFDNRILFGTAGLRSKME 71

Query: 66  AGFNRMNTLVIIQASQGLATYAKQQFPNNLVAVVGHDHRFHSKEFARATATAFLLKGFKV 125
           AGF+RMNTLV++QA+QGLATY KQQFP+NL AV+GHDHR+HSKEFA    + FL  GF V
Sbjct: 72  AGFSRMNTLVVLQATQGLATYIKQQFPSNLKAVIGHDHRYHSKEFAEIATSVFLSAGFTV 131

Query: 126 HYLNPDHEFVHTPLVPFAVDKLKASVGVMVTASHNPKMDNGYKVYYSNGCQIIPPHDHAI 185
           + LNP   FVHTPLVPF VD++ ASVGVM+TASHNPKMDNGYKVYYSNGCQIIPP D +I
Sbjct: 132 YNLNPPGTFVHTPLVPFTVDQIGASVGVMITASHNPKMDNGYKVYYSNGCQIIPPVDASI 191

Query: 186 SDSIDMNLEPWANVWNFDDVLNKGLKQGKLMYSREEILKLYLGEVSKNLVGTDPLK-FEV 244
           +  ID NLEPW+N W+    +  GL   KL+Y R E+L  Y  +V  N++    ++ F+ 
Sbjct: 192 AKCIDENLEPWSNSWDSSKAIEAGLSNKKLIYLRNEMLLAYSDKVDNNIIDKKTIREFDE 251

Query: 245 KAKPWFVYTPMHGVGFDIFSTIVKKTMSLVEGKDYLCVPEQQEPDPSFPTVAFPNPEEKG 304
             KPWFVYTPMHGVG++IF+++V + ++L E +DYL V EQ  PDP+FPT++FPNPEEKG
Sbjct: 252 HRKPWFVYTPMHGVGYEIFTSLVLEKVNLKENRDYLTVKEQIVPDPAFPTISFPNPEEKG 311

Query: 305 ALDLGINLAENHGINLLIANDPDADRFSVAIKDIRSGEWRQLTGNEIGFLFAIFEFQKFK 364
           ALD+ I LA+ + I+L+IANDPDADRFS AI +  SGEW+QLTGNEIGFLF  + F K+ 
Sbjct: 312 ALDMAIALAKENDISLVIANDPDADRFSAAIYNSHSGEWQQLTGNEIGFLFGYYLFNKYT 371

Query: 365 SMEKQFQHAHPLAMLSSTVSSQMIKKMAEVEGFHYEETLTGFKWIGNRAILLEKEGYYVP 424
           +M+ +F+  HPLAML+STVSS+M+K MA+ E F + +TLTGFKWIGN+AI L+KEGY+V 
Sbjct: 372 NMDPEFKKNHPLAMLNSTVSSRMLKSMADTENFKFIDTLTGFKWIGNKAIDLKKEGYHVV 431

Query: 425 FGFEEAIGYMFPAMEHDKDGLSASIVFLQAYCQWKIDHNLDPISILEDGFKKYGVFKEYN 484
           FG+EEAIGYMFPAMEHDKDG++AS+VFLQAY +W     +  I ILE G +KYG FKEYN
Sbjct: 432 FGYEEAIGYMFPAMEHDKDGITASVVFLQAYFEWDNLSKVTVIDILEQGIEKYGAFKEYN 491

Query: 485 GYYIVSSPIVTNEIFDYIRNAYTPKGVSYPSSIGKEIEVLNYRDLTIGYQSDTSNHKPTL 544
           GYY+VS+P VTN+IF YIRN Y   G  YP  IG  +EV ++RDLT G+QSDT ++ P+L
Sbjct: 492 GYYVVSNPQVTNDIFHYIRNEYPKNGNQYPKMIGTLLEVCSFRDLTTGFQSDTVDNIPSL 551

Query: 545 PIDPSSQMITVSAKPSDGNEGEH---IRFTIRGSGTEPKIKVYIEACADEEQRATFLAKL 601
           P+DPSSQMIT++AK  D    +    +RFT+RGSGTEPK+K+YIE  + +   A+ +AKL
Sbjct: 552 PVDPSSQMITITAKICDDEYQKSDSIVRFTMRGSGTEPKLKLYIEGHSKDPIAASKIAKL 611

Query: 602 TWNVLKREWFRPEKMDIVTHF 622
           TW+VLK+EW RPE   + T +
Sbjct: 612 TWDVLKKEWIRPEVTGVTTSY 632

>TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840
           YMR278W
          Length = 629

 Score =  794 bits (2051), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/621 (61%), Positives = 477/621 (76%), Gaps = 3/621 (0%)

Query: 4   QFLEAVPSNLKEAISLWFEQDQNPETIEEVTALCKKSDWNELHRRFDSRIQFGTAGLRSQ 63
             L ++P +LKE I +WF  D N ET++EV  LC     +ELH+RFD RI FGTAGLRS+
Sbjct: 10  NLLSSIPEDLKEKIRVWFRYDDNQETVDEVKELCVNKSLDELHKRFDQRIVFGTAGLRSR 69

Query: 64  MQAGFNRMNTLVIIQASQGLATYAKQQFPNNLVAVVGHDHRFHSKEFARATATAFLLKGF 123
           M+AGFNRMN L ++Q++QGLA+Y K QFP+NL AVVGHDHR+HSKEFA+ TA  FL  GF
Sbjct: 70  MEAGFNRMNALTVLQSTQGLASYIKSQFPSNLTAVVGHDHRYHSKEFAQITAAVFLNAGF 129

Query: 124 KVHYLNPDHEFVHTPLVPFAVDKLKASVGVMVTASHNPKMDNGYKVYYSNGCQIIPPHDH 183
           KV+YLNP+ EFVHTP+VPF ++   AS+GVM+TASHNP+MDNGYKVYY+NGCQIIPPHD 
Sbjct: 130 KVYYLNPNDEFVHTPMVPFGINLYSASIGVMITASHNPEMDNGYKVYYNNGCQIIPPHDK 189

Query: 184 AISDSIDMNLEPWANVWNFDDVLNKGLKQGKLMYSREEILKLYLGEVSKNLVGTD-PLKF 242
            I++ I+ NLEP ++ WN + V++K ++  KL+YS+E++L+ Y+  + K ++  +  L  
Sbjct: 190 NIAECIEKNLEPLSDNWNTEAVISKAIENVKLIYSKEDVLQQYMLNLDKYIIPKNISLGT 249

Query: 243 EVKAK-PWFVYTPMHGVGFDIFSTIVKKTMSLVEGKDYLCVPEQQEPDPSFPTVAFPNPE 301
            +K K PWFVYTPMHGVG+ IF  I    ++LVE  DY+CV EQ  PDPSFPTV+FPNPE
Sbjct: 250 TIKGKKPWFVYTPMHGVGYQIFHRISSTCLNLVEDIDYVCVKEQIVPDPSFPTVSFPNPE 309

Query: 302 EKGALDLGINLAENHGINLLIANDPDADRFSVAIKDIRSGEWRQLTGNEIGFLFAIFEFQ 361
           EKGALDLGI  A+ H I+L++ANDPDADRFSVA+++  + E++QLTGNEIGFLFA F ++
Sbjct: 310 EKGALDLGIKYAKKHNIDLVVANDPDADRFSVAVRNPLTDEFQQLTGNEIGFLFAYFLWE 369

Query: 362 KFKSMEKQFQHAHPLAMLSSTVSSQMIKKMAEVEGFHYEETLTGFKWIGNRAILLEKEGY 421
           ++  +   F+   PLAM++STVSSQMIKKMAEVEGF+YE+TLTGFKWIGN+A  LEKEGY
Sbjct: 370 QYSMLPADFKDKFPLAMINSTVSSQMIKKMAEVEGFYYEDTLTGFKWIGNKARELEKEGY 429

Query: 422 YVPFGFEEAIGYMFPAMEHDKDGLSASIVFLQAYCQWKIDHNLDPISILEDGFKKYGVFK 481
           YVPFGFEEAIGYMFP ME DKDG++A++VFLQAY  W +++      I+E GFKKYGVFK
Sbjct: 430 YVPFGFEEAIGYMFPKMECDKDGITATVVFLQAYYGWCMNNKQSLFDIIETGFKKYGVFK 489

Query: 482 EYNGYYIVSSPIVTNEIFDYIRNAYTPKGVSYPSSIGKEIEVLNYRDLTIGYQSDTSNHK 541
           EYNGYYIV+   +T  IFD IR     K   Y S IG E +V+ +RDLT+GYQSDT  + 
Sbjct: 490 EYNGYYIVNDLSLTKIIFDNIRENKNDKE-KYVSHIGTEFKVITFRDLTLGYQSDTIGNV 548

Query: 542 PTLPIDPSSQMITVSAKPSDGNEGEHIRFTIRGSGTEPKIKVYIEACADEEQRATFLAKL 601
           PTLP+DPSSQMIT++  P+   E   +RFTIRGSGTEPK+KVYIEA A  E  A  LAKL
Sbjct: 549 PTLPVDPSSQMITMTIIPTSLPENGSVRFTIRGSGTEPKLKVYIEANAKTEAEANRLAKL 608

Query: 602 TWNVLKREWFRPEKMDIVTHF 622
           TW+VLKREWF  EK  + T+F
Sbjct: 609 TWDVLKREWFSSEKTGLTTNF 629

>CAGL0M02981g Chr13 (335863..337716) [1854 bp, 617 aa] {ON} similar
           to uniprot|Q03262 Saccharomyces cerevisiae YMR278w
          Length = 617

 Score =  790 bits (2040), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/616 (60%), Positives = 468/616 (75%), Gaps = 6/616 (0%)

Query: 9   VPSNLKEAISLWFEQDQNPETIEEVTALCKKSDWNELHRRFDSRIQFGTAGLRSQMQAGF 68
           +P  L+ AI  W + D+N ET  EV  LC   +W+ELH+RFDSRI FGTAGLR++M+AG 
Sbjct: 6   IPVELRTAIESWLQLDKNEETRNEVIKLCNDQNWDELHKRFDSRIVFGTAGLRARMEAGT 65

Query: 69  NRMNTLVIIQASQGLATYAKQQFPNNLVAVVGHDHRFHSKEFARATATAFLLKGFKVHYL 128
           NR+N LVI+QASQGLATY K +FP NL AVVGHDHR+HS+EFA+ TA  F+  GFKV+YL
Sbjct: 66  NRLNKLVILQASQGLATYIKDKFPQNLTAVVGHDHRYHSQEFAQVTAATFIRAGFKVYYL 125

Query: 129 NPDHEFVHTPLVPFAVDKLKASVGVMVTASHNPKMDNGYKVYYSNGCQIIPPHDHAISDS 188
           NP  EFVHTP+VP++VD L ASVGVM+TASHNPKMDNGYKVYY+NGCQIIPPHDH I+++
Sbjct: 126 NPHDEFVHTPMVPYSVDHLNASVGVMITASHNPKMDNGYKVYYTNGCQIIPPHDHGIAET 185

Query: 189 IDMNLEPWANVWNFDDVLNKGLKQGKLMYSREEILKLYLGEVSKNLVGTDPLKFEV-KAK 247
           I+ NLEPW+  WNF  +L+     GK+ Y R+ +L  YL  V   L+  D   F     K
Sbjct: 186 INNNLEPWSTDWNFTKILSNAETDGKIEYVRKRMLTSYLNSVVNQLIQRD---FAAPDEK 242

Query: 248 PWFVYTPMHGVGFDIFSTIVKKTMSLVEGKDYLCVPEQQEPDPSFPTVAFPNPEEKGALD 307
           PWFVYTPMHGVG  IFSTI+ ++++L +  DY+ VPEQ++PDPSF TV+FPNPEEKGAL+
Sbjct: 243 PWFVYTPMHGVGHQIFSTILNESLNLKDNIDYITVPEQKDPDPSFRTVSFPNPEEKGALN 302

Query: 308 LGINLAENHGINLLIANDPDADRFSVAIKDIRSGEWRQLTGNEIGFLFAIFEFQKFKSME 367
           L I LAE +GI L++ANDP+ADRFSVA++D    EW+QLTGNEIG LFA +EF+ ++   
Sbjct: 303 LAITLAEANGIKLVLANDPNADRFSVAVRDDSKNEWKQLTGNEIGLLFAFYEFKMYQKAA 362

Query: 368 KQFQHAHPLAMLSSTVSSQMIKKMAEVEGFHYEETLTGFKWIGNRAILLEKEGYYVPFGF 427
            +     PLAML+STVS+Q+IK+MAE EGF Y++TLTGFKWIGN A  LE++GY+VPFG+
Sbjct: 363 DKGIKNKPLAMLNSTVSAQVIKRMAEKEGFLYKDTLTGFKWIGNEAAKLEEKGYFVPFGY 422

Query: 428 EEAIGYMFPAMEHDKDGLSASIVFLQAYCQWKIDHNLDPISILEDGFKKYGVFKEYNGYY 487
           EEAIGYMFPAMEHDKDG+SA+IVFLQAY  W +  + +PI I+ + + KYGV  EYNGYY
Sbjct: 423 EEAIGYMFPAMEHDKDGVSAAIVFLQAYANW-LQSSSNPIDIIHECYDKYGVSAEYNGYY 481

Query: 488 IVSSPIVTNEIFDYIRNAYTPKGVSYPSSIGKEIEVLNYRDLTIGYQSDTSNHKPTLPID 547
           IVS P  T+++F+ IR++YT  G+S+P SIG+   V  +RDLTIG+ S T++ KP LP+D
Sbjct: 482 IVSDPSKTDKVFESIRSSYTSMGLSFPESIGEHFRVTEFRDLTIGFDSTTADKKPLLPVD 541

Query: 548 PSSQMITVSAKPSDG-NEGEHIRFTIRGSGTEPKIKVYIEACADEEQRATFLAKLTWNVL 606
            +SQMIT++A PS   N GE +RFTIRGSGTEPK+KVYIE  +  E RA  LAK  W  L
Sbjct: 542 KNSQMITITAVPSGASNTGESVRFTIRGSGTEPKLKVYIEGISSTEGRARILAKSLWETL 601

Query: 607 KREWFRPEKMDIVTHF 622
           K EWF+P    + T F
Sbjct: 602 KHEWFKPSSNGLSTDF 617

>TBLA0B03250 Chr2 (757928..759859) [1932 bp, 643 aa] {ON} Anc_8.840
           YMR278W
          Length = 643

 Score =  789 bits (2037), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/638 (59%), Positives = 475/638 (74%), Gaps = 24/638 (3%)

Query: 5   FLEAVPSNLKEAISLWFEQDQNPETIEEVTALCKKSDWNELHRRFDSRIQFGTAGLRSQM 64
            ++  P +L++ + LW EQD++  T +E+  LCK ++  ELH RFDSRI FGTAGLRS M
Sbjct: 10  LIKDYPEDLQKKVLLWLEQDKDDSTRKEIIDLCKSANVKELHERFDSRITFGTAGLRSTM 69

Query: 65  QAGFNRMNTLVIIQASQGLATYAKQQFPNN---LVAVVGHDHRFHSKEFARATATAFLLK 121
           +AGF+RMNTL ++QASQGLATY K    N    L+AV+GHDHR+HSKEFA+  AT FL+ 
Sbjct: 70  EAGFSRMNTLTVLQASQGLATYMKNDAKNTGQKLIAVIGHDHRYHSKEFAKIAATVFLIA 129

Query: 122 GFKVHYLNPD-------HEFVHTPLVPFAVDKLKASVGVMVTASHNPKMDNGYKVYYSNG 174
           GFKV+YLN D       ++FVHTP+VPF V  LKASVGVMVTASHNPKMDNGYKVYYSNG
Sbjct: 130 GFKVYYLNDDSLEDPRDNKFVHTPMVPFTVKNLKASVGVMVTASHNPKMDNGYKVYYSNG 189

Query: 175 CQIIPPHDHAISDSIDMNLEPWANVWNFDDVLNKGLKQGKLMYSREEILKLYLGEVSKNL 234
           CQIIPPHD  IS  ID NLEPW N WN+ +++     +G L+Y R+ +L  Y+ ++ + L
Sbjct: 190 CQIIPPHDSGISQCIDANLEPWENSWNYKEIMANAESKGDLIYHRDVMLNDYITQLEEKL 249

Query: 235 VGTDPL----KFEVKAKPWFVYTPMHGVGFDIFSTIVKKTMSLVEGKDYLCVPEQQEPDP 290
              D +    K +VK+KPWFVYTPMHGVG++IF+ I  + + + EG+D++ V EQ+ PDP
Sbjct: 250 TSKDIIHLSKKIDVKSKPWFVYTPMHGVGYEIFTKISNEILHMKEGEDFIVVEEQKHPDP 309

Query: 291 SFPTVAFPNPEEKGALDLGINLAENHGINLLIANDPDADRFSVAIKDIRS-GEWRQLTGN 349
            FPTV+FPNPEEKGA+D+GI LAE++GI+L+IANDPDADRFS+A+K   S G W Q TGN
Sbjct: 310 GFPTVSFPNPEEKGAIDMGIKLAEDNGISLVIANDPDADRFSIAVKSKGSQGTWHQFTGN 369

Query: 350 EIGFLFAIFEFQKFKSMEKQFQHAHPLAMLSSTVSSQMIKKMAEVEGFHYEETLTGFKWI 409
           EIG+LFA FEFQK+K  +   Q  H L M++STVSSQMIKKMAE+EGF+YEETLTGFKWI
Sbjct: 370 EIGYLFAYFEFQKYKISK---QDLHRLYMVNSTVSSQMIKKMAEIEGFNYEETLTGFKWI 426

Query: 410 GNRAILLEKEGYYVPFGFEEAIGYMFPAMEHDKDGLSASIVFLQAYCQWKIDHNLDPISI 469
           GNRAI L  +G  VPFG+EEAIGYMFP ME DKDG++A+++F+QA+  W     +DP  I
Sbjct: 427 GNRAIDLINKGNIVPFGYEEAIGYMFPTMEIDKDGIAATVIFIQAFMYWNQIDKMDPYEI 486

Query: 470 LEDGFKKYGVFKEYNGYYIVSSPIVTNEIFDYIRNAYTPKGVS-----YPSSIGKEIEVL 524
           ++ GFKKYGVF EYNGYY  +   +T +IFDY+R  Y  KGVS     YP  IG+E +++
Sbjct: 487 IQLGFKKYGVFIEYNGYYRYTDLGITKKIFDYVRYDYD-KGVSEGNKKYPDHIGEEFKII 545

Query: 525 NYRDLTIGYQSDTSNHKPTLPIDPSSQMITVSAKPSDGNEGEHIRFTIRGSGTEPKIKVY 584
            YRDLT GYQSDT ++KP LP+DPSSQMITV   P+D      IR TIRGSGTEPK+KVY
Sbjct: 546 KYRDLTTGYQSDTPDNKPLLPVDPSSQMITVEMIPTDNESDGSIRLTIRGSGTEPKLKVY 605

Query: 585 IEACADEEQRATFLAKLTWNVLKREWFRPEKMDIVTHF 622
           IEAC+     A+FLAK  WNVLKREW RPE+  I T F
Sbjct: 606 IEACSRSATEASFLAKQAWNVLKREWMRPEQTGITTAF 643

>NDAI0K00410 Chr11 complement(91807..93687) [1881 bp, 626 aa] {ON}
           Anc_8.840 YMR278W
          Length = 626

 Score =  776 bits (2005), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/615 (61%), Positives = 462/615 (75%), Gaps = 1/615 (0%)

Query: 9   VPSNLKEAISLWFEQDQNPETIEEVTALCKKSDWNELHRRFDSRIQFGTAGLRSQMQAGF 68
            P+NL+E I LW  QD+  ET  EV  LCK S+W ELH+RFDSRI FGTAGLRS+M+AGF
Sbjct: 12  CPANLRENIDLWLRQDKCEETRNEVIQLCKDSNWIELHKRFDSRIVFGTAGLRSRMEAGF 71

Query: 69  NRMNTLVIIQASQGLATYAKQQFPNNLVAVVGHDHRFHSKEFARATATAFLLKGFKVHYL 128
           +RMN LVI+QASQGLA Y K QFP NL AVVGHDHRFHSK+FA  TA+ FL  GFKV+YL
Sbjct: 72  SRMNPLVILQASQGLAKYIKAQFPTNLTAVVGHDHRFHSKQFAMITASVFLRVGFKVYYL 131

Query: 129 NPDHEFVHTPLVPFAVDKLKASVGVMVTASHNPKMDNGYKVYYSNGCQIIPPHDHAISDS 188
           NP+  FVHTPLVPF+V+ L AS+GVM+TASHNPKMDNGYKVYYSNGCQIIPPHD  I+ +
Sbjct: 132 NPEDSFVHTPLVPFSVNHLNASIGVMITASHNPKMDNGYKVYYSNGCQIIPPHDKNIAAT 191

Query: 189 IDMNLEPWANVWNFDDVLNKGLKQGKLMYSREEILKLYLGEVSKNLVGTDPLKFEVKAK- 247
           ID NLEPW++ WN+D    K LK+ KL+Y REE+   YL  +   LV +   +     K 
Sbjct: 192 IDENLEPWSSDWNWDSTFEKNLKEKKLVYVREEMTNKYLQAMKDILVSSSISRPNNNGKK 251

Query: 248 PWFVYTPMHGVGFDIFSTIVKKTMSLVEGKDYLCVPEQQEPDPSFPTVAFPNPEEKGALD 307
           PWFVYTPMHGVG++IF+ I K  +   E  DY  V EQ  PDP+FPTV+FPNPEEKGAL 
Sbjct: 252 PWFVYTPMHGVGYNIFTKISKNILHYEENMDYFVVKEQMYPDPAFPTVSFPNPEEKGALS 311

Query: 308 LGINLAENHGINLLIANDPDADRFSVAIKDIRSGEWRQLTGNEIGFLFAIFEFQKFKSME 367
           L   LAE + I+L+IANDPDADRFSVA K+ ++G+W+QL+GNEIGFLFA FE +K+ S +
Sbjct: 312 LATKLAEENNISLVIANDPDADRFSVASKNEKTGQWQQLSGNEIGFLFASFELEKYMSQD 371

Query: 368 KQFQHAHPLAMLSSTVSSQMIKKMAEVEGFHYEETLTGFKWIGNRAILLEKEGYYVPFGF 427
            +++  HPLAM++STVSSQMIKKMA+VE FHYE+TLTGFKWIGNRA+ L+ +GYYVPFGF
Sbjct: 372 IEWRRTHPLAMINSTVSSQMIKKMAQVESFHYEDTLTGFKWIGNRALDLQGQGYYVPFGF 431

Query: 428 EEAIGYMFPAMEHDKDGLSASIVFLQAYCQWKIDHNLDPISILEDGFKKYGVFKEYNGYY 487
           EEAIGYMFP M  DKDG+SA++VFL AY  W  +    P  ILE GFKK+G FKEYNGYY
Sbjct: 432 EEAIGYMFPTMVTDKDGVSAAVVFLLAYSYWLNNDGSYPFDILEKGFKKFGFFKEYNGYY 491

Query: 488 IVSSPIVTNEIFDYIRNAYTPKGVSYPSSIGKEIEVLNYRDLTIGYQSDTSNHKPTLPID 547
           I   P  T +IFD++R  Y   G  YP +IGKE ++  +RDLT GYQS+T ++ P LP+D
Sbjct: 492 IYDDPKTTKQIFDFVRYQYDTSGNPYPKNIGKEFKIEVFRDLTTGYQSNTIDNLPNLPVD 551

Query: 548 PSSQMITVSAKPSDGNEGEHIRFTIRGSGTEPKIKVYIEACADEEQRATFLAKLTWNVLK 607
           P S+MIT+ A P        +RFT+RGSGTEPK+K+YIEA AD E+ A  LA   WNVLK
Sbjct: 552 PHSEMITIEAVPKQDIGKSKVRFTMRGSGTEPKLKLYIEAVADNEKCAIDLAYEMWNVLK 611

Query: 608 REWFRPEKMDIVTHF 622
           +EW RP+   + T F
Sbjct: 612 KEWIRPDVTGLTTTF 626

>KAFR0B03920 Chr2 (814394..816268) [1875 bp, 624 aa] {ON} Anc_8.840
           YMR278W
          Length = 624

 Score =  762 bits (1967), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/618 (59%), Positives = 450/618 (72%), Gaps = 8/618 (1%)

Query: 7   EAVPSNLKEAISLWFEQDQNPETIEEVTALCKKSDWNELHRRFDSRIQFGTAGLRSQMQA 66
           E VP  LK +   W   DQN ET  E+  +  + DW EL  R + RI FGTAGLR +M+A
Sbjct: 13  EYVPERLKVSCDRWLRYDQNEETRSEILTIIGRKDWKELGNRLEGRIPFGTAGLRGRMEA 72

Query: 67  GFNRMNTLVIIQASQGLATYAKQQFPNNLVAVVGHDHRFHSKEFARATATAFLLKGFKVH 126
           GF RMN+LVI+Q SQGLA Y  ++FP NL  VVGHDHR+HSKEFA  T   FL  GFKV 
Sbjct: 73  GFTRMNSLVILQTSQGLAQYIMEKFPQNLSVVVGHDHRYHSKEFADITVATFLNAGFKVF 132

Query: 127 YLNPDHEFVHTPLVPFAVDKLKASVGVMVTASHNPKMDNGYKVYYSNGCQIIPPHDHAIS 186
           YLN ++EFVHTPLVP++VDKL+++ GVM+TASHNPK DNGYKVYYSNGCQIIPPHD  I+
Sbjct: 133 YLNTENEFVHTPLVPYSVDKLRSACGVMITASHNPKDDNGYKVYYSNGCQIIPPHDKNIA 192

Query: 187 DSIDMNLEPWANVWNFDDVLNKGLKQGKLMYSREEILKLYLGEVSKNLV--GTDPLKFEV 244
            +I+ NL PW+  WN+ D+ +   + G L ++  ++   Y+ ++++ +   G+  LK   
Sbjct: 193 LTIEKNLTPWSKDWNWKDLFSTEERNGNLEFNGNKMFLAYVQDITRYVFTNGSPMLK--- 249

Query: 245 KAKPWFVYTPMHGVGFDIFSTIVKKTMSLVEGKDYLCVPEQQEPDPSFPTVAFPNPEEKG 304
             KPWFVYTPMHGVG  IF  I K+ + L E  DY  VPEQ +PDPSFPTV+FPNPEEKG
Sbjct: 250 TGKPWFVYTPMHGVGHKIFGQIAKQVLGLSENVDYFSVPEQIKPDPSFPTVSFPNPEEKG 309

Query: 305 ALDLGINLAENHGINLLIANDPDADRFSVAIKDIRSGEWRQLTGNEIGFLFAIFEFQKFK 364
           ALD+ I LAE  G+ L+IANDPDADRFS A+KD RS EWRQL+GNEIG LFAIF+ Q+ K
Sbjct: 310 ALDMAIQLAEREGLTLIIANDPDADRFSAAVKDKRSHEWRQLSGNEIGSLFAIFKLQEHK 369

Query: 365 SMEKQFQHAHPLAMLSSTVSSQMIKKMAEVEGFHYEETLTGFKWIGNRAILLEKEGYYVP 424
              ++     PLAML+STVSSQM+KKMA+VEGFHYEETLTGFKWIGNRA+ LE++GY V 
Sbjct: 370 ---EKAASRKPLAMLNSTVSSQMLKKMAQVEGFHYEETLTGFKWIGNRALQLEQQGYDVC 426

Query: 425 FGFEEAIGYMFPAMEHDKDGLSASIVFLQAYCQWKIDHNLDPISILEDGFKKYGVFKEYN 484
           FG+EEAIGYMFP MEHDKDG+ AS+VFL  Y +W     L P+ +L+  F+KYGVF EYN
Sbjct: 427 FGYEEAIGYMFPCMEHDKDGIIASVVFLHMYSKWLELEGLGPLDVLDLCFEKYGVFSEYN 486

Query: 485 GYYIVSSPIVTNEIFDYIRNAYTPKGVSYPSSIGKEIEVLNYRDLTIGYQSDTSNHKPTL 544
           GYY V  P +   +F YIR+ Y PK   YP  +G+E  + ++RDLT+GYQSDT + KPTL
Sbjct: 487 GYYTVEEPALIESVFSYIRDEYCPKARPYPEKLGREFFLTSFRDLTLGYQSDTIDFKPTL 546

Query: 545 PIDPSSQMITVSAKPSDGNEGEHIRFTIRGSGTEPKIKVYIEACADEEQRATFLAKLTWN 604
           P+D SSQMIT + KP      E IRFTIRGSGTEPK+KVYIE+ A  ++ A  LA LTWN
Sbjct: 547 PVDASSQMITATLKPERTVGHEEIRFTIRGSGTEPKLKVYIESHAANKEAAANLAHLTWN 606

Query: 605 VLKREWFRPEKMDIVTHF 622
           VL+REWFRPE   + T F
Sbjct: 607 VLRREWFRPEITGLKTSF 624

>Kwal_27.10258 s27 complement(265612..267474) [1863 bp, 620 aa] {ON}
           YMR278W - Hypothetical ORF [contig 37] FULL
          Length = 620

 Score =  730 bits (1885), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/623 (56%), Positives = 456/623 (73%), Gaps = 19/623 (3%)

Query: 9   VPSNLKEAISLWFEQDQNPETIEEVTALCKKSDWNELHRRFDSRIQFGTAGLRSQMQAGF 68
           +P++LK ++  WFE D+N ET  E+  L  + +WNELH+R D RI FGTAGLRS+M+AGF
Sbjct: 8   IPADLKSSVESWFEHDKNEETRNEILQLVTEQNWNELHKRLDQRISFGTAGLRSKMEAGF 67

Query: 69  NRMNTLVIIQASQGLATYAKQQFPNNLVAVVGHDHRFHSKEFARATATAFLLKGFKVHYL 128
           +RMNTL ++QASQGLA Y  ++FP N    VGHDHRF+S++FA  T+ AFL   FKV+ L
Sbjct: 68  SRMNTLTVLQASQGLAKYIAEKFPENKTVAVGHDHRFNSRDFAEVTSVAFLQLRFKVYSL 127

Query: 129 --NPDHE---FVHTPLVPFAVDKLKASVGVMVTASHNPKMDNGYKVYYSNGCQIIPPHDH 183
             N D +   FVHTP+VPFA+D+L AS GVM+TASHNPKMDNGYKVYYSNGCQIIPPHD 
Sbjct: 128 GFNADPKKDAFVHTPMVPFAIDRLGASAGVMITASHNPKMDNGYKVYYSNGCQIIPPHDR 187

Query: 184 AISDSIDMNLEPWANVWNFDDVLNKGLKQGKLMYSREEILKLYLGEVSKNLVGTDPLKFE 243
            I+ SI  NL PW   W+   V+ +  ++G  +  ++ ++  Y+ E+S  LV +D     
Sbjct: 188 LIAQSILDNLNPWERAWDCKAVIAEATEKGYFVDMKKPMVDHYVKEISDKLVSSD---IG 244

Query: 244 VKAKPWFVYTPMHGVGFDIFSTIVKKTMSLVEGKDYLCVPEQQEPDPSFPTVAFPNPEEK 303
            ++KPWFVYTP+HGVGF+IF  I  + + LVEG+DY CV E ++PDP+FPTV+FPNPEE 
Sbjct: 245 DRSKPWFVYTPLHGVGFEIFERIASEVLGLVEGRDYWCVSEHKQPDPAFPTVSFPNPEEA 304

Query: 304 GALDLGINLAENHGINLLIANDPDADRFSVAIKDIRSGEWRQLTGNEIGFLFAIFEFQKF 363
           GALDL I LA+ +GI+ ++ NDPDADRFS A+K    G+WRQLTGNEIGFLFA F ++K+
Sbjct: 305 GALDLAIALADKNGISFVLGNDPDADRFSAAVK--HQGKWRQLTGNEIGFLFAQFVWEKY 362

Query: 364 KSMEKQFQHAHPLAMLSSTVSSQMIKKMAEVEGFHYEETLTGFKWIGNRAILLEKEGYYV 423
           +    +F+  +PLA+++STVSSQMIKK+A VE FHYE+TLTGFKW+GNRA  LE  GYYV
Sbjct: 363 QKESSEFKLENPLALINSTVSSQMIKKLAGVEKFHYEDTLTGFKWLGNRARQLESSGYYV 422

Query: 424 PFGFEEAIGYMFPAMEHDKDGLSASIVFLQAYCQWKIDHNLDPISILEDGFKKYGVFKEY 483
           PF +EEAIG+MF  + HDKDG+SA++VFLQ    WK    L PI +L+  F KYGVFKEY
Sbjct: 423 PFAYEEAIGFMFSDIVHDKDGVSAAVVFLQMLWSWK-KQALSPIDVLQSAFGKYGVFKEY 481

Query: 484 NGYYIVSSPIVTNEIFDYIRNAYTPKGVSYPSSIGKEIEVLNYRDLTIGYQSDTSNHKPT 543
           NGYY V    +T+ IF  IR++Y     SYP  IG + +V+++ DLT G+QSDT+++ P 
Sbjct: 482 NGYYTVPDLSLTDRIFSDIRSSYD----SYPKHIGNQFDVVSFTDLTKGFQSDTADNTPR 537

Query: 544 LPIDPSSQMITVSAKPS-DGNEG---EHIRFTIRGSGTEPKIKVYIEACADEEQRATFLA 599
           LP+DPSSQMI  +  PS  G  G   E +RFT RGSGTEPK+KVYIEA + EE RA+ LA
Sbjct: 538 LPVDPSSQMIQATLVPSTSGGSGAPLEIVRFTARGSGTEPKLKVYIEATSVEETRASDLA 597

Query: 600 KLTWNVLKREWFRPEKMDIVTHF 622
           + TWNVL+ EWF+P++  + T F
Sbjct: 598 RTTWNVLRDEWFKPKETGLSTKF 620

>KLTH0C03872g Chr3 complement(337765..339630) [1866 bp, 621 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 621

 Score =  714 bits (1842), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/631 (55%), Positives = 451/631 (71%), Gaps = 20/631 (3%)

Query: 1   MSLQFLEAVPSNLKEAISLWFEQDQNPETIEEVTALCKKSDWNELHRRFDSRIQFGTAGL 60
           MSL   E VP +LK  +  W + D+N +T +++  L +   W EL  R + RI FGTAGL
Sbjct: 2   MSLTNAE-VPEDLKLGVEAWLKYDKNEQTRDQIIKLVEDKSWTELRNRLNFRITFGTAGL 60

Query: 61  RSQMQAGFNRMNTLVIIQASQGLATYAKQQFPNNLVAVVGHDHRFHSKEFARATATAFLL 120
           RS+M+AGFNRMNTL ++QASQGLA Y    FP+NL  VVGHDHRF+SK+FA  T  AFL 
Sbjct: 61  RSRMEAGFNRMNTLTVLQASQGLAKYIASNFPDNLSVVVGHDHRFNSKDFAEVTIVAFLQ 120

Query: 121 KGFKVHYLNPDHE-----FVHTPLVPFAVDKLKASVGVMVTASHNPKMDNGYKVYYSNGC 175
            GFKV+ L    +      VHTP+VPF +D L+AS G+M+TASHNPKMDNGYKVYYSNGC
Sbjct: 121 LGFKVYDLGFTEDASQDVVVHTPMVPFGIDHLRASGGIMITASHNPKMDNGYKVYYSNGC 180

Query: 176 QIIPPHDHAISDSIDMNLEPWANVWNFDDVLNKGLKQGKLMYSREEILKLYLGEVSKNLV 235
           QIIPPHD  IS SI  NLEPW   W+   V  + ++   L+ +++ ++  Y+  V ++LV
Sbjct: 181 QIIPPHDQRISQSILANLEPWDRAWDCAAVKAEAVQSEMLIDAKKVLVDQYVDTVRRSLV 240

Query: 236 GTDPLKFEVKAKPWFVYTPMHGVGFDIFSTIVKKTMSLVEGKDYLCVPEQQEPDPSFPTV 295
            T+         PWFVYTP+HGVGF+IF  I+     L +G+DYLCV EQ+ PDP+FPTV
Sbjct: 241 ITN---VNHTKAPWFVYTPLHGVGFEIFEKILSSAWRLGQGRDYLCVEEQKYPDPNFPTV 297

Query: 296 AFPNPEEKGALDLGINLAENHGINLLIANDPDADRFSVAIKDIRSGEWRQLTGNEIGFLF 355
           +FPNPEEKGALD  I LAE H I  ++ NDPDADRFSVA K   +G+WRQLTGNEIGFLF
Sbjct: 298 SFPNPEEKGALDKAIELAEKHDITFVLGNDPDADRFSVAAK--HNGQWRQLTGNEIGFLF 355

Query: 356 AIFEFQKFKSMEKQFQHAHPLAMLSSTVSSQMIKKMAEVEGFHYEETLTGFKWIGNRAIL 415
           A ++++ ++    +F+  +PLAM++STVSSQMIKKMAEVEGFHYE+TLTGFKW+GNRA  
Sbjct: 356 AQYKWETYRLESDKFKGTNPLAMINSTVSSQMIKKMAEVEGFHYEDTLTGFKWLGNRARE 415

Query: 416 LEKEGYYVPFGFEEAIGYMFPAMEHDKDGLSASIVFLQAYCQWKIDHNLDPISILEDGFK 475
           LE  GY+VPF +EEAIGYMF  + HDKDG+SA++VFLQ    WK    L P  +L+  ++
Sbjct: 416 LENAGYFVPFAYEEAIGYMFSDVVHDKDGISAAVVFLQMLWSWKA-QALTPFDVLQRAYQ 474

Query: 476 KYGVFKEYNGYYIVSSPIVTNEIFDYIRNAYTPKGVSYPSSIGKEIEVLNYRDLTIGYQS 535
           KYGVFKEYNGYYIV    +T+++F  IR+ ++ +    P+ IG+E  V +Y DLT GYQS
Sbjct: 475 KYGVFKEYNGYYIVPDLSLTDKVFSGIRSGFSLQ----PTHIGQEFRVESYTDLTTGYQS 530

Query: 536 DTSNHKPTLPIDPSSQMITVSAKP--SDGNEG--EHIRFTIRGSGTEPKIKVYIEACADE 591
           +T + +P LP+DPSSQMIT +  P  S G +G  E +RFT RGSGTEPK+KVYIEA +  
Sbjct: 531 NTPDSEPRLPVDPSSQMITATLTPTSSTGRQGFSESVRFTARGSGTEPKLKVYIEAVSSS 590

Query: 592 EQRATFLAKLTWNVLKREWFRPEKMDIVTHF 622
           E+ A+ LAK  W+VL+REWF+PE+  + T+F
Sbjct: 591 EELASALAKKAWDVLRREWFKPEQTGLATNF 621

>ABL126W Chr2 (159207..161081) [1875 bp, 624 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR278W
          Length = 624

 Score =  704 bits (1818), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/626 (55%), Positives = 440/626 (70%), Gaps = 17/626 (2%)

Query: 7   EAVPSNLKEAISLWFEQDQNPETIEEVTALCKKSDWNELHRRFDSRIQFGTAGLRSQMQA 66
           +AVPS+LK+++  W   D+N ET  E+  L     W+EL +R   RI FGTAGLR++M+A
Sbjct: 6   DAVPSSLKDSLMEWLTFDKNSETQHEICELVSNHQWDELRKRLLPRITFGTAGLRARMEA 65

Query: 67  GFNRMNTLVIIQASQGLATYAKQQFPNNLVAVVGHDHRFHSKEFARATATAFLLKGFKVH 126
           GF+RMNTL +IQASQGLA Y K QFP++L  V+GHDHRFHS+EFA AT  AFL   + ++
Sbjct: 66  GFSRMNTLTVIQASQGLARYIKSQFPDDLKVVIGHDHRFHSREFAEATIAAFLQLDYDIY 125

Query: 127 YLN------PDHEFVHTPLVPFAVDKLKA---SVGVMVTASHNPKMDNGYKVYYSNGCQI 177
           YLN       +  FVHTP+VPFA++ ++    S GVM+TASHNPKMDNGYKVYY+NGCQI
Sbjct: 126 YLNYVPPGSDEDVFVHTPMVPFAINNVEGGPTSCGVMITASHNPKMDNGYKVYYANGCQI 185

Query: 178 IPPHDHAISDSIDMNLEPWANVWNFDDVLNKGLKQGKLMYSREEILKLYLGEVSKNLVGT 237
           IPPHD  I   ID NLEPW   W+   ++ + +K GKL   R+E+L+ Y   +   LV  
Sbjct: 186 IPPHDELIGRHIDANLEPWTRAWDSKALIEEAIKSGKLHDVRKEMLQKYKDSIQTMLVKQ 245

Query: 238 DPLKFEVKAKPWFVYTPMHGVGFDIFSTIVKKTMSLVEGKDYLCVPEQQEPDPSFPTVAF 297
             LKF     PWFVYTPMHGVG++ F   V   + + E KDY+ VPEQ+ PDP FPTV+F
Sbjct: 246 SNLKF--AGGPWFVYTPMHGVGYEFFKEAVASVLGIEEDKDYIVVPEQKYPDPEFPTVSF 303

Query: 298 PNPEEKGALDLGINLAENHGINLLIANDPDADRFSVAIKDIRSGEWRQLTGNEIGFLFAI 357
           PNPEE+GALD+ + +A+ +GI +++ANDPDADRFSVA+K    GEW QLTGN+IG LFA 
Sbjct: 304 PNPEERGALDMAMKVADANGITVVLANDPDADRFSVAVK--YHGEWNQLTGNQIGILFAQ 361

Query: 358 FEFQKFKSMEKQFQHAHPLAMLSSTVSSQMIKKMAEVEGFHYEETLTGFKWIGNRAILLE 417
            E Q +    K  +    LAML+S VSSQ+++KMAE EGF   ETLTGFKW+GNRA  LE
Sbjct: 362 AEMQSYFKEPKLDRKQ--LAMLTSAVSSQLLRKMAEEEGFLAVETLTGFKWLGNRARELE 419

Query: 418 KEGYYVPFGFEEAIGYMFPAMEHDKDGLSASIVFLQAYCQWKIDHNLDPISILEDGFKKY 477
            EGYYVPF +EEAIGYMF  + HDKDG++A+ VFLQ   +WK         +L++ ++KY
Sbjct: 420 LEGYYVPFAYEEAIGYMFSQVVHDKDGIAAAAVFLQMCYEWKKVAK-SSQEVLQECYEKY 478

Query: 478 GVFKEYNGYYIVSSPIVTNEIFDYIRNAYTPKGVSYPSSIGKEIEVLNYRDLTIGYQSDT 537
           G F +YNGYYI S+P VT E+FDY RN YTP G  YPS IG E EV   RDLT+GYQSDT
Sbjct: 479 GYFVDYNGYYISSAPAVTKEVFDYFRNEYTPAGKPYPSHIGCEFEVEYLRDLTVGYQSDT 538

Query: 538 SNHKPTLPIDPSSQMITVSAKPSD-GNEGEHIRFTIRGSGTEPKIKVYIEACADEEQRAT 596
           + + P LP+D +SQMIT   KP     + E +RFT RGSGTEPK+KVYIE+CA   QRA+
Sbjct: 539 ATNIPDLPVDHNSQMITCVLKPVKMETDCESVRFTARGSGTEPKLKVYIESCAANHQRAS 598

Query: 597 FLAKLTWNVLKREWFRPEKMDIVTHF 622
            L+ L W+VLKREWFRP +  + T+F
Sbjct: 599 HLSHLAWDVLKREWFRPTETGLQTNF 624

>Ecym_4611 Chr4 (1191367..1193259) [1893 bp, 630 aa] {ON} similar to
           Ashbya gossypii ABL126W
          Length = 630

 Score =  703 bits (1814), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/628 (54%), Positives = 441/628 (70%), Gaps = 20/628 (3%)

Query: 7   EAVPSNLKEAISLWFEQDQNPETIEEVTALCKKSDWNELHRRFDSRIQFGTAGLRSQMQA 66
           E +P +L++ I  WF+ D+NP+T  E+ +L    +WNEL  R   RI FGTAGLR++M+A
Sbjct: 11  ELIPDDLRDKIDKWFKYDKNPQTTAEIRSLVDSQNWNELRGRLCQRISFGTAGLRARMEA 70

Query: 67  GFNRMNTLVIIQASQGLATYAKQQFPNNLVAVVGHDHRFHSKEFARATATAFLLKGFKVH 126
           GF RMNTL +IQASQGLATY K QFPNNL  VVGHDHR++SK FA     AFL  GF+V+
Sbjct: 71  GFARMNTLTVIQASQGLATYIKSQFPNNLKVVVGHDHRYNSKSFAEVAIAAFLQLGFEVY 130

Query: 127 YLN--PDHE----FVHTPLVPFAVDKLK--ASVGVMVTASHNPKMDNGYKVYYSNGCQII 178
           YLN  P ++    +VHTP+VPF V  ++  AS G+M+TASHNPKMDNGYKVYYSNGCQI 
Sbjct: 131 YLNYVPSNKDVESYVHTPMVPFTVSNIEGGASCGIMITASHNPKMDNGYKVYYSNGCQIT 190

Query: 179 PPHDHAISDSIDMNLEPWANVWNFDDVLNKGLKQGKLMYSREEILKLYLGEVSKNLVGTD 238
           PPHD  I+  ID NL PW   W+   ++       +L   ++E++K Y+  +  +LV T+
Sbjct: 191 PPHDKKIASEIDANLVPWDQAWDAQKLIEDARNNNRLHDVKQELIKNYVQRIQSSLVTTN 250

Query: 239 PLKFEVKAKPWFVYTPMHGVGFDIFSTIVKKTMSLVEGKDYLCVPEQQEPDPSFPTVAFP 298
            L      K WFVYTPMHGVG++IF+ IV  T+ L E + YL V  Q+ PDP F TV+FP
Sbjct: 251 SLA--DCGKNWFVYTPMHGVGYEIFNNIVTNTLHLKEDEHYLVVGAQKFPDPEFTTVSFP 308

Query: 299 NPEEKGALDLGINLAENHGINLLIANDPDADRFSVAIKDIRSGEWRQLTGNEIGFLFAIF 358
           NPEE+GAL+L I LA   G  L++ANDPDADRFS A+KD    +W+QLTGN++G+LFA+ 
Sbjct: 309 NPEEEGALNLAIELAARSGAELVLANDPDADRFSAAVKD--GNKWKQLTGNQLGYLFAVG 366

Query: 359 EFQKFKSMEKQFQHAHPLAMLSSTVSSQMIKKMAEVEGFHYEETLTGFKWIGNRAILLEK 418
           + +KF +   Q ++  PLAML STVSSQMI KMA+VEGF + ETLTGFKW+ NRAI LE 
Sbjct: 367 QLEKFSN---QNENKKPLAMLGSTVSSQMIAKMADVEGFTFVETLTGFKWLANRAIDLEN 423

Query: 419 EGYYVPFGFEEAIGYMFPAMEHDKDGLSASIVFLQAYCQWKIDHNLDPISILEDGFKKYG 478
           +G+YVPF +EEAIGYMF ++ HDKDG+SA+  FLQ   +WK +    P+ +L  G++KYG
Sbjct: 424 DGFYVPFAYEEAIGYMFSSVTHDKDGVSAATEFLQMAARWKKEGKT-PLDVLNAGYEKYG 482

Query: 479 VFKEYNGYYIVSSPIVTNEIFDYIRNAYTPKGVSYPSSIGKEIEVLNYRDLTIGYQSDTS 538
            F EYNGYY V    +  ++F YIRNA     V YPS+IG E  V ++RDLT+GYQSDT 
Sbjct: 483 NFVEYNGYYSVQDLSIIGDVFKYIRNACNGNDVPYPSTIGNEFAVASFRDLTVGYQSDTG 542

Query: 539 NHKPTLPIDPSSQMITVSAKP----SDGNEGEHIRFTIRGSGTEPKIKVYIEACADEEQR 594
           NH P LP+ P S MIT   KP    +     +++RFTIRGSGTEPK+KVYIE+ A +++ 
Sbjct: 543 NHIPNLPVSPGSHMITCVLKPLIKETAQTSSDYVRFTIRGSGTEPKLKVYIESNALDKEY 602

Query: 595 ATFLAKLTWNVLKREWFRPEKMDIVTHF 622
           AT LAKLTW+VLKREWFRPE   + T F
Sbjct: 603 ATKLAKLTWDVLKREWFRPEVTGLQTKF 630

>KLLA0D01573g Chr4 complement(139183..141006) [1824 bp, 607 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 607

 Score =  682 bits (1761), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/625 (54%), Positives = 440/625 (70%), Gaps = 29/625 (4%)

Query: 4   QFLEAVPSNLKEAISLWFEQDQNPETIEEVTALCKKSDWNELHRRFDSRIQFGTAGLRSQ 63
           + +E++PS+L+  +  W + D+  ET  E+  LC K D  ELH+R D+ I FGTAGLR +
Sbjct: 5   EVIESLPSDLQGKVRNWLKYDKVEETRNEILQLCLKGDITELHKRLDTMIAFGTAGLRGR 64

Query: 64  MQAGFNRMNTLVIIQASQGLATYAKQQFPNNLVAVVGHDHRFHSKEFARATATAFLLKGF 123
           M+AGFNRMN L + QASQGLA Y K+QFP NL  VVGHDHR +S+ F + T   FL  GF
Sbjct: 65  MEAGFNRMNALTVKQASQGLAKYIKKQFPENLTVVVGHDHRHNSRLFGKVTVDTFLQLGF 124

Query: 124 KVHYLNPDHE--FVHTPLVPFAVDKLKASVGVMVTASHNPKMDNGYKVYYSNGCQIIPPH 181
           KV +LN ++E   VHTPLVPF V+   ASVG+M+TASHNPKMDNGYKVYY+NGCQIIPPH
Sbjct: 125 KVFHLNHENEKSLVHTPLVPFTVNATGASVGIMITASHNPKMDNGYKVYYTNGCQIIPPH 184

Query: 182 DHAISDSIDMNLEPWANVWNFDDVLNKGLKQGKLMYSREEILKLYLGEVSKNLVGTDPLK 241
           D  I++SI  NLEP+++            + G ++  +E++ K Y+  +   L+  D   
Sbjct: 185 DKLIAESIIHNLEPFSSP-----------QTGTIIDCKEKMTKKYIDAIGSTLI--DGAV 231

Query: 242 FEVKAKPWFVYTPMHGVGFDIFSTIVKKTMSLVEGKDYLCVPEQQEPDPSFPTVAFPNPE 301
            +   +PWFVYTPMHGVGF+IF +I K+ +SL EGKDYL V EQ+ PD  FPTV+FPNPE
Sbjct: 232 NKKTNEPWFVYTPMHGVGFEIFESISKQLLSLEEGKDYLVVEEQKYPDADFPTVSFPNPE 291

Query: 302 EKGALDLGINLA-ENHGINLLIANDPDADRFSVAIKDI---RSGEWRQLTGNEIGFLFAI 357
           EKGALDL +    +N  ++L+IANDPDADRFSVA++D     +  WRQLTGNEIGFLFA 
Sbjct: 292 EKGALDLAVEYGRKNDTVDLIIANDPDADRFSVAVRDNDQNTTTAWRQLTGNEIGFLFAY 351

Query: 358 FEFQKFKSMEKQFQHAHPLAMLSSTVSSQMIKKMAEVEGFHYEETLTGFKWIGNRAILLE 417
           +E++++K          PLAML+STVSSQMIK+MAE+EGFHYE+TLTGFKW+GNRA+ LE
Sbjct: 352 YEWERYKHSPID----EPLAMLNSTVSSQMIKRMAEIEGFHYEDTLTGFKWLGNRALELE 407

Query: 418 KEGYYVPFGFEEAIGYMFPAMEHDKDGLSASIVFLQAYCQWKIDHNLDPISILEDGFKKY 477
           +EGYY PF +EEAIGYMF ++ HDKDG+SA+IVFLQAY +W+       + IL     KY
Sbjct: 408 QEGYYTPFAYEEAIGYMFSSVVHDKDGISAAIVFLQAYSKWRASGQT-VLDILATASLKY 466

Query: 478 GVFKEYNGYYIVSSPIVTNEIFDYIRNAYTPKGVSYPSSIGKEIEVLNYRDLTIGYQSDT 537
           G FKE+NGYYIV    +T ++FD IR+  +P    YP  +G   E++ +RDLT GYQSDT
Sbjct: 467 GHFKEFNGYYIVPDLAITKQVFDAIRSIESP----YPKKLGSSFEIIKFRDLTNGYQSDT 522

Query: 538 SNHKPTLPIDPSSQMITVSAKPSDGNEGEHIRFTIRGSGTEPKIKVYIEACADEEQRATF 597
            +H P L  DPSSQMIT      +      +RFTIRGSGTEPK+KVYIEA  + E  +  
Sbjct: 523 PDHIPELASDPSSQMITCEMLLVE-QPTSRVRFTIRGSGTEPKLKVYIEARTNTEPNSIA 581

Query: 598 LAKLTWNVLKREWFRPEKMDIVTHF 622
           LAK TW+VL++EWF+PE   ++T F
Sbjct: 582 LAKFTWDVLRQEWFKPELTGLLTPF 606

>KLTH0D04796g Chr4 (437416..439128) [1713 bp, 570 aa] {ON} highly
           similar to uniprot|P37012 Saccharomyces cerevisiae
           YMR105C PGM2 Phosphoglucomutase catalyzes the conversion
           from glucose-1-phosphate to glucose-6-phosphate which is
           a key step in hexose metabolism functions as the
           acceptor for a Glc-phosphotransferase and to YKL127W
           uniprot|P33401 Saccharomyces cerevisiae YKL127W PGM1
           Phosphoglucomutase, minor isoform; catalyzes the
           conversion from glucose-1-phosphate to glucose-6-
           phosphate, which is a key step in hexose metabolism
          Length = 570

 Score = 47.8 bits (112), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 131/565 (23%), Positives = 227/565 (40%), Gaps = 74/565 (13%)

Query: 56  GTAGLRSQMQAGFNRMN-TLVIIQASQGLATYAKQQFPNNLVAVVGHDHRFHSKEFARAT 114
           GT+GLR + +   N  + T   IQA         Q    + V VVG D R+++ E  +  
Sbjct: 19  GTSGLRKKTKVFMNEPHYTENFIQAIMEAIPEGSQ----DAVLVVGGDGRYYNNEVLQKI 74

Query: 115 ATAFLLKGFKVHYLNPDHEFVHTPLVPFAVDKL--KASVGVMVTASHN---PKMDNGYKV 169
                  G K   +   +  + TP     +     K++ G+++TASHN   P+ D G K 
Sbjct: 75  GEIGAANGVK-KLIVGQNGLLSTPAASHIIRSYPEKSTGGIILTASHNPGGPENDFGIKY 133

Query: 170 YYSNGCQIIPPHDHAISDSI---DMNLEPWANVWNFDDV----LNKGLKQGKLMYSREEI 222
             SNG     P   ++++SI      L  +  V NF  +    + K  + G L+    ++
Sbjct: 134 NLSNGG----PAPESVTNSIFEKSKQLASYKTVKNFPKINLSKIGKNQEYGSLLVDVIDV 189

Query: 223 LKLYLGEVSKNLVGTDPLKFEVKAKPWFVYTPMHGVGFDIFSTIVKKTMSLVEGKDYLCV 282
              Y+ ++ K +   D +K  +  +     T    + FD  + I       +   D L +
Sbjct: 190 TAEYV-KLMKEIFDFDLIKKFIDHQR---STKGFKILFDALNGITGPYGKAIFA-DELGL 244

Query: 283 PEQQ-----EPDPSFPTVAFPNPEEKGALDLGINLAENHGINLLIANDPDADRFSVAIKD 337
           P ++     EP P F  +  P+P    A  L +   +   I    A+D D DR  +    
Sbjct: 245 PAEEVLQNYEPKPDFGGL-HPDPNLTYAHTL-VERVDKEQIAFGAASDGDGDRNMI---- 298

Query: 338 IRSGEWRQLTGNEIGFLFAIFEFQKFKSMEKQFQHAHPLAMLSSTVSSQMIKKMAEVEGF 397
              G      G+ +  +       ++ S    F+      +  S  +S  I ++A+ +G 
Sbjct: 299 YGCGPAFVSPGDSVAII------AEYASEIPYFKKQGIYGLARSFPTSAAIDRVAKAQGL 352

Query: 398 HYEETLTGFKWIGNRAILLEKEGYYVPFGFEEAIGYMFPAMEHDKDGLSASIVFLQAYCQ 457
           +  E  TG+K+    A+   K+   +    EE+ G     +  +KDG+ A + +L     
Sbjct: 353 NCYEVPTGWKFFC--ALFDAKK---LSICGEESFGTGSNHV-REKDGVWAIVAWLNILAI 406

Query: 458 WKIDHNLDPISI---LEDGFKKYG--VFKEYNGYYIVSSPIVTNEIFDYIRNAYTPKGVS 512
           +  +H    +SI   L++ + KYG   F  Y+         V+ E    +        VS
Sbjct: 407 YNREHPDSDVSIKVVLDEFWAKYGRTFFTRYD------FEQVSGEAAAKVLRVLEDLVVS 460

Query: 513 YPSSIGKEIEVLNYRDLTIGYQSDTSNHKPTLPIDPSSQMITVSAKPSDGNEGEHIRFTI 572
             S+IGK +      DLT+   +D  +   T      S+   + AK S+G      RF +
Sbjct: 461 KESAIGKLLP--GNTDLTV---TDCGDFSYTDLDGSVSEHQGLYAKLSNG-----CRFVV 510

Query: 573 RGSGTEPK---IKVYIEACADEEQR 594
           R SGT      I++Y+E   D+  +
Sbjct: 511 RLSGTGSSGATIRLYLERYTDDASK 535

>KNAG0E02390 Chr5 (475467..477176) [1710 bp, 569 aa] {ON} Anc_2.445
           YKL127W
          Length = 569

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 132/578 (22%), Positives = 224/578 (38%), Gaps = 89/578 (15%)

Query: 56  GTAGLRSQMQAGFNRMN-TLVIIQASQGLATYAKQQFPNNLVAVVGHDHRFHSKEFARAT 114
           GT+GLR +     N  + T   IQA       A  +       VVG D R+++       
Sbjct: 19  GTSGLRKKTAVFTNEPHYTENFIQA----VMEAIPEGCKGATLVVGGDGRYYNDVILHKI 74

Query: 115 ATAFLLKGFKVHYLNPDHEFVHTPLVPFAVD--KLKASVGVMVTASHN---PKMDNGYKV 169
           A      G +   +   +  + TP     +   K K + G+++TASHN   PK D G K 
Sbjct: 75  AAIGAANGVRKLVIG-QNGLLSTPAASHIMRTYKEKCTGGIILTASHNPGGPKNDMGIKY 133

Query: 170 YYSNGCQIIPPHDHAISDSIDMNLEPWANVWNFD----DVLNKGLKQGKLMYSREEILKL 225
             SNG     P  + I + +   L+ +  + +      D L + ++ G L+    +  + 
Sbjct: 134 NLSNGGPAPEPVTNKIWE-VSKQLDHYKIIPDLPELALDTLAENVQYGPLLVDVVDTTRD 192

Query: 226 YLGEVSKNLVGTDPLKF----EVKAKPW-FVYTPMHGVGFDIFSTIVKKTMSLVEGKDYL 280
           Y+ E  K +     +K     +   K W  ++  M+GV       I      L   +   
Sbjct: 193 YV-EFLKEIFDFPLIKSFIHKQRSQKHWKLLFDGMNGVTGPYGKAIFVDEFELPAEE--- 248

Query: 281 CVPEQQEPDPSFPTVAFPNPEEKGALDLGINLAENHGINLLIANDPDADRFSVAIKDIRS 340
            V +   P P F  +  P+P    A  L ++  +   I    A+D D DR  +      +
Sbjct: 249 -VLQNWHPQPDFGGI-HPDPNLTYARSL-VDRVDRENIEFGAASDGDGDRNMI----YGA 301

Query: 341 GEWRQLTGNEIGFLFAIFEFQKFKSMEKQFQHAHPLAMLSSTVSSQMIKKMAEVEGFHYE 400
           G      G+ +  +       ++ +    F       +  S  ++  I ++AE  G    
Sbjct: 302 GPAFVSPGDSVAII------AEYAAEIPYFAKQGIYGLARSFPTASAIDRVAEKHGLKCY 355

Query: 401 ETLTGFKWIGNRAILLEKEGYYVPFGFEEAIGYMFPAMEHDKDGLSASIVFLQAYCQWKI 460
           E  TG+K+    A+   K+   +    EE+ G     +  +KDG+ A I +L     +  
Sbjct: 356 EVPTGWKFFC--ALFDAKK---LSICGEESFGTGSNHV-REKDGVWAIIAWLNLLAIYNR 409

Query: 461 DHNLDPIS---ILEDGFKKYG--VFKEYNGYYIVSSPIVTNEIFDYIRNAYTPKGVSYPS 515
            H    +S   I E+ +KKYG   F  Y+  ++ S+     ++ D +R +YT K    P 
Sbjct: 410 RHPDRDVSIKIIQEEFWKKYGRVFFTRYDYEHVDSNS--AKKVIDNLR-SYTEK----PG 462

Query: 516 SIGKEIEVLNYRDLTIGYQSDTSNHKPTLPIDPSSQMITVSAKPSDGNEGEH-------- 567
            +G +            + +DT     TL +  S      S K  DG+  EH        
Sbjct: 463 VVGSK------------FPTDT-----TLTVTESGDF---SYKDLDGSVSEHQGLYVRLS 502

Query: 568 --IRFTIRGSGTEPK---IKVYIEACADEEQRATFLAK 600
              RF +R SGT      I++Y+E   D+E +    A+
Sbjct: 503 NGARFVVRLSGTGSSGATIRLYLEKYCDDESKYGLTAE 540

>CAGL0B03597g Chr2 complement(359018..360640) [1623 bp, 540 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058w PCM1 phosphoacetylglucosamine mutase
          Length = 540

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 17/30 (56%), Positives = 22/30 (73%)

Query: 149 ASVGVMVTASHNPKMDNGYKVYYSNGCQII 178
           A VGVM+TASHNP  DNG K+  S+G  ++
Sbjct: 52  APVGVMITASHNPPRDNGVKIVESDGSMLL 81

>NCAS0F00200 Chr6 complement(30474..32123) [1650 bp, 549 aa] {ON}
           Anc_6.11 YEL058W
          Length = 549

 Score = 40.0 bits (92), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 20/28 (71%)

Query: 151 VGVMVTASHNPKMDNGYKVYYSNGCQII 178
           VGVMVTASHNP +DNG KV    G  +I
Sbjct: 60  VGVMVTASHNPPLDNGVKVVEPTGAMLI 87

>TBLA0G00980 Chr7 complement(248484..250160) [1677 bp, 558 aa] {ON}
           Anc_6.11 YEL058W
          Length = 558

 Score = 39.7 bits (91), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 17/28 (60%), Positives = 21/28 (75%)

Query: 150 SVGVMVTASHNPKMDNGYKVYYSNGCQI 177
           +VGVMVTASHNP +DNG K+   NG  +
Sbjct: 61  AVGVMVTASHNPPVDNGVKIVEPNGSML 88

>NDAI0K02890 Chr11 (655311..656996) [1686 bp, 561 aa] {ON} Anc_6.11
           YEL058W
          Length = 561

 Score = 39.3 bits (90), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 22/30 (73%)

Query: 149 ASVGVMVTASHNPKMDNGYKVYYSNGCQII 178
           +++GVMVTASHNP  DNG K+   NG  ++
Sbjct: 66  SAIGVMVTASHNPPEDNGVKIIEPNGSMLL 95

>TDEL0G04600 Chr7 (838381..839967) [1587 bp, 528 aa] {ON} Anc_6.11
           YEL058W
          Length = 528

 Score = 38.5 bits (88), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 17/28 (60%), Positives = 20/28 (71%)

Query: 151 VGVMVTASHNPKMDNGYKVYYSNGCQII 178
           VGVM+TASHNP  DNG KV   +G  +I
Sbjct: 57  VGVMITASHNPSGDNGVKVVEPDGSMLI 84

>KAFR0L00340 Chr12 complement(62157..63779) [1623 bp, 540 aa] {ON}
           Anc_6.11 YEL058W
          Length = 540

 Score = 38.1 bits (87), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 23/37 (62%)

Query: 151 VGVMVTASHNPKMDNGYKVYYSNGCQIIPPHDHAISD 187
           +GVM+TASHNP  DNG K+   +G  +I   +   +D
Sbjct: 59  IGVMITASHNPPQDNGVKIVEPSGAMLIESWEQIATD 95

>KAFR0D03010 Chr4 (594118..595827) [1710 bp, 569 aa] {ON} Anc_2.445
           YKL127W
          Length = 569

 Score = 38.1 bits (87), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 117/516 (22%), Positives = 200/516 (38%), Gaps = 74/516 (14%)

Query: 98  VVGHDHRFHSKEFARATATAFLLKGFKVHYLNPDHEFVHTPLVPFAVDKL--KASVGVMV 155
           VVG D R+++       A      G K   +   +  + TP     +     K + G+++
Sbjct: 58  VVGGDGRYYNDVILEKIAKIGAANGVKKLVVG-QNGLLSTPAASHIIRSYHEKVTGGIIL 116

Query: 156 TASHN---PKMDNGYKVYYSNGCQIIPPHDHAISDSIDMNLEPWANVWNFDDV------- 205
           TASHN   PK D G K   +NG     P   +++D I  N +   +     D+       
Sbjct: 117 TASHNPGGPKNDMGIKYNLANGG----PAPESVTDKIWENSKKLTSYKIIKDLPTLDTSK 172

Query: 206 LNKGLKQGKLMYSREEILKLYLGEVSKNLVGTDPLK----FEVKAKPW-FVYTPMHGVGF 260
           + +  K G ++    ++ K Y+ E  K +   + +K     + K K W  ++  ++G+  
Sbjct: 173 IGENQKYGPILIDVIDVTKAYV-EFLKEIFDFELIKKFIHTQRKTKNWKLLFDGLNGITG 231

Query: 261 DIFSTIVKKTMSLVEGKDYLCVPEQQEPDPSFPTVAFPNPEEKGALDLGINLAENHGINL 320
                I      L E +    V +   P P F  +  P+P    A  L ++  +   I  
Sbjct: 232 PYGKAIFVDEFELPENE----VLQNYHPQPDFGGL-HPDPNLTYARSL-VDRVDKEKIEF 285

Query: 321 LIANDPDADRFSVAIKDIRSGEWRQLTGNEIGFLFAIFEFQKFKSMEKQFQHAHPLAMLS 380
             A+D D DR  +       G      G+ +  +       ++ S    F       +  
Sbjct: 286 GAASDGDGDRNMI----YGYGPAFVSPGDSVAII------AEYASEIPYFAKQGIYGLAR 335

Query: 381 STVSSQMIKKMAEVEGFHYEETLTGFKWIGNRAILLEKEGYYVPFGFEEAIGYMFPAMEH 440
           S  +S  I ++A+  G    E  TG+K+    A+   K+   +    EE+ G     +  
Sbjct: 336 SFPTSAAIDRVAKAHGLECYEVPTGWKFFC--ALFDAKK---LSICGEESFGTGSNHV-R 389

Query: 441 DKDGLSASIVFLQAYCQWKIDHNLDPISI--LEDGF-KKYG--VFKEYNGYYIVSSPI-- 493
           +KDGL A + +L     +   H     SI  ++D F  KYG   F  Y+  ++ S     
Sbjct: 390 EKDGLWAIVAWLNVLAIFNKHHPEREASIKTIQDDFWLKYGRTFFTRYDYEHVTSEDANK 449

Query: 494 VTNEIFDYIRNAYTPKGVSYPSSIGKEIEVLNYRDLTIGYQSDTSNHKPTLPIDPSSQMI 553
           V + + ++  N+ T K   +P              LT+   +D  N   T      S   
Sbjct: 450 VVDLLTEFTSNSKT-KNAPFPGD----------ESLTV---TDCGNFSYTDLDGSVSSKQ 495

Query: 554 TVSAKPSDGNEGEHIRFTIRGSGTEPK---IKVYIE 586
            +S K SDG+     RF +R SGT      I++Y+E
Sbjct: 496 GLSVKLSDGS-----RFVLRLSGTGSSGATIRLYVE 526

>NCAS0F01470 Chr6 complement(293218..294927) [1710 bp, 569 aa] {ON}
           Anc_2.445 YKL127W
          Length = 569

 Score = 38.1 bits (87), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 105/441 (23%), Positives = 172/441 (39%), Gaps = 47/441 (10%)

Query: 56  GTAGLRSQMQAGFNRMN-TLVIIQASQGLATYAKQQFPNNLVAVVGHDHRFHSKEFARAT 114
           GT+GLR + +   +  N T   IQA       A  +       VVG D R+++       
Sbjct: 19  GTSGLRKKTKIFKDTPNYTENFIQAIMD----AIPEGSKGATLVVGGDGRYYNDVILHKI 74

Query: 115 ATAFLLKGFKVHYLNPDHEFVHTPLVPFAVDKL--KASVGVMVTASHNP---KMDNGYKV 169
           A      G K   +      + TP     +     K   G+++TASHNP   K D G K 
Sbjct: 75  AAIGAANGVKKLVIG-QRGLLSTPAASHIMRTYEEKTQGGIILTASHNPGGIKNDMGIKF 133

Query: 170 YYSNGCQIIPPHDHAISDSIDMNLEPWANVWNFDDV----LNKGLKQGKLMYSREEILKL 225
             SNG     P  + I + I   +  +  + +F ++    L K  K G L+    +  K 
Sbjct: 134 NLSNGGPAPEPVTNKIWE-ISKKMTSFKIIKDFPELELETLGKNKKYGPLLVDVIDTTKA 192

Query: 226 YLGEVSKNLVGTDPLKFEV----KAKPW-FVYTPMHGVGFDIFSTIVKKTMSLVEGKDYL 280
           Y+ E  K +   D +K  V      K W  ++  M+GV       I    + L   +   
Sbjct: 193 YV-EFVKQIFDFDLIKKFVHKQRDTKHWKLLFDGMNGVTGPYGKAIFVDELGLPADE--- 248

Query: 281 CVPEQQEPDPSFPTVAFPNPEEKGALDLGINLAENHGINLLIANDPDADRFSVAIKDIRS 340
            V +Q  P P F  V  P+P    A  L ++  +   I    A+D D DR  +      +
Sbjct: 249 -VLQQWHPSPDFGGV-HPDPNLTYAKAL-VDRVDRENIEFGAASDGDGDRNMI----YGA 301

Query: 341 GEWRQLTGNEIGFLFAIFEFQKFKSMEKQFQHAHPLAMLSSTVSSQMIKKMAEVEGFHYE 400
           G      G+ +  +       ++ +    F       +  S  +S  I ++A+  G +  
Sbjct: 302 GPAFVSPGDSVAII------AEYAAEIPYFAKQGIYGLARSFPTSSAIDRVAKAHGLNCY 355

Query: 401 ETLTGFKWIGNRAILLEKEGYYVPFGFEEAIGYMFPAMEHDKDGLSASIVFLQAYCQWKI 460
           E  TG+K+    A+   K+   +    EE+ G     +  +KDG+ A + +L     +  
Sbjct: 356 EVPTGWKFFC--ALFDAKK---LSICGEESFGTGSNHV-REKDGIWAILAWLNLLAIYNK 409

Query: 461 DHNLDPIS--ILEDGF-KKYG 478
            H    +S  I++D F  KYG
Sbjct: 410 HHPDRDVSIKIIQDEFWNKYG 430

>Kpol_1032.2 s1032 complement(1049..2668) [1620 bp, 539 aa] {ON}
           complement(1049..2668) [1620 nt, 540 aa]
          Length = 539

 Score = 38.1 bits (87), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 20/28 (71%)

Query: 150 SVGVMVTASHNPKMDNGYKVYYSNGCQI 177
           +VGVM+TASHNP  DNG K+   NG  +
Sbjct: 53  AVGVMITASHNPPEDNGVKIVEPNGAML 80

>Smik_13.291 Chr13 complement(460399..462108) [1710 bp, 569 aa] {ON}
           YKL127W (REAL)
          Length = 569

 Score = 37.7 bits (86), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 130/565 (23%), Positives = 219/565 (38%), Gaps = 76/565 (13%)

Query: 56  GTAGLRSQMQAGFNRMN-TLVIIQASQGLATYAKQQFPNNLVAVVGHDHRFHSKEFARAT 114
           GT+GLR + +   ++ N T   IQ+       A  +       VVG D R+++       
Sbjct: 19  GTSGLRKKTKVFKDQPNYTENFIQS----IMEAIPEGSKGATLVVGGDGRYYNDVILHKI 74

Query: 115 ATAFLLKGFKVHYLNPDHEFVHTPLVPFAVDKL--KASVGVMVTASHN---PKMDNGYKV 169
           A      G K   +   H  + TP     +     K + G+++TASHN   P+ D G K 
Sbjct: 75  AAIGAANGVKKLVIG-QHGLLSTPAASHIMRTYEEKCTGGIILTASHNPGGPENDMGIKY 133

Query: 170 YYSNGCQIIPPHDHAISDSIDMNLEPWANVWNFDDV----LNKGLKQGKLMYSREEILKL 225
             SNG        + I D I   L  +  + +F ++    + K  K G L+    +I K 
Sbjct: 134 NLSNGGPAPESVTNVIWD-ISKKLTSYKIIKDFPELDLATIGKNKKYGPLLVDIIDITKD 192

Query: 226 Y---LGEVSKNLVGTDPLKFEVKAKPW-FVYTPMHGVGFDIFSTIVKKTMSLVEGKDYLC 281
           Y   L E+    +    +  +   K W  ++  M+GV       I      L   +    
Sbjct: 193 YVDFLKEIFDFKLIKKFIDNQRSTKNWKLLFDSMNGVTGPYGKAIFVDEFGLPADE---- 248

Query: 282 VPEQQEPDPSFPTVAFPNPEEKGALDLGINLAENHGINLLIANDPDADRFSVAIKDIRSG 341
           V +   P P F  +  P+P    A  L +   +   I    A+D D DR  +       G
Sbjct: 249 VLQNWHPSPDFGGM-HPDPNLTYASTL-VKRVDREKIEFGAASDGDGDRNMI----YGYG 302

Query: 342 EWRQLTGNEIGFLFAIFEFQKFKSMEKQFQHAHPLAMLSSTVSSQMIKKMAEVEGFHYEE 401
                 G+ +  +       ++ +    F       +  S  +S  I ++A+  G +  E
Sbjct: 303 PSFVSPGDSVAII------AEYAAEIPYFAKQGIYGLARSFPTSAAIDRVAKAHGLNCYE 356

Query: 402 TLTGFKWIGNRAILLEKEGYYVPFGFEEAIGYMFPAMEHDKDGLSASIVFLQAYCQWKID 461
             TG+K+    A+   K+   +    EE+ G     +  +KDG+ A + +L     +   
Sbjct: 357 VPTGWKFFC--ALFDAKK---LSICGEESFGTGSNHV-REKDGVWAIMAWLNILAIYNKH 410

Query: 462 H--NLDPISILEDGF-KKYG--VFKEYNGYYIVSSPIVTNEIFDYIRNAYTPKGV---SY 513
           H  N   I  +++ F  KYG   F  Y+   + S     N+I D ++   T  GV   ++
Sbjct: 411 HPENEASIKTIQNEFWAKYGRTFFTRYDFEKVESQK--ANKIVDQLKAYVTKSGVVSSAF 468

Query: 514 PSSIGKEIEVLNYRDLT-IGYQSDTSNHKPTLPIDPSSQMITVSAKPSDGNEGEHIRFTI 572
           P+   + ++V +  D +        S+H+             +  K S+G      RF +
Sbjct: 469 PAD--ESLKVTDCGDFSYTDLDGSVSDHQ------------GLYVKLSNG-----ARFVL 509

Query: 573 RGSGTEPK---IKVYIEA-CADEEQ 593
           R SGT      I++YIE  C DE Q
Sbjct: 510 RLSGTGSSGATIRLYIEKYCDDESQ 534

>Suva_13.282 Chr13 complement(457565..459274) [1710 bp, 569 aa] {ON}
           YKL127W (REAL)
          Length = 569

 Score = 37.7 bits (86), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 121/522 (23%), Positives = 204/522 (39%), Gaps = 71/522 (13%)

Query: 98  VVGHDHRFHSKEFARATATAFLLKGFKVHYLNPDHEFVHTPLVPFAVDKL--KASVGVMV 155
           VVG D R+++       A      G K   +   H  + TP     +     K + G+++
Sbjct: 58  VVGGDGRYYNDVILHKIAAISAANGVKKLVIG-QHGLLSTPAASHIMRTYEDKCTGGIIL 116

Query: 156 TASHN---PKMDNGYKVYYSNGCQIIPPHDHAISDSIDMNLEPWANVWNFDDV----LNK 208
           TASHN   P+ D G K   SNG        +AI + I   L  +  V +F ++    + K
Sbjct: 117 TASHNPGGPENDMGIKYNLSNGGPAPESVTNAIWE-ISKKLTSYKIVKDFPELDLQTIGK 175

Query: 209 GLKQGKLMYSREEILKLYLGEVSKNLVGTDPLK----FEVKAKPW-FVYTPMHGVGFDIF 263
             K G L+    ++ K Y+ E+ + +   + +K     +   K W  ++  M+GV     
Sbjct: 176 DRKYGPLLIDIIDVTKAYV-ELMEEIFDFNLIKKFIDNQRSTKNWKLLFDSMNGVTGPYG 234

Query: 264 STIVKKTMSLVEGKDYLCVPEQQEPDPSFPTVAFPNPEEKGALDLGINLAENHGINLLIA 323
             I      L   +    V +   P P F  +  P+P    A  L +   +   I    A
Sbjct: 235 KAIFVDKFGLPAEE----VLQNWHPSPDFGGM-HPDPNLTYASSL-VKRVDREQIEFGAA 288

Query: 324 NDPDADRFSVAIKDIRSGEWRQLTGNEIGFLFAIFEFQKFKSMEKQFQHAHPLAMLSSTV 383
           +D D DR  +       G      G+ +  +       ++ +    F       +  S  
Sbjct: 289 SDGDGDRNMI----YGYGPSFVSPGDSVAII------AEYAAEIPYFAKQGIYGLARSFP 338

Query: 384 SSQMIKKMAEVEGFHYEETLTGFKWIGNRAILLEKEGYYVPFGFEEAIGYMFPAMEHDKD 443
           +S  I ++A+  G +  E  TG+K+    A+   K+   +    EE+ G     +  +KD
Sbjct: 339 TSAAIDRVAKAHGLNCYEVPTGWKFFC--ALFDAKK---LSICGEESFGTGSNHV-REKD 392

Query: 444 GLSASIVFLQAYCQWKIDHNLDPISI--LEDGF-KKYG--VFKEYNGYYIVSSPIVTNEI 498
           G+ A + +L     +   H     SI  ++D F  KYG   F  Y+   + S     NEI
Sbjct: 393 GVWAIMAWLNILAIYNKHHPEKEASIKTIQDEFWAKYGRTFFTRYDFEKVESEK--ANEI 450

Query: 499 FDYIRNAYT--PKGVSYPSSIGKEIEVLNYRDLT-IGYQSDTSNHKPTLPIDPSSQMITV 555
            D +  A+T  P  +  P    + +++ +  D +        SNH+             +
Sbjct: 451 VDQL-GAFTSKPGVIGSPFPTDESVKITDCGDFSYTDLDGSVSNHQ------------GL 497

Query: 556 SAKPSDGNEGEHIRFTIRGSGTEPK---IKVYIEA-CADEEQ 593
             K S+G      RF +R SGT      I++YIE  C D+ Q
Sbjct: 498 YVKLSNG-----ARFVLRLSGTGSSGATIRLYIEKYCDDKSQ 534

>ZYRO0F00506g Chr6 complement(49579..51231) [1653 bp, 550 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 550

 Score = 37.7 bits (86), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 16/24 (66%), Positives = 19/24 (79%)

Query: 151 VGVMVTASHNPKMDNGYKVYYSNG 174
           +GVMVTASHNP +DNG KV   +G
Sbjct: 59  IGVMVTASHNPPVDNGVKVVEPDG 82

>Skud_13.263 Chr13 complement(451194..452903) [1710 bp, 569 aa] {ON}
           YKL127W (REAL)
          Length = 569

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 130/566 (22%), Positives = 222/566 (39%), Gaps = 78/566 (13%)

Query: 56  GTAGLRSQMQAGFNRMN-TLVIIQASQGLATYAKQQFPNNLVAVVGHDHRFHSKEFARAT 114
           GT+GLR + +   ++ N T   IQ+       A  +       VVG D R+++       
Sbjct: 19  GTSGLRKKTKVFKDQPNYTENFIQS----IMEAIPEGSKGATLVVGGDGRYYNDVILNKI 74

Query: 115 ATAFLLKGFKVHYLNPDHEFVHTPLVPFAVDKLK--ASVGVMVTASHN---PKMDNGYKV 169
           A      G K   +   +  + TP     +   +   + G+++TASHN   P+ D G K 
Sbjct: 75  AAIGSANGIKKLVIG-QYGLLSTPAASHIMRTYEEECTGGIILTASHNPGGPENDMGIKY 133

Query: 170 YYSNGCQIIPPHDHAISDSIDMNLEPWANVWNFDDV----LNKGLKQGKLMYSREEILKL 225
             SNG        +AI D I   L  +  V +F ++    + K  K G L+    +I K 
Sbjct: 134 NLSNGGPAPESVTNAIWD-ISKKLTNYKIVKDFPELDLKTIGKNKKYGPLLIDVIDITKA 192

Query: 226 YLGEVSKNLVGTDPLK----FEVKAKPW-FVYTPMHGVGFDIFSTIVKKTMSLVEGKDYL 280
           Y+ +  K +   D +K     +   K W  ++  M+GV       I      L   +   
Sbjct: 193 YV-DFLKKIFDFDLIKKFIDNQRSTKNWKLLFDSMNGVTGPYGKAIFVDEFGLPAEE--- 248

Query: 281 CVPEQQEPDPSFPTVAFPNPEEKGALDLGINLAENHGINLLIANDPDADRFSVAIKDIRS 340
            V +   P P F  +  P+P    A  L +   +   I    A+D D DR  +       
Sbjct: 249 -VLQNWHPSPDFGGM-HPDPNLTYASSL-VKRVDREKIEFGAASDGDGDRNMI----YGY 301

Query: 341 GEWRQLTGNEIGFLFAIFEFQKFKSMEKQFQHAHPLAMLSSTVSSQMIKKMAEVEGFHYE 400
           G      G+ +  +       ++ +    F       +  S  +S  I ++A+  G +  
Sbjct: 302 GPSFVSPGDSVAII------AEYAAEIPYFAKQGIYGLARSFPTSAAIDRVAKAHGLNCY 355

Query: 401 ETLTGFKWIGNRAILLEKEGYYVPFGFEEAIGYMFPAMEHDKDGLSASIVFLQAYCQWKI 460
           E  TG+K+    A+   K+   +    EE+ G     +  +KDG+ A + +L     +  
Sbjct: 356 EVPTGWKFFC--ALFDAKK---LSICGEESFGTGSNHV-REKDGVWAVMAWLNILAIYNK 409

Query: 461 DH--NLDPISILEDGF-KKYG--VFKEYNGYYIVSSPIVTNEIFDYIRNAYTPKGV---S 512
            H  N   I  +++ F  KYG   F  Y+   + S     N+I D +R   T  GV   +
Sbjct: 410 HHPENEASIKTIQNEFWAKYGRTFFTRYDFEKVESEK--ANKIVDQLRAYVTKSGVINSA 467

Query: 513 YPSSIGKEIEVLNYRDLT-IGYQSDTSNHKPTLPIDPSSQMITVSAKPSDGNEGEHIRFT 571
           +P+   + ++V +  D +        S+H+             +  K S+G      RF 
Sbjct: 468 FPAD--ESLKVTDCGDFSYTDLDGSVSDHQ------------GLYVKLSNG-----ARFV 508

Query: 572 IRGSGTEPK---IKVYIEA-CADEEQ 593
           +R SGT      I++Y+E  C D+ Q
Sbjct: 509 LRLSGTGSSGATIRLYVEKYCDDKSQ 534

>Smik_5.29 Chr5 (45538..47205) [1668 bp, 555 aa] {ON} YEL058W (REAL)
          Length = 555

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 20/28 (71%)

Query: 151 VGVMVTASHNPKMDNGYKVYYSNGCQII 178
           VGVM+TASHNP  DNG K+   +G  ++
Sbjct: 60  VGVMITASHNPYQDNGVKIVEPDGSMLL 87

>YEL058W Chr5 (43252..44925) [1674 bp, 557 aa] {ON}  PCM1Essential
           N-acetylglucosamine-phosphate mutase; converts
           GlcNAc-6-P to GlcNAc-1-P, which is a precursor for the
           biosynthesis of chitin and for the formation of
           N-glycosylated mannoproteins and
           glycosylphosphatidylinositol anchors
          Length = 557

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 20/28 (71%)

Query: 151 VGVMVTASHNPKMDNGYKVYYSNGCQII 178
           VGVM+TASHNP  DNG K+   +G  ++
Sbjct: 60  VGVMITASHNPYQDNGVKIVEPDGSMLL 87

>TDEL0E00210 Chr5 (28244..29956) [1713 bp, 570 aa] {ON} Anc_2.445
           YKL127W
          Length = 570

 Score = 37.4 bits (85), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 72/293 (24%), Positives = 119/293 (40%), Gaps = 31/293 (10%)

Query: 56  GTAGLRSQMQAGFNRMN-TLVIIQASQGLATYAKQQFPNNLVAVVGHDHRFHSKEFARAT 114
           GT+GLR +     N ++ T   IQ+       A  +   + + VVG D R+++ +  +  
Sbjct: 17  GTSGLRKKTAVFMNNVHYTENFIQS----ILDAIPESSKDAILVVGGDGRYYNDKILQII 72

Query: 115 ATAFLLKGFKVHYLNPDHEFVHTPLVPFAV------DKLKASVGVMVTASHN---PKMDN 165
           A      G +   +   H  + TP     +      D  K + G+++TASHN   P+ D 
Sbjct: 73  AAISAANGVRKLVIG-QHGLLSTPAASHIIRSYQDKDGKKVTGGIILTASHNPGGPENDI 131

Query: 166 GYKVYYSNGCQIIPPHDHAISDSIDMNLEPWANVWNFDDV--LNKGLKQ-GKLMYSREEI 222
           G K   SNG        +AI D I   L  +  V  F ++    KG K  G L+    + 
Sbjct: 132 GIKYNLSNGGPAPESVTNAIWD-ISKKLTHYKIVKGFPEINLSVKGEKSYGSLVIDVVDT 190

Query: 223 LKLYLGEVSKNLVGTDPLK----FEVKAKPW-FVYTPMHGVGFDIFSTIVKKTMSLVEGK 277
            + Y+ +  K +   D +K     +   K W  ++  ++GV       I    + L E +
Sbjct: 191 TQEYV-DFLKGIFDFDLIKKFVDTQRSTKNWKLLFDGLNGVTGPYGRAIFVDELGLPENE 249

Query: 278 DYLCVPEQQEPDPSFPTVAFPNPEEKGALDLGINLAENHGINLLIANDPDADR 330
               V +   P P F  +  P+P    A  L ++  +   I    A+D D DR
Sbjct: 250 ----VLQNCHPKPDFGGI-HPDPNLTYARTL-VDRVDKEKIEFGAASDGDGDR 296

>Skud_5.31 Chr5 (42262..43935) [1674 bp, 557 aa] {ON} YEL058W (REAL)
          Length = 557

 Score = 37.4 bits (85), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 20/28 (71%)

Query: 151 VGVMVTASHNPKMDNGYKVYYSNGCQII 178
           VGVM+TASHNP  DNG K+   +G  ++
Sbjct: 60  VGVMITASHNPYQDNGVKIVEPDGSMLL 87

>YMR105C Chr13 complement(475897..477606) [1710 bp, 569 aa] {ON}
           PGM2Phosphoglucomutase, catalyzes the conversion from
           glucose-1-phosphate to glucose-6-phosphate, which is a
           key step in hexose metabolism; functions as the acceptor
           for a Glc-phosphotransferase
          Length = 569

 Score = 37.4 bits (85), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 130/566 (22%), Positives = 221/566 (39%), Gaps = 78/566 (13%)

Query: 56  GTAGLRSQMQAGFNRMN-TLVIIQASQGLATYAKQQFPNNLVAVVGHDHRFHSKEFARAT 114
           GT+GLR + +   +  N T   IQ+       A  +       VVG D R+++       
Sbjct: 19  GTSGLRKKTKVFKDEPNYTENFIQS----IMEAIPEGSKGATLVVGGDGRYYNDVILHKI 74

Query: 115 ATAFLLKGFKVHYLNPDHEFVHTPLVPFAVDKL--KASVGVMVTASHN---PKMDNGYKV 169
           A      G K   +   H  + TP     +     K + G+++TASHN   P+ D G K 
Sbjct: 75  AAIGAANGIKKLVIG-QHGLLSTPAASHIMRTYEEKCTGGIILTASHNPGGPENDMGIKY 133

Query: 170 YYSNGCQIIPPHDHAISDSIDMNLEPWANVWNFDDV----LNKGLKQGKLMYSREEILKL 225
             SNG        +AI + I   L  +  + +F ++    + K  K G L+    +I K 
Sbjct: 134 NLSNGGPAPESVTNAIWE-ISKKLTSYKIIKDFPELDLGTIGKNKKYGPLLVDIIDITKD 192

Query: 226 YLGEVSKNLVGTDPLK----FEVKAKPW-FVYTPMHGVGFDIFSTIVKKTMSLVEGKDYL 280
           Y+  + K +   D +K     +   K W  ++  M+GV       I      L   +   
Sbjct: 193 YVNFL-KEIFDFDLIKKFIDNQRSTKNWKLLFDSMNGVTGPYGKAIFVDEFGLPADE--- 248

Query: 281 CVPEQQEPDPSFPTVAFPNPEEKGALDLGINLAENHGINLLIANDPDADRFSVAIKDIRS 340
            V +   P P F  +  P+P    A  L +   +   I    A+D D DR  +       
Sbjct: 249 -VLQNWHPSPDFGGM-HPDPNLTYASSL-VKRVDREKIEFGAASDGDGDRNMI----YGY 301

Query: 341 GEWRQLTGNEIGFLFAIFEFQKFKSMEKQFQHAHPLAMLSSTVSSQMIKKMAEVEGFHYE 400
           G      G+ +  +       ++ +    F       +  S  +S  I ++A+  G +  
Sbjct: 302 GPSFVSPGDSVAII------AEYAAEIPYFAKQGIYGLARSFPTSGAIDRVAKAHGLNCY 355

Query: 401 ETLTGFKWIGNRAILLEKEGYYVPFGFEEAIGYMFPAMEHDKDGLSASIVFLQAYCQWKI 460
           E  TG+K+    A+   K+   +    EE+ G     +  +KDG+ A + +L     +  
Sbjct: 356 EVPTGWKFFC--ALFDAKK---LSICGEESFGTGSNHV-REKDGVWAIMAWLNILAIYNK 409

Query: 461 DH--NLDPISILEDGF-KKYG--VFKEYNGYYIVSSPIVTNEIFDYIRNAYTPKGV---S 512
            H  N   I  +++ F  KYG   F  Y+   + +     N+I D +R   T  GV   +
Sbjct: 410 HHPENEASIKTIQNEFWAKYGRTFFTRYDFEKVETEK--ANKIVDQLRAYVTKSGVVNSA 467

Query: 513 YPSSIGKEIEVLNYRDLT-IGYQSDTSNHKPTLPIDPSSQMITVSAKPSDGNEGEHIRFT 571
           +P+   + ++V +  D +        S+H+             +  K S+G      RF 
Sbjct: 468 FPAD--ESLKVTDCGDFSYTDLDGSVSDHQ------------GLYVKLSNG-----ARFV 508

Query: 572 IRGSGTEPK---IKVYIEA-CADEEQ 593
           +R SGT      I++YIE  C D+ Q
Sbjct: 509 LRLSGTGSSGATIRLYIEKYCDDKSQ 534

>Suva_5.10 Chr5 (19280..20941) [1662 bp, 553 aa] {ON} YEL058W (REAL)
          Length = 553

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 20/28 (71%)

Query: 151 VGVMVTASHNPKMDNGYKVYYSNGCQII 178
           VGVM+TASHNP  DNG K+   +G  ++
Sbjct: 60  VGVMITASHNPYQDNGVKIVEPDGSMLL 87

>KNAG0E00940 Chr5 (176887..178503) [1617 bp, 538 aa] {ON} Anc_6.11
           YEL058W
          Length = 538

 Score = 37.0 bits (84), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 17/21 (80%), Positives = 17/21 (80%)

Query: 149 ASVGVMVTASHNPKMDNGYKV 169
           A VGVMVTASHNP  DNG KV
Sbjct: 56  AQVGVMVTASHNPPEDNGVKV 76

>TBLA0B09010 Chr2 complement(2135961..2137670) [1710 bp, 569 aa]
           {ON} Anc_2.445 YKL127W
          Length = 569

 Score = 37.0 bits (84), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 40/140 (28%), Positives = 58/140 (41%), Gaps = 15/140 (10%)

Query: 56  GTAGLRSQMQAGFNRMN-TLVIIQASQGLATYAKQQFPNNLVAVVGHDHRFHSKEFARAT 114
           GT+GLR + +   +  N T   IQA       A  +   +   VVG D RF++       
Sbjct: 19  GTSGLRKKTKVFMDEPNYTENFIQAIMD----AIPEGSKDATLVVGGDGRFYNDVIMNKI 74

Query: 115 ATAFLLKGFKVHYLNPDHEFVHTPLVPFAVDKLKASV--GVMVTASHN---PKMDNGYKV 169
           A      G K   +   +  + TP     +   K  V  G+++TASHN   P  D G K 
Sbjct: 75  AAIGAANGVKKLIIG-QNGILSTPAASHIIRTYKDKVTGGIILTASHNPGGPTNDLGIKY 133

Query: 170 YYSNGCQIIPPHDHAISDSI 189
              NG     P   A++D+I
Sbjct: 134 NLGNGA----PAPEAVTDAI 149

>NDAI0H02350 Chr8 complement(571624..573333) [1710 bp, 569 aa] {ON}
           Anc_2.445 YKL127W
          Length = 569

 Score = 36.6 bits (83), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 107/469 (22%), Positives = 186/469 (39%), Gaps = 53/469 (11%)

Query: 56  GTAGLRSQMQAGFNRMN-TLVIIQASQGLATYAKQQFPNNLVAVVGHDHRFHSKEFARAT 114
           GT+GLR + +   ++ + T   IQA       A  +       VVG D R+++       
Sbjct: 19  GTSGLRKKTRVFKDKPHYTENFIQAIMD----AIPEGAKGATLVVGGDGRYYNDVILHKI 74

Query: 115 ATAFLLKGFKVHYLNPDHEFVHTPLVPFAVDKL--KASVGVMVTASHNP---KMDNGYKV 169
           A      G K   +   H  + TP     +     K + G+++TASHNP   + D G K 
Sbjct: 75  AAIGAANGVKKLVVG-QHGLLSTPAASHIMRTYEEKTTGGIILTASHNPGGLENDMGIKY 133

Query: 170 YYSNGCQIIPPHDHAISDSIDMNLEPWANVWNFDDV----LNKGLKQGKLMYSREEILKL 225
             SNG     P  + I + I   +  +  + +F ++    L K  K G L+    +I K 
Sbjct: 134 NLSNGGPAPEPVTNKIWE-ISKKMTHYKIIKDFPELELETLGKNKKYGPLLVDVIDITKA 192

Query: 226 YLGEVSKNLVGTDPLK----FEVKAKPW-FVYTPMHGVGFDIFSTIVKKTMSLVEGKDYL 280
           Y+ +  K +   + +K     + + K W  ++  M+GV       I      L   +   
Sbjct: 193 YV-DFLKEIFDFELIKKFIHNQREKKHWKLLFDGMNGVTGPYGKAIFVDEFGLPADE--- 248

Query: 281 CVPEQQEPDPSFPTVAFPNPEEKGALDLGINLAENHGINLLIANDPDADRFSVAIKDIRS 340
            V +Q  P P F  V  P+P    A  L ++      I    A+D D DR  +      +
Sbjct: 249 -VLQQWHPQPDFGGV-HPDPNLTYAKAL-VDRVNREKIEFGAASDGDGDRNMI----YGA 301

Query: 341 GEWRQLTGNEIGFLFAIFEFQKFKSMEKQFQHAHPLAMLSSTVSSQMIKKMAEVEGFHYE 400
           G      G+ +  +       ++ S    F+      +  S  ++  I ++A+  G +  
Sbjct: 302 GPAFVSPGDSVAII------AEYASEIPYFKKQGIYGLARSFPTASSIDRVAKAHGLNCY 355

Query: 401 ETLTGFKWIGNRAILLEKEGYYVPFGFEEAIGYMFPAMEHDKDGLSASIVFLQAYCQWKI 460
           +  TG+K+      L +     +    EE+ G     +  +KDGL A I +L     +  
Sbjct: 356 QVPTGWKFF---CALFDAN--KLSICGEESFGTGSNHVR-EKDGLWAIIAWLNVLAIYN- 408

Query: 461 DHNLD---PISILEDGF-KKYG--VFKEYNGYYIVSSPIVTNEIFDYIR 503
            HN +    I I++D F  KYG   F  Y+  ++ +      ++ D +R
Sbjct: 409 KHNPEKDVSIKIIQDEFWNKYGRTFFTRYDYEHVTTE--AAGKVIDQLR 455

>ZYRO0G02508g Chr7 (192411..194120) [1710 bp, 569 aa] {ON} highly
           similar to uniprot|P37012 Saccharomyces cerevisiae
           YMR105C PGM2 Phosphoglucomutase catalyzes the conversion
           from glucose-1-phosphate to glucose-6-phosphate which is
           a key step in hexose metabolism functions as the
           acceptor for a Glc-phosphotransferase and to YKL127W
           uniprot|P33401 Saccharomyces cerevisiae YKL127W PGM1
           Phosphoglucomutase, minor isoform; catalyzes the
           conversion from glucose-1-phosphate to glucose-6-
           phosphate, which is a key step in hexose metabolism
          Length = 569

 Score = 35.8 bits (81), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 140/604 (23%), Positives = 239/604 (39%), Gaps = 105/604 (17%)

Query: 56  GTAGLRSQMQAGFNRMN-TLVIIQASQGLATYAKQQFPNNLVAVVGHDHRFHSKEFARAT 114
           GT+GLR + +      N T   IQA       A  +   + V +VG D R+++    +  
Sbjct: 19  GTSGLRKRTKVFAEEPNYTENFIQA----ILEAIPEGVKDSVLLVGGDGRYYNDVVLQKI 74

Query: 115 ATAFLLKGFKVHYLNPDHEFVHTPLVPFAV---DKLKASVGVMVTASHNPKMDN---GYK 168
           A      G K   +   +  + TP     +    K K + G+++TASHNP   N   G K
Sbjct: 75  AAIGAANGVK-RLVVGQNGILSTPAASHVIRSYSKAKVTGGIILTASHNPGGPNNDFGIK 133

Query: 169 VYYSNGCQIIPPHDHAISDSI---DMNLEPWANVWNFD--DVLNKGLKQ-GKLMYSREEI 222
              +NG     P    +++++      L  +  V +F   D+   G KQ G L     + 
Sbjct: 134 YNLANGG----PAPENVTNAMWEASKRLTSYKIVTDFPHVDLSALGEKQYGSLTVDVIDS 189

Query: 223 LKLYLGEVSKNLVGTDPLKFEV----KAKPW-FVYTPMHGVGFDIFSTIVKKTMSLVEGK 277
            K Y+ +  K +     +K  V    + K W  ++  ++GV       I    + L E +
Sbjct: 190 TKAYV-DFLKTIFDFPLIKSFVNHQRETKNWKLLFDGLNGVTGPYGRAIFADELGLPEDE 248

Query: 278 DYLCVPEQQEPDPSFPTVAFPNPEEKGALDLGINLAENHGINLLIANDPDADRFSVAIKD 337
               V +   P P F  +  P+P    A  L ++  +   I    A+D D DR  +    
Sbjct: 249 ----VLQNCHPKPDFGGL-HPDPNLTYARTL-VDRVDRENIAFGAASDGDGDRNMI---- 298

Query: 338 IRSGEWRQLTGNEIGFLFAIFEFQKFKSMEKQFQHAHPLAMLSSTVSSQMIKKMAEVEGF 397
             +G      G+ +  +       ++ S    FQ      +  S  +SQ I  +A+    
Sbjct: 299 YGAGPAFVSPGDSVAII------AEYASEIPYFQREGIYGLARSFPTSQAIDLVAKHHNL 352

Query: 398 HYEETLTGFKWIGNRAILLEKEGYYVPFGFEEAIGYMFPAMEHDKDGLSASIVFLQAYCQ 457
              E  TG+K+    A+   K+   +    EE+ G     +  +KDGL A I +L     
Sbjct: 353 SCYEVPTGWKFFC--ALFDAKK---LSICGEESFGTGSNHI-REKDGLWAIIAWLNILA- 405

Query: 458 WKIDHNLDP-----ISILEDGF-KKYG--VFKEYNGYYIVSSPIVTNEIFDYIRNAYTP- 508
             I H  +P     I  ++D F  KYG   F  Y+  Y   S    N + ++ +N  +  
Sbjct: 406 --IYHKRNPEKDVSIKTIQDEFWDKYGRTFFTRYD--YENVSGEAANRVIEFFQNFVSQP 461

Query: 509 --KGVSYPSSIGKEIEVLN-----YRDLTIGYQSDTSNHKPTLPIDPSSQMITVSAKPSD 561
             KG ++P  + + ++V++     Y+DL     S +SN    L             K S+
Sbjct: 462 GVKGSNFP--LDESLKVVDAGDFEYKDLD---GSVSSNQGLFL-------------KLSN 503

Query: 562 GNEGEHIRFTIRGSGT---EPKIKVYIEACADEEQRATFLAKLTWNVLKREWFRPEKMDI 618
           G     +R  +R SGT      I++Y+E  +D+  +        + +   E+ RP    +
Sbjct: 504 G-----VRTVLRLSGTGSAGATIRLYVEQYSDDASK--------YGLTAEEFLRPAIQQL 550

Query: 619 VTHF 622
           V+ F
Sbjct: 551 VSFF 554

>KLLA0D00858g Chr4 complement(80327..81952) [1626 bp, 541 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 541

 Score = 35.4 bits (80), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 15/19 (78%), Positives = 16/19 (84%)

Query: 151 VGVMVTASHNPKMDNGYKV 169
           VGVM+TASHNP  DNG KV
Sbjct: 54  VGVMITASHNPPEDNGVKV 72

>SAKL0E00902g Chr5 complement(68682..70316) [1635 bp, 544 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 544

 Score = 35.4 bits (80), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 14/19 (73%), Positives = 16/19 (84%)

Query: 151 VGVMVTASHNPKMDNGYKV 169
           VGVM+TASHNP  DNG K+
Sbjct: 58  VGVMITASHNPPQDNGVKI 76

>Kwal_56.22355 s56 complement(62955..64580) [1626 bp, 541 aa] {ON}
           YEL058W (PCM1) - Phosphoacetylglucosamine Mutase [contig
           186] FULL
          Length = 541

 Score = 35.4 bits (80), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 18/25 (72%)

Query: 150 SVGVMVTASHNPKMDNGYKVYYSNG 174
           +VGVM+TASHNP  DNG K+    G
Sbjct: 57  TVGVMITASHNPPEDNGVKIVDPKG 81

>KLTH0C11506g Chr3 (944869..946503) [1635 bp, 544 aa] {ON} similar
           to uniprot|P38628 Saccharomyces cerevisiae YEL058W PCM1
           Essential N-acetylglucosamine- phosphate mutase a
           hexosephosphate mutase involved in the biosynthesis of
           chitin
          Length = 544

 Score = 35.4 bits (80), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 14/20 (70%), Positives = 17/20 (85%)

Query: 150 SVGVMVTASHNPKMDNGYKV 169
           +VGVM+TASHNP  DNG K+
Sbjct: 57  TVGVMITASHNPPEDNGVKI 76

>TDEL0A02210 Chr1 (400375..402093) [1719 bp, 572 aa] {ON} Anc_2.445
           YKL127W
          Length = 572

 Score = 34.7 bits (78), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 125/541 (23%), Positives = 214/541 (39%), Gaps = 75/541 (13%)

Query: 98  VVGHDHRFHSKEFARATATAFLLKGFKVHYLNPDHEFVHTPLVPFAV----DKL--KASV 151
           VVG D R+++ +  +  A+     G     +   H  + TP     +    DK   K + 
Sbjct: 58  VVGGDGRYYNDKILQIIASISAANGVGKLVIG-QHGLLSTPAASHIIRTYQDKSGKKVTG 116

Query: 152 GVMVTASHN---PKMDNGYKVYYSNGCQIIPPHDHAISDSIDMNLEPWANVWNFD--DVL 206
           G+++TASHN   P  D G K   SNG        +AI + I   L  +  + N    D+ 
Sbjct: 117 GIILTASHNPGGPDNDIGIKYNLSNGGPAPESVTNAIWE-ISKKLTSYKIIKNLPQLDLS 175

Query: 207 NKGLKQ-GKLMYSREEILKLYLGEVSKNLVGTDPLK----FEVKAKPW-FVYTPMHGVGF 260
            KG K+ G L     ++ + Y+ E  K +   D +K     +   K W  ++  ++GV  
Sbjct: 176 TKGEKKLGNLEIDVVDVTQAYV-EFLKEIFDFDLIKKFVDTQRSTKHWKLLFDGLNGVTG 234

Query: 261 DIFSTIVKKTMSLVEGKDYLCVPEQQEPDPSFPTVAFPNPEEKGALDLGINLAENHGINL 320
                I    + L E +    V +   P P F  +  P+P    A  L +   +   I  
Sbjct: 235 PYGKAIFVDELGLPENE----VLQNCHPKPDFGGI-HPDPNLTYARTL-VERVDKEKIEF 288

Query: 321 LIANDPDADRFSVAIKDIRSGEWRQLTGNEIGFLFAIFEFQKFKSMEKQFQHAHPLAMLS 380
             A+D D DR  +       G      G+ +  +       ++      F       +  
Sbjct: 289 GAASDGDGDRNMI----YGYGPAFVSPGDSVAII------AEYAKEIPYFAKQGIYGLAR 338

Query: 381 STVSSQMIKKMAEVEGFHYEETLTGFKWIGNRAILLEKEGYYVPFGFEEAIGYMFPAMEH 440
           S  +S  I ++A  +G +  E  TG+K+    A+   K+   +    EE+ G     +  
Sbjct: 339 SFPTSSAIDRVAAEQGLNCYEVPTGWKFFC--ALFDAKK---LSICGEESFGTGSNHV-R 392

Query: 441 DKDGLSASIVFLQAYCQWKIDHNLDPISI--LEDGF-KKYG--VFKEYNGYYIVSSPIVT 495
           +KDG+ A I +L     +   H     SI  ++D F  KYG   F  Y+  ++ +     
Sbjct: 393 EKDGVWAIIAWLNILAIYNKHHPQKEASIKTIQDEFWLKYGRTFFTRYDFEHVTTEK--A 450

Query: 496 NEIFDYIRNAYTPKGVSYPSSIGKEIEVLNYRDLTIGYQSDTSNHKPTLPIDPSSQMITV 555
           NEI  ++ +      V+ P+ +G +    N   +T+    D         +  S+Q + V
Sbjct: 451 NEIVKHLDSF-----VNSPNVVGSKFPSDN--SVTVAEAGDFQYTDLDGSVS-SNQGLYV 502

Query: 556 SAKPSDGNEGEHIRFTIRGSGTEPK---IKVYIEACADEEQRATFLAKLTWNVLKREWFR 612
             K S G      RF +R SGT      I++YIE  +D++ +        + +   E+ R
Sbjct: 503 --KLSSG-----ARFVLRLSGTGSSGATIRLYIEKYSDDKTK--------YGLTAEEYLR 547

Query: 613 P 613
           P
Sbjct: 548 P 548

>ACR015W Chr3 (383130..384788) [1659 bp, 552 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL058W (PCM1)
          Length = 552

 Score = 34.7 bits (78), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 16/26 (61%), Positives = 19/26 (73%)

Query: 149 ASVGVMVTASHNPKMDNGYKVYYSNG 174
           A VGVM+TASHNP  DNG K+   +G
Sbjct: 56  AYVGVMLTASHNPPEDNGVKLVDPHG 81

>TPHA0M00210 Chr13 complement(42336..43973) [1638 bp, 545 aa] {ON}
           Anc_6.11 YEL058W
          Length = 545

 Score = 34.7 bits (78), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 38/80 (47%), Gaps = 22/80 (27%)

Query: 150 SVGVMVTASHNPKMDNGYKVYYSNGCQIIPPHDHAISDSIDMNLEPWANVWNFDDVLNKG 209
           +VGVM+TASHN   DNG K+   +G              +D + EP+A      ++ NK 
Sbjct: 57  AVGVMITASHNQPCDNGVKIVEPDGSM------------LDQSWEPFAT-----ELANK- 98

Query: 210 LKQGKLMYSREEILKLYLGE 229
                  +S +E  KLYL E
Sbjct: 99  ---ASFCHSTQE-FKLYLQE 114

>KLLA0B12694g Chr2 (1107696..1109402) [1707 bp, 568 aa] {ON} highly
           similar to uniprot|P37012 Saccharomyces cerevisiae
           YMR105C PGM2 Phosphoglucomutase catalyzes the conversion
           from glucose-1-phosphate to glucose-6-phosphate which is
           a key step in hexose metabolism functions as the
           acceptor for a Glc-phosphotransferase and to YKL127W
           uniprot|P33401 Saccharomyces cerevisiae YKL127W PGM1
           Phosphoglucomutase, minor isoform; catalyzes the
           conversion from glucose-1-phosphate to glucose-6-
           phosphate, which is a key step in hexose metabolism
          Length = 568

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 121/548 (22%), Positives = 220/548 (40%), Gaps = 82/548 (14%)

Query: 98  VVGHDHRFHSKEFARATATAFLLKGFKVHYLNPDHEFVHTPLVPFAVDKL--KASVGVMV 155
           V+G D R+++    +  A      G +   +   +  + TP     +     K + G+++
Sbjct: 58  VIGGDGRYYNDVVIQKIAAIGSANGVRKIVIG-HNGILSTPAASHIIRAYHEKCTGGIIL 116

Query: 156 TASHN---PKMDNGYKVYYSNGCQIIPPHDHAISDSI---DMNLEPWANVWNFDDV---- 205
           TASHN   P  D G K   +NG     P   ++++SI      L  +  V +F  +    
Sbjct: 117 TASHNPGGPTNDFGIKYNLANGG----PAPESVTNSIWHKSRELTHYKIVESFPAIDLTK 172

Query: 206 LNKGLKQGKLMYSREEILKLYLGEVSKNLVGTDPLK--FEVKAKPWF--VYTPMHGVGFD 261
           + +  K G L+    +    Y+ E+ K +     +K   + +AK  F  ++  M+GV   
Sbjct: 173 IGQDQKYGDLLVDIVDSTAAYV-ELMKEIFDFPLIKSFIDTQAKNGFKILFDAMNGVTGP 231

Query: 262 IFSTIVKKTMSLVEGKDYLCVPEQQEPDPSFPTVAFPNPEEKGALDLGINLAENHGINLL 321
               +  K + L E        +   P P F  +  P+P    A  L +   + +GI   
Sbjct: 232 YGEALFVKELGLPESS-----LQNYHPKPDFGGL-HPDPNLTYAHTL-VERVDKYGIQFG 284

Query: 322 IANDPDADRFSVAIKDIRSGEWRQLTGNEIGFLFAIFEFQKFKSMEKQFQHAHPLAMLSS 381
            A+D D DR  +      +G      G+ +  +       ++ S    F+      +  S
Sbjct: 285 AASDGDGDRNMI----YGAGPAFVSPGDSVAII------AEYASAIPYFKKQGIYGLARS 334

Query: 382 TVSSQMIKKMAEVEGFHYEETLTGFKWIGNRAILLEKEGYYVPFGFEEAIGYMFPAMEHD 441
             +S  I ++A+ +G +  E  TG+K+    A+   K+   +    EE+ G     +  +
Sbjct: 335 FPTSSAIDRVAKEQGLNCYEVPTGWKFF--CALFDAKK---LSICGEESFGTGSNHV-RE 388

Query: 442 KDGLSASIVFLQ---AYCQWKIDHNLDPISILEDGFKKYG--VFKEYNGYYIVSSPIVTN 496
           KDG+ A + +L     Y Q   +      SI  D ++KYG   F  Y+ +  +SS     
Sbjct: 389 KDGVWAIMAWLNILAIYNQRFPNKEASIKSIQTDFWQKYGRTFFTRYD-FENLSSEDAGK 447

Query: 497 EIF---DYIRNAYTPKGVSYPSSIGKEIEVLNYRDLT-IGYQSDTSNHKPTLPIDPSSQM 552
            I    +Y+ +  + KG  +P+     + V+   D +        S+H+           
Sbjct: 448 VILLLQNYVADPESIKGTKFPAD--DSLTVVEGGDFSYTDLDGSVSSHQ----------- 494

Query: 553 ITVSAKPSDGNEGEHIRFTIRGSGTEPK---IKVYIEACADE----EQRA-TFLAKLTWN 604
             +  + S+G     +RF +R SGT      I++Y+E   ++    EQ A  FL K    
Sbjct: 495 -GLYVRLSNG-----VRFVVRLSGTGSSGATIRLYVERYTNDGSKYEQTAEEFLGKDIKT 548

Query: 605 VLKREWFR 612
           +LK   F+
Sbjct: 549 ILKFLKFK 556

>CAGL0K07480g Chr11 complement(740462..742165) [1704 bp, 567 aa]
           {ON} highly similar to uniprot|P37012 Saccharomyces
           cerevisiae YMR105c PGM2 phosphoglucomutase
          Length = 567

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 54/125 (43%), Gaps = 11/125 (8%)

Query: 56  GTAGLRSQMQAGFNRMN-TLVIIQASQGLATYAKQQFPNNLVAVVGHDHRFHSKEFARAT 114
           GT+GLR + +      N T   IQA       A  +   + V VVG D RF++    +  
Sbjct: 17  GTSGLRKKTKVFMEEPNYTENFIQAIMD----AIPEGAKDAVLVVGGDGRFYNDVIMQKI 72

Query: 115 ATAFLLKGFKVHYLNPDHEFVHTPLVPFAVDKL--KASVGVMVTASHN---PKMDNGYKV 169
           A      G +   +   +  + TP     +     K + G+++TASHN   P+ D G K 
Sbjct: 73  AAIGAANGVRKLIIG-QNGLLSTPAASHVIRSYAEKCTGGIILTASHNPGGPENDLGIKY 131

Query: 170 YYSNG 174
             +NG
Sbjct: 132 NLANG 136

>Kwal_26.7628 s26 (449302..451014) [1713 bp, 570 aa] {ON} YMR105C
           (PGM2) - Phosphoglucomutase [contig 55] FULL
          Length = 570

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 119/526 (22%), Positives = 209/526 (39%), Gaps = 69/526 (13%)

Query: 94  NLVAVVGHDHRFHSKEFARATATAFLLKGFKVHYLNPDHEFVHTPLVPFAVDKL--KASV 151
           N   VVG D R+++ E  +         G +   L   +  + TP     +     K + 
Sbjct: 54  NATLVVGGDGRYYNNEVMQIIGAIAAANGVRKMILG-QNGILSTPAASHIIRSYPEKCTG 112

Query: 152 GVMVTASHN---PKMDNGYKVYYSNGCQIIPPHDHAISDSI---DMNLEPWANVWNFDDV 205
           G+++TASHN   P+ D G K   SNG     P   +++++I      L  +  V NF  +
Sbjct: 113 GIILTASHNPGGPENDFGIKYNLSNGG----PAPESVTNAIFEKSKQLTHYKIVKNFPKI 168

Query: 206 ----LNKGLKQGKLMYSREEILKLYLGEVSKNLVGTDPLKFEV---KAKPWF--VYTPMH 256
               + K  K G L+    +    Y+  + K +   D +K  +   ++   F  ++  ++
Sbjct: 169 DFSKIGKDQKYGPLLVDVVDSTADYVA-LMKEIFDFDLIKKFIDNQRSTKGFKILFDSLN 227

Query: 257 GVGFDIFSTIVKKTMSLVEGKDYLCVPEQQEPDPSFPTVAFPNPEEKGALDLGINLAENH 316
           GV       I  K + L   +    V +   P P F  +  P+P    A  L +   +  
Sbjct: 228 GVTGPYGEAIFVKELGLPAEE----VLQNYVPKPDFGGL-HPDPNLTYAHTL-VERVDKE 281

Query: 317 GINLLIANDPDADRFSVAIKDIRSGEWRQLTGNEIGFLFAIFEFQKFKSMEKQFQHAHPL 376
            I    A+D D DR  +       G      G+ +  +       ++ S    F+     
Sbjct: 282 QIAFGAASDGDGDRNMI----YGCGPAFVSPGDSVAII------AEYASEIPYFKKQGIY 331

Query: 377 AMLSSTVSSQMIKKMAEVEGFHYEETLTGFKWIGNRAILLEKEGYYVPFGFEEAIGYMFP 436
            +  S  +S  I ++A+ +G    E  TG+K+    A+   K+   +    EE+ G    
Sbjct: 332 GLARSFPTSAAIDRVAKEQGLACYEVPTGWKFFC--ALFDAKK---LSICGEESFGTGSN 386

Query: 437 AMEHDKDGLSASIVFLQAYCQWKIDHNLDPISI--LEDGF-KKYG--VFKEYNGYYIVSS 491
            +  +KDG+ A + +L     +  DH    +SI  +++ F  KYG   F  Y+ +  VSS
Sbjct: 387 HV-REKDGVWAIVAWLNILAIYNRDHPDSDVSIKVIQEKFWAKYGRTFFTRYD-FEQVSS 444

Query: 492 PIVTNEIFDYIRNAYTPKGVSYPSSIGKEIEVLNYRDLTIGYQSDTSNHKPTLPIDPSSQ 551
                ++   + +    K     SS+GK         LT+   +D  +   T      S+
Sbjct: 445 ESAA-QVLQVLEDLVAAK----DSSVGKPFA--GNPALTV---ADCGDFSYTDLDGSVSE 494

Query: 552 MITVSAKPSDGNEGEHIRFTIRGSGTEPK---IKVYIEACADEEQR 594
              + AK S+G      RF +R SGT      I++Y+E   D+  +
Sbjct: 495 HQGLYAKLSNG-----CRFVVRLSGTGSSGATIRLYVEKYTDDASK 535

>NCAS0A04350 Chr1 (878688..880397) [1710 bp, 569 aa] {ON} Anc_2.445
           YKL127W
          Length = 569

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 36/125 (28%), Positives = 51/125 (40%), Gaps = 11/125 (8%)

Query: 56  GTAGLRSQMQAGFNRMN-TLVIIQASQGLATYAKQQFPNNLVAVVGHDHRFHSKEFARAT 114
           GT+GLR +     N  N T   IQA         Q    +   VVG D RF++       
Sbjct: 19  GTSGLRKKTAIFMNEPNYTENFIQAMLDAIPEGSQ----DATLVVGGDGRFYNDVIMNKI 74

Query: 115 ATAFLLKGFKVHYLNPDHEFVHTPLVPFAVDKL--KASVGVMVTASHN---PKMDNGYKV 169
           A      G K   +   +  + TP     +     K + G+++TASHN   P+ D G K 
Sbjct: 75  AAISAANGVKKLIIG-QNGLLSTPAASHIIRSYEEKVTGGIILTASHNPGGPENDLGIKY 133

Query: 170 YYSNG 174
             +NG
Sbjct: 134 NLANG 138

>SAKL0E03630g Chr5 complement(294321..296036) [1716 bp, 571 aa] {ON}
           highly similar to uniprot|P37012 Saccharomyces
           cerevisiae YMR105C PGM2 Phosphoglucomutase catalyzes the
           conversion from glucose-1-phosphate to
           glucose-6-phosphate which is a key step in hexose
           metabolism functions as the acceptor for a
           Glc-phosphotransferase and to YKL127W uniprot|P33401
           Saccharomyces cerevisiae YKL127W PGM1
           Phosphoglucomutase, minor isoform; catalyzes the
           conversion from glucose-1-phosphate to glucose-6-
           phosphate, which is a key step in hexose metabolism
          Length = 571

 Score = 33.5 bits (75), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 49/170 (28%), Positives = 69/170 (40%), Gaps = 23/170 (13%)

Query: 56  GTAGLRSQMQAGFNRMN-TLVIIQASQGLATYAKQQFPNNLVAVVGHDHRFHSKEFARAT 114
           GT+GLR + +      N T   IQA         Q    +   VVG D RF++    +  
Sbjct: 19  GTSGLRKKTKVFMEEPNYTENFIQAVMDAIPEGSQ----DATLVVGGDGRFYNDVVVQKI 74

Query: 115 ATAFLLKGFKVHYLN-PDHEFVHTPLVPFAVDK---LKASVGVMVTASHNP---KMDNGY 167
           A      G  VH L    +  + TP     +      K + G+++TASHNP   K D G 
Sbjct: 75  AAIGAANG--VHKLVIGQNGILSTPAASHIIRTYPHAKITGGIILTASHNPGGAKNDFGI 132

Query: 168 KVYYSNGCQIIPPHDHAISDSI---DMNLEPWANVWNFD--DVLNKGLKQ 212
           K   SNG     P   ++++ I      L  +  V NF   D+  KG  Q
Sbjct: 133 KYNLSNGG----PAPESVTNKIFEKSKQLTSYKIVANFPQLDLSKKGTDQ 178

>Suva_11.98 Chr11 (189966..191678) [1713 bp, 570 aa] {ON} YMR105C
           (REAL)
          Length = 570

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 58/141 (41%), Gaps = 16/141 (11%)

Query: 56  GTAGLRSQMQAGFNRMN-TLVIIQASQGLATYAKQQFPNNLVAVVGHDHRFHSKEFARAT 114
           GT+GLR + +   N  + T   IQA          + P+    VVG D RF++       
Sbjct: 19  GTSGLRKKTKVFMNEPHYTENFIQAMMECI----PEGPSGATLVVGGDGRFYNDVIMNKI 74

Query: 115 ATAFLLKGFKVHYLNPDHEFVHTPLVPFAVDKLKASV---GVMVTASHN---PKMDNGYK 168
           A      G K   +      + TP     +   + +    G+++TASHN   P+ D G K
Sbjct: 75  AAVGAANGIKKLVIG-QAGLLSTPAASHIIRTYEDNCNGGGIILTASHNPGGPENDLGIK 133

Query: 169 VYYSNGCQIIPPHDHAISDSI 189
               NG     P   +++D+I
Sbjct: 134 YNLPNGG----PAPESVTDAI 150

>Ecym_3014 Chr3 complement(28261..29916) [1656 bp, 551 aa] {ON}
           similar to Ashbya gossypii ACR015W
          Length = 551

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 13/19 (68%), Positives = 15/19 (78%)

Query: 151 VGVMVTASHNPKMDNGYKV 169
           VG M+TASHNP  DNG K+
Sbjct: 58  VGAMITASHNPPQDNGVKL 76

>CAGL0K03421g Chr11 complement(314680..316386) [1707 bp, 568 aa]
           {ON} highly similar to uniprot|P37012 Saccharomyces
           cerevisiae YMR105c Phosphoglucomutase 2
          Length = 568

 Score = 32.7 bits (73), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 35/126 (27%), Positives = 56/126 (44%), Gaps = 13/126 (10%)

Query: 56  GTAGLRSQMQAGFNRMNTL--VIIQASQGLATYAKQQFPNNLVAVVGHDHRFHSKEFARA 113
           GT+GLR + +   ++ N +   I    + +   AK       V VVG D R+++    + 
Sbjct: 18  GTSGLRKKTKVFEDQPNYVENFIQSVMEAIPEGAK-----GAVLVVGGDGRYYNDVILQK 72

Query: 114 TATAFLLKGFKVHYLNPDHEFVHTPLVPFAVD--KLKASVGVMVTASHN---PKMDNGYK 168
            A      G K   +   +  + TP     +   K K + G+++TASHN   P+ D G K
Sbjct: 73  IAAIGAANGVKKLVIG-QNGLLSTPAASHIMRTYKEKCTGGIILTASHNPGGPENDMGIK 131

Query: 169 VYYSNG 174
              SNG
Sbjct: 132 YNLSNG 137

>Smik_11.112 Chr11 (189511..191223) [1713 bp, 570 aa] {ON} YKL127W
           (REAL)
          Length = 570

 Score = 32.7 bits (73), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 60/142 (42%), Gaps = 18/142 (12%)

Query: 56  GTAGLRSQMQAGFNRMN-TLVIIQASQGLATYAKQQFPNNLVAVVGHDHRFHSKEFARAT 114
           GT+GLR + +   + ++ T   IQA+      +    P  +  VVG D RF++       
Sbjct: 19  GTSGLRKKTRVFMDELHYTENFIQAT----IESIPNGPGGVTLVVGGDGRFYNDVIMNKI 74

Query: 115 ATAFLLKGFKVHYLNPDHEFVHTPLVPFAV----DKLKASVGVMVTASHN---PKMDNGY 167
           A      G +   +      + TP     +    DK     G+++TASHN   P+ D G 
Sbjct: 75  AAVGAANGVRKLVIG-QGGLLSTPAASHVIRTYEDKCSGG-GIILTASHNPGGPENDLGI 132

Query: 168 KVYYSNGCQIIPPHDHAISDSI 189
           K    NG     P   +++++I
Sbjct: 133 KYNLPNGG----PAPESVTNAI 150

>TPHA0G02900 Chr7 (622303..624012) [1710 bp, 569 aa] {ON} 
          Length = 569

 Score = 32.7 bits (73), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 69/293 (23%), Positives = 119/293 (40%), Gaps = 34/293 (11%)

Query: 56  GTAGLRSQMQAGFNRMN-TLVIIQASQGLATYAKQQFPNNLVAVVGHDHRFHSKEFARAT 114
           GT+GLR + +   N  N T   IQA       A  +   N   VVG D RF++    +  
Sbjct: 19  GTSGLRKKSKVFMNEPNYTENFIQA----ILDAIPEGSENSTLVVGGDGRFYNDVILQLI 74

Query: 115 ATAFLLKGFKVHYLNPDHEFVHTPLVPFAVDKLKASV--GVMVTASHN---PKMDNGYKV 169
           A      G +   +      + TP     +      V  G+++TASHN   P+ D G K 
Sbjct: 75  AEIGAANGVRKLIIG-QAGILSTPAASHIIRTYHEEVTGGIILTASHNPGGPENDIGIKY 133

Query: 170 YYSNGCQIIPPHDHAISDSI---DMNLEPWANVWNFDDV----LNKGLKQGKLMY----S 218
             +NG     P   +++++I     NL  +  + +F  +    +++ +K G L+     S
Sbjct: 134 NLANGG----PAPESVTNAIWEASKNLTTYKTMKDFPKIDINTISENVKYGPLLIDIIDS 189

Query: 219 REEILKLYLGEVSKNLVGTDPLKFEVKAKPW-FVYTPMHGVGFDIFSTIVKKTMSLVEGK 277
            E+ +K +L E+    +    ++ + K   W  ++  ++GV       I      L   +
Sbjct: 190 TEDYVK-FLKEIFDFPLIKKFIETQRKTNNWKLLFDSLNGVTGPYGKAIFVDEFGLPADE 248

Query: 278 DYLCVPEQQEPDPSFPTVAFPNPEEKGALDLGINLAENHGINLLIANDPDADR 330
               V +   P P F  +  P+P    A  L ++  +   I    A+D D DR
Sbjct: 249 ----VLQNWHPQPDFGGL-HPDPNLTYARTL-VDRVDKEKIEFGAASDGDGDR 295

>TPHA0E01560 Chr5 (318471..319214) [744 bp, 247 aa] {ON} Anc_5.463
           YDR383C
          Length = 247

 Score = 32.0 bits (71), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 45/90 (50%), Gaps = 5/90 (5%)

Query: 200 WNFDDVLNKGLKQGKLMYSREEILKL--YLGEVSKNLVGTDPLKFEVKAKPWFVYTPMHG 257
            N  D+L K +   +    R +IL++  ++GEV K  +GT+ LK   K+K       ++ 
Sbjct: 52  QNKKDLLAKNIYDLEQELRRSQILQINEFVGEVPKYSIGTEILKQNAKSKDLNDSISINK 111

Query: 258 VGFDIFSTIVKKTMSLVEGKDYLCVPEQQE 287
           +  DIF+      MSLV G D     EQ++
Sbjct: 112 LISDIFNL---PQMSLVRGLDEDTEDEQEK 138

>KNAG0A06280 Chr1 (955994..957706) [1713 bp, 570 aa] {ON} 
          Length = 570

 Score = 32.3 bits (72), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 39/82 (47%), Gaps = 6/82 (7%)

Query: 98  VVGHDHRFHSKEFARATATAFLLKGFKVHYLNPDHEFVHTPLVPFAVD--KLKASVGVMV 155
           V+G D RF++       A      G +   +   +  + TP   + +   K KA+ G+++
Sbjct: 59  VIGGDGRFYNDVVINKIAAISAANGVRKLVIG-QNGLLSTPATSYIIRSYKDKATGGIIL 117

Query: 156 TASHN---PKMDNGYKVYYSNG 174
           TASHN   P+ D G K   +NG
Sbjct: 118 TASHNPGGPENDMGIKYNLANG 139

>KAFR0A04200 Chr1 complement(842429..843211) [783 bp, 260 aa] {ON}
           Anc_8.740 YOR280C
          Length = 260

 Score = 32.0 bits (71), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 1/59 (1%)

Query: 166 GYKVYYSNGCQIIPPHDHAISDSIDMNLEPWANVWNFDDVLNKGLKQGKLMYSREEILK 224
           GY+++Y  G ++IP +D  + +  D  +  W  V N D      +K   + Y RE I+K
Sbjct: 32  GYELHYPCGTEVIPANDVGLEEDTDAEMFGWF-VRNKDSFTEFEIKPKTINYLREYIIK 89

>TPHA0B01160 Chr2 complement(263016..264194) [1179 bp, 392 aa] {ON}
           Anc_1.229 YJL125C
          Length = 392

 Score = 31.6 bits (70), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 35/147 (23%), Positives = 57/147 (38%), Gaps = 17/147 (11%)

Query: 84  ATYAKQQF---PNNLVAVVGHDHRFHSKEFARATATAFLLKGFKVHYLNPDHEFVHTPLV 140
           ++Y  Q+F   PN  V   G      S  FAR++   F  +  +V Y     EF    L+
Sbjct: 98  SSYIMQRFNCGPNTRVIEAGTGSGSFSHAFARSSNHLFTFEFHEVRYEQALEEFQDHGLI 157

Query: 141 PFAVDKLKASVGVM-VTASHNPKMDNGYKVYYSNGCQIIPPHDHAISDSIDMNLE----- 194
               D  K++     VT +H    +NG+ +  ++             D + +N       
Sbjct: 158 --GNDDAKSNEAFKNVTITHRDVCENGFTIKQTDKTSYKFAEGE---DEVKINANVVFLD 212

Query: 195 ---PWANVWNFDDVLNKGLKQGKLMYS 218
              PW  + N D V++K  K G   +S
Sbjct: 213 LPAPWNAIPNLDQVISKNEKVGVCCFS 239

>Smik_4.752 Chr4 complement(1328812..1331445) [2634 bp, 877 aa] {ON}
           YDR475C (REAL)
          Length = 877

 Score = 31.6 bits (70), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 22/42 (52%)

Query: 126 HYLNPDHEFVHTPLVPFAVDKLKASVGVMVTASHNPKMDNGY 167
           H L   HEF + P + F  ++ K S G   T   NP +++G+
Sbjct: 209 HRLEQKHEFFNYPTILFPPNRKKWSTGAASTIKFNPPLEDGF 250

>AEL006W Chr5 (621384..628859) [7476 bp, 2491 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YBL004W (UTP20)
          Length = 2491

 Score = 31.6 bits (70), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 25/45 (55%), Gaps = 3/45 (6%)

Query: 363  FKSMEKQFQHAHPLAMLSSTVSSQMIKKMAEVEGFHYEETLTGFK 407
            F SM K+F+H  P+A L   ++S    +M E   + +E  L+ FK
Sbjct: 1288 FSSMGKRFEHIQPVAKLLCDLNSYSTSRMQE---YDFETILSAFK 1329

>TPHA0G02470 Chr7 (507445..509154) [1710 bp, 569 aa] {ON} Anc_2.445
           YKL127W
          Length = 569

 Score = 31.2 bits (69), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 37/140 (26%), Positives = 59/140 (42%), Gaps = 15/140 (10%)

Query: 56  GTAGLRSQMQAGFNRMN-TLVIIQASQGLATYAKQQFPNNLVAVVGHDHRFHSKEFARAT 114
           GT+GLR + +   N  N T   IQA       A  +   +   VVG D RF++    +  
Sbjct: 19  GTSGLRKKTKIFMNEPNYTENFIQA----ILDAIPEGSEDSTLVVGGDGRFYNDVILQLI 74

Query: 115 ATAFLLKGFKVHYLNPDHEFVHTPLVPFAVDKLKASV--GVMVTASHN---PKMDNGYKV 169
           A      G +   +      + TP     +      V  G+++TASHN   P+ D G K 
Sbjct: 75  AEIGAANGVRKLIIG-QAGILSTPATSHVIRTYHEEVTGGIILTASHNPGGPENDIGIKY 133

Query: 170 YYSNGCQIIPPHDHAISDSI 189
             +NG     P   +++++I
Sbjct: 134 NLANGA----PAPESVTNAI 149

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.412 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 69,427,053
Number of extensions: 3139838
Number of successful extensions: 7669
Number of sequences better than 10.0: 71
Number of HSP's gapped: 7775
Number of HSP's successfully gapped: 71
Length of query: 622
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 506
Effective length of database: 40,180,143
Effective search space: 20331152358
Effective search space used: 20331152358
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)