Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_13.4908.839ON73273235740.0
YMR277W (FCP1)8.839ON73273134540.0
Skud_13.4498.839ON73473433140.0
Suva_13.4658.839ON73273331180.0
TDEL0B005808.839ON71374121430.0
NCAS0C004208.839ON72565221400.0
ZYRO0G14168g8.839ON76465221220.0
KAFR0B039108.839ON72465521130.0
CAGL0M02959g8.839ON75860820800.0
NDAI0K004208.839ON77869520150.0
Kpol_1068.98.839ON74566319220.0
TBLA0D032608.839ON76876719230.0
TPHA0I002408.839ON73266418850.0
KNAG0J002808.839ON74276118750.0
SAKL0D01496g8.839ON68865118240.0
Kwal_27.102638.839ON74365217730.0
Ecym_46108.839ON75165817700.0
KLTH0C03894g8.839ON74564617630.0
ABL127W8.839ON72865317480.0
KLLA0D01595g8.839ON71965916200.0
TPHA0E030705.202ON4941591101e-04
NDAI0D018605.202ON5141311046e-04
SAKL0G12870g5.202ON3991321039e-04
NCAS0A068005.202ON4731311030.001
Kpol_1010.615.94ON932921020.002
TPHA0H010705.94ON1015100990.004
Ecym_20665.94ON88081970.006
Smik_12.825.202ON392118950.007
Suva_10.655.202ON415126950.007
YLR019W (PSR2)5.202ON397118940.009
Skud_12.575.202ON415123940.011
Kpol_1050.635.94ON1058123940.013
ZYRO0B10428g5.202ON482112930.014
TBLA0C060905.202ON484123900.034
Kpol_478.165.202ON35094890.040
Smik_12.535.202ON414112890.040
NDAI0C032305.94ON103496900.040
KAFR0E021405.94ON951102900.041
Kwal_33.151405.202ON410132890.041
Skud_12.875.202ON392118890.045
Ecym_50527.46ON87397880.067
SAKL0G15620g5.94ON879164880.070
CAGL0D03234g5.202ON410112860.087
TDEL0E042705.202ON453112860.087
KLLA0F15620g5.202ON414149860.089
KAFR0J009905.202ON483124860.091
TPHA0N006705.202ON452110860.11
Suva_10.995.202ON385114850.11
YLL010C (PSR1)5.202ON42751850.13
NCAS0D027405.202ON398118850.13
NDAI0I021705.202ON391117840.16
Kpol_2002.1005.202ON477127840.17
AAL158W5.202ON478112840.17
Smik_8.2385.94ON1075142840.24
Ecym_71045.202ON492113820.32
CAGL0D05610g5.202ON447132810.39
KAFR0A065604.156ON55555810.40
KNAG0M017405.202ON481109810.43
KLTH0B03388g5.202ON409132800.51
CAGL0I01958g5.94ON1099170810.51
Smik_16.1728.527ON477100800.54
Suva_16.2498.527ON480100800.58
Ecym_72764.156ON59353780.94
KLLA0E23101g8.527ON480106781.0
Smik_12.3356.48ON67896781.1
KNAG0E005705.94ON981102781.1
Skud_12.3406.48ON68095771.3
NCAS0D015105.94ON900120771.4
YPL063W (TIM50)8.527ON476100761.5
SAKL0H20592g4.156ON50877761.7
ADR369C7.46ON82792762.0
NDAI0I023706.48ON76095742.7
KLLA0E15621g5.94ON89168742.9
Skud_16.2188.527ON480100733.3
SAKL0C02200g1.65ON66475733.5
Skud_8.2185.94ON1076145733.7
TPHA0A051105.94ON1065139733.7
ADL145C5.94ON875135734.1
NCAS0C022108.527ON491100724.3
YHR154W (RTT107)5.94ON1070142725.4
KLTH0C01584g5.94ON913114725.7
CAGL0H05159g8.527ON485100716.7
SAKL0H10296g8.527ON47899707.4
NDAI0B019608.258ON439100709.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_13.490
         (732 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_13.490 Chr13 (803288..805486) [2199 bp, 732 aa] {ON} YMR277...  1381   0.0  
YMR277W Chr13 (820256..822454) [2199 bp, 732 aa] {ON}  FCP1Carbo...  1335   0.0  
Skud_13.449 Chr13 (793592..795796) [2205 bp, 734 aa] {ON} YMR277...  1281   0.0  
Suva_13.465 Chr13 (802947..805145) [2199 bp, 732 aa] {ON} YMR277...  1205   0.0  
TDEL0B00580 Chr2 complement(111408..113549) [2142 bp, 713 aa] {O...   830   0.0  
NCAS0C00420 Chr3 complement(65252..67429) [2178 bp, 725 aa] {ON}...   828   0.0  
ZYRO0G14168g Chr7 (1128601..1130895) [2295 bp, 764 aa] {ON} simi...   822   0.0  
KAFR0B03910 Chr2 (811940..814114) [2175 bp, 724 aa] {ON} Anc_8.8...   818   0.0  
CAGL0M02959g Chr13 (332990..335266) [2277 bp, 758 aa] {ON} simil...   805   0.0  
NDAI0K00420 Chr11 complement(94101..96437) [2337 bp, 778 aa] {ON...   780   0.0  
Kpol_1068.9 s1068 complement(15966..18203) [2238 bp, 745 aa] {ON...   744   0.0  
TBLA0D03260 Chr4 (810350..812656) [2307 bp, 768 aa] {ON} Anc_8.8...   745   0.0  
TPHA0I00240 Chr9 (43854..46052) [2199 bp, 732 aa] {ON} Anc_8.839...   730   0.0  
KNAG0J00280 Chr10 complement(41831..44059) [2229 bp, 742 aa] {ON...   726   0.0  
SAKL0D01496g Chr4 complement(120202..122268) [2067 bp, 688 aa] {...   707   0.0  
Kwal_27.10263 s27 complement(268744..270975) [2232 bp, 743 aa] {...   687   0.0  
Ecym_4610 Chr4 (1188871..1191126) [2256 bp, 751 aa] {ON} similar...   686   0.0  
KLTH0C03894g Chr3 complement(339897..342134) [2238 bp, 745 aa] {...   683   0.0  
ABL127W Chr2 (156798..158984) [2187 bp, 728 aa] {ON} Syntenic ho...   677   0.0  
KLLA0D01595g Chr4 complement(141459..143618) [2160 bp, 719 aa] {...   628   0.0  
TPHA0E03070 Chr5 (644651..646135) [1485 bp, 494 aa] {ON} Anc_5.2...    47   1e-04
NDAI0D01860 Chr4 (437370..438914) [1545 bp, 514 aa] {ON} Anc_5.202     45   6e-04
SAKL0G12870g Chr7 (1100535..1101734) [1200 bp, 399 aa] {ON} simi...    44   9e-04
NCAS0A06800 Chr1 (1346677..1348098) [1422 bp, 473 aa] {ON} Anc_5...    44   0.001
Kpol_1010.61 s1010 (148944..151325,151327..151743) [2799 bp, 932...    44   0.002
TPHA0H01070 Chr8 (229632..232679) [3048 bp, 1015 aa] {ON} Anc_5....    43   0.004
Ecym_2066 Chr2 complement(110523..113165) [2643 bp, 880 aa] {ON}...    42   0.006
Smik_12.82 Chr12 (167115..168293) [1179 bp, 392 aa] {ON} YLR019W...    41   0.007
Suva_10.65 Chr10 complement(134276..135523) [1248 bp, 415 aa] {O...    41   0.007
YLR019W Chr12 (180288..181481) [1194 bp, 397 aa] {ON}  PSR2Funct...    41   0.009
Skud_12.57 Chr12 complement(120706..121953) [1248 bp, 415 aa] {O...    41   0.011
Kpol_1050.63 s1050 (138268..141444) [3177 bp, 1058 aa] {ON} (138...    41   0.013
ZYRO0B10428g Chr2 (823155..824603) [1449 bp, 482 aa] {ON} simila...    40   0.014
TBLA0C06090 Chr3 complement(1478726..1480180) [1455 bp, 484 aa] ...    39   0.034
Kpol_478.16 s478 complement(58800..59852) [1053 bp, 350 aa] {ON}...    39   0.040
Smik_12.53 Chr12 complement(116428..117672) [1245 bp, 414 aa] {O...    39   0.040
NDAI0C03230 Chr3 (734531..737635) [3105 bp, 1034 aa] {ON} Anc_5....    39   0.040
KAFR0E02140 Chr5 (426065..428920) [2856 bp, 951 aa] {ON} Anc_5.9...    39   0.041
Kwal_33.15140 s33 complement(975769..977001) [1233 bp, 410 aa] {...    39   0.041
Skud_12.87 Chr12 (172096..173274) [1179 bp, 392 aa] {ON} YLR019W...    39   0.045
Ecym_5052 Chr5 (112351..114972) [2622 bp, 873 aa] {ON} similar t...    39   0.067
SAKL0G15620g Chr7 (1342049..1344688) [2640 bp, 879 aa] {ON} some...    39   0.070
CAGL0D03234g Chr4 (334913..336145) [1233 bp, 410 aa] {ON} simila...    38   0.087
TDEL0E04270 Chr5 (798352..799713) [1362 bp, 453 aa] {ON} Anc_5.2...    38   0.087
KLLA0F15620g Chr6 complement(1441560..1442804) [1245 bp, 414 aa]...    38   0.089
KAFR0J00990 Chr10 complement(178980..180431) [1452 bp, 483 aa] {...    38   0.091
TPHA0N00670 Chr14 complement(147329..148687) [1359 bp, 452 aa] {...    38   0.11 
Suva_10.99 Chr10 (186341..187498) [1158 bp, 385 aa] {ON} YLR019W...    37   0.11 
YLL010C Chr12 complement(129330..130613) [1284 bp, 427 aa] {ON} ...    37   0.13 
NCAS0D02740 Chr4 complement(525116..526312) [1197 bp, 398 aa] {O...    37   0.13 
NDAI0I02170 Chr9 (498399..499574) [1176 bp, 391 aa] {ON} Anc_5.202     37   0.16 
Kpol_2002.100 s2002 complement(238947..240380) [1434 bp, 477 aa]...    37   0.17 
AAL158W Chr1 (67892..69328) [1437 bp, 478 aa] {ON} Syntenic homo...    37   0.17 
Smik_8.238 Chr8 (379729..382956) [3228 bp, 1075 aa] {ON} YHR154W...    37   0.24 
Ecym_7104 Chr7 (203366..204844) [1479 bp, 492 aa] {ON} similar t...    36   0.32 
CAGL0D05610g Chr4 complement(534849..536192) [1344 bp, 447 aa] {...    36   0.39 
KAFR0A06560 Chr1 complement(1329583..1331250) [1668 bp, 555 aa] ...    36   0.40 
KNAG0M01740 Chr13 (321477..322922) [1446 bp, 481 aa] {ON} Anc_5....    36   0.43 
KLTH0B03388g Chr2 (272914..274143) [1230 bp, 409 aa] {ON} simila...    35   0.51 
CAGL0I01958g Chr9 (162266..165565) [3300 bp, 1099 aa] {ON} weakl...    36   0.51 
Smik_16.172 Chr16 (313129..314562) [1434 bp, 477 aa] {ON} YPL063...    35   0.54 
Suva_16.249 Chr16 (440525..441967) [1443 bp, 480 aa] {ON} YPL063...    35   0.58 
Ecym_7276 Chr7 complement(579526..581307) [1782 bp, 593 aa] {ON}...    35   0.94 
KLLA0E23101g Chr5 complement(2059506..2060948) [1443 bp, 480 aa]...    35   1.0  
Smik_12.335 Chr12 (603893..605929) [2037 bp, 678 aa] {ON} YLR260...    35   1.1  
KNAG0E00570 Chr5 (95945..98890) [2946 bp, 981 aa] {ON} Anc_5.94 ...    35   1.1  
Skud_12.340 Chr12 (606790..608832) [2043 bp, 680 aa] {ON} YLR260...    34   1.3  
NCAS0D01510 Chr4 complement(282977..285679) [2703 bp, 900 aa] {O...    34   1.4  
YPL063W Chr16 (429939..431369) [1431 bp, 476 aa] {ON}  TIM50Esse...    34   1.5  
SAKL0H20592g Chr8 complement(1805321..1806847) [1527 bp, 508 aa]...    34   1.7  
ADR369C Chr4 complement(1362309..1364792) [2484 bp, 827 aa] {ON}...    34   2.0  
NDAI0I02370 Chr9 (540379..542661) [2283 bp, 760 aa] {ON} Anc_6.4...    33   2.7  
KLLA0E15621g Chr5 complement(1397950..1400625) [2676 bp, 891 aa]...    33   2.9  
Skud_16.218 Chr16 (401347..402789) [1443 bp, 480 aa] {ON} YPL063...    33   3.3  
SAKL0C02200g Chr3 (194464..196458) [1995 bp, 664 aa] {ON} simila...    33   3.5  
Skud_8.218 Chr8 (374359..377589) [3231 bp, 1076 aa] {ON} YHR154W...    33   3.7  
TPHA0A05110 Chr1 (1149460..1152657) [3198 bp, 1065 aa] {ON} Anc_...    33   3.7  
ADL145C Chr4 complement(435983..438610) [2628 bp, 875 aa] {ON} S...    33   4.1  
NCAS0C02210 Chr3 (411245..412720) [1476 bp, 491 aa] {ON} Anc_8.527     32   4.3  
YHR154W Chr8 (402966..406178) [3213 bp, 1070 aa] {ON}  RTT107Pro...    32   5.4  
KLTH0C01584g Chr3 complement(139563..142304) [2742 bp, 913 aa] {...    32   5.7  
CAGL0H05159g Chr8 complement(501094..502551) [1458 bp, 485 aa] {...    32   6.7  
SAKL0H10296g Chr8 complement(880969..882405) [1437 bp, 478 aa] {...    32   7.4  
NDAI0B01960 Chr2 complement(477552..478871) [1320 bp, 439 aa] {O...    32   9.0  

>Smik_13.490 Chr13 (803288..805486) [2199 bp, 732 aa] {ON} YMR277W
           (REAL)
          Length = 732

 Score = 1381 bits (3574), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 676/732 (92%), Positives = 676/732 (92%)

Query: 1   MTTQIRSPEGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERASETGVDDNEHDASP 60
           MTTQIRSPEGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERASETGVDDNEHDASP
Sbjct: 1   MTTQIRSPEGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERASETGVDDNEHDASP 60

Query: 61  GGGAGSNGVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEVATANQVICEIKRPCNHDI 120
           GGGAGSNGVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEVATANQVICEIKRPCNHDI
Sbjct: 61  GGGAGSNGVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEVATANQVICEIKRPCNHDI 120

Query: 121 VYGGLCTQCGKEVSADAFDGVPLDVVGDMDLQISETEAIRTGKALKEHLRRDKKLILVVD 180
           VYGGLCTQCGKEVSADAFDGVPLDVVGDMDLQISETEAIRTGKALKEHLRRDKKLILVVD
Sbjct: 121 VYGGLCTQCGKEVSADAFDGVPLDVVGDMDLQISETEAIRTGKALKEHLRRDKKLILVVD 180

Query: 181 LDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGSVLRPPPV 240
           LDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGSVLRPPPV
Sbjct: 181 LDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGSVLRPPPV 240

Query: 241 RKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGKLFGDRILSRDE 300
           RKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGKLFGDRILSRDE
Sbjct: 241 RKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGKLFGDRILSRDE 300

Query: 301 NGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQS 360
           NGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQS
Sbjct: 301 NGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQS 360

Query: 361 TGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLATAEEPPANE 420
           TGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLATAEEPPANE
Sbjct: 361 TGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLATAEEPPANE 420

Query: 421 SKEELTKKLEYSASLEVQQQNRPXXXXXXXXXXXXXXXXXXXXXXXXMGTLSNIHMTYYQ 480
           SKEELTKKLEYSASLEVQQQNRP                        MGTLSNIHMTYYQ
Sbjct: 421 SKEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLLVDDDDELYYLMGTLSNIHMTYYQ 480

Query: 481 MLSQENEPEPNLMEIIPSLKQKVFQNCFFVFSGLIPLGTDIQRSDIVIWTSTFGATSTSD 540
           MLSQENEPEPNLMEIIPSLKQKVFQNCFFVFSGLIPLGTDIQRSDIVIWTSTFGATSTSD
Sbjct: 481 MLSQENEPEPNLMEIIPSLKQKVFQNCFFVFSGLIPLGTDIQRSDIVIWTSTFGATSTSD 540

Query: 541 IDFLTTHLITKNPSTYKARLAKKFNPEIKIVHPDWIFECLVNWKKVDEKPYTLIVDSPIS 600
           IDFLTTHLITKNPSTYKARLAKKFNPEIKIVHPDWIFECLVNWKKVDEKPYTLIVDSPIS
Sbjct: 541 IDFLTTHLITKNPSTYKARLAKKFNPEIKIVHPDWIFECLVNWKKVDEKPYTLIVDSPIS 600

Query: 601 DEELQNFQSQLQKRQEYLEENQEQQHMLTSQENLNLFATGTSWLXXXXXXXXXXXXXXXX 660
           DEELQNFQSQLQKRQEYLEENQEQQHMLTSQENLNLFATGTSWL                
Sbjct: 601 DEELQNFQSQLQKRQEYLEENQEQQHMLTSQENLNLFATGTSWLNNDDDDDIPDTASDDD 660

Query: 661 XXXXXXXXXXXXXXXXGIDRKRSIEDNHEDTSQKKTKAEPLQDGPVQQKREGDDNEDSDS 720
                           GIDRKRSIEDNHEDTSQKKTKAEPLQDGPVQQKREGDDNEDSDS
Sbjct: 661 EDDEHNDESDEENHPEGIDRKRSIEDNHEDTSQKKTKAEPLQDGPVQQKREGDDNEDSDS 720

Query: 721 QLEEELMDMLDG 732
           QLEEELMDMLDG
Sbjct: 721 QLEEELMDMLDG 732

>YMR277W Chr13 (820256..822454) [2199 bp, 732 aa] {ON}
           FCP1Carboxy-terminal domain (CTD) phosphatase, essential
           for dephosphorylation of the repeated C-terminal domain
           of the RNA polymerase II large subunit (Rpo21p)
          Length = 732

 Score = 1335 bits (3454), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 652/731 (89%), Positives = 664/731 (90%)

Query: 1   MTTQIRSPEGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERASETGVDDNEHDASP 60
           MTTQIRSP+GLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERAS+TG DDNEHD SP
Sbjct: 1   MTTQIRSPQGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERASDTGDDDNEHDVSP 60

Query: 61  GGGAGSNGVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEVATANQVICEIKRPCNHDI 120
           GG AGSNGVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEVATANQVICEIKRPCNHDI
Sbjct: 61  GGSAGSNGVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEVATANQVICEIKRPCNHDI 120

Query: 121 VYGGLCTQCGKEVSADAFDGVPLDVVGDMDLQISETEAIRTGKALKEHLRRDKKLILVVD 180
           VYGGLCTQCGKEVSADAFDGVPLDVVGD+DLQISETEAIRTGKALKEHLRRDKKLILVVD
Sbjct: 121 VYGGLCTQCGKEVSADAFDGVPLDVVGDVDLQISETEAIRTGKALKEHLRRDKKLILVVD 180

Query: 181 LDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGSVLRPPPV 240
           LDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMN+DGS+LRPPPV
Sbjct: 181 LDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNDDGSMLRPPPV 240

Query: 241 RKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGKLFGDRILSRDE 300
           RKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTG+LFGDRILSRDE
Sbjct: 241 RKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFGDRILSRDE 300

Query: 301 NGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQS 360
           NGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQS
Sbjct: 301 NGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQS 360

Query: 361 TGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLATAEEPPANE 420
           TGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLATAEEPPANE
Sbjct: 361 TGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLATAEEPPANE 420

Query: 421 SKEELTKKLEYSASLEVQQQNRPXXXXXXXXXXXXXXXXXXXXXXXXMGTLSNIHMTYYQ 480
           SKEELTKKLEYSASLEVQQQNRP                        MGTLSNIH TYY 
Sbjct: 421 SKEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLLVDDDDELYYLMGTLSNIHKTYYD 480

Query: 481 MLSQENEPEPNLMEIIPSLKQKVFQNCFFVFSGLIPLGTDIQRSDIVIWTSTFGATSTSD 540
           MLSQ+NEPEPNLMEIIPSLKQKVFQNC+FVFSGLIPLGTDIQRSDIVIWTSTFGATST D
Sbjct: 481 MLSQQNEPEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTSTFGATSTPD 540

Query: 541 IDFLTTHLITKNPSTYKARLAKKFNPEIKIVHPDWIFECLVNWKKVDEKPYTLIVDSPIS 600
           ID+LTTHLITKNPSTYKARLAKKFNP+IKIVHPDWIFECLVNWKKVDEKPYTLIVDSPIS
Sbjct: 541 IDYLTTHLITKNPSTYKARLAKKFNPQIKIVHPDWIFECLVNWKKVDEKPYTLIVDSPIS 600

Query: 601 DEELQNFQSQLQKRQEYLEENQEQQHMLTSQENLNLFATGTSWLXXXXXXXXXXXXXXXX 660
           DEELQNFQ+QLQKRQEYLEE QEQQHMLTSQENLNLFA GTSWL                
Sbjct: 601 DEELQNFQTQLQKRQEYLEETQEQQHMLTSQENLNLFAAGTSWLNNDDDEDIPDTASDDD 660

Query: 661 XXXXXXXXXXXXXXXXGIDRKRSIEDNHEDTSQKKTKAEPLQDGPVQQKREGDDNEDSDS 720
                           GIDRKRSIEDNH+DTSQKKTKAEP QDGPVQ K EGDDNEDSDS
Sbjct: 661 EDDDHDDESDDENNSEGIDRKRSIEDNHDDTSQKKTKAEPSQDGPVQHKGEGDDNEDSDS 720

Query: 721 QLEEELMDMLD 731
           QLEEELMDMLD
Sbjct: 721 QLEEELMDMLD 731

>Skud_13.449 Chr13 (793592..795796) [2205 bp, 734 aa] {ON} YMR277W
           (REAL)
          Length = 734

 Score = 1281 bits (3314), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 642/734 (87%), Positives = 659/734 (89%), Gaps = 2/734 (0%)

Query: 1   MTTQIRSPEGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERASET-GVDDNEHDAS 59
           MTTQIRSPEGLPYPIQIDKL+PSVGSYLHEGDRL+VYKFWYLVERAS+T G DDNEHDA+
Sbjct: 1   MTTQIRSPEGLPYPIQIDKLVPSVGSYLHEGDRLIVYKFWYLVERASDTTGDDDNEHDAT 60

Query: 60  PGGGAGSNGVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEVATANQVICEIKRPCNHD 119
           PGGGAGS  VSPPTKQLRESIEFFESPYEGDLISWNVDVGDE+ATANQVICEIKRPCNHD
Sbjct: 61  PGGGAGSGSVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEIATANQVICEIKRPCNHD 120

Query: 120 IVYGGLCTQCGKEVSADAFDGVPLDVVGDMDLQISETEAIRTGKALKEHLRRDKKLILVV 179
           IVYGGLCTQCGKEVSADAFDGVPLDVVGDMDLQISETEAIR+G+ALKEHLRRDKKLILVV
Sbjct: 121 IVYGGLCTQCGKEVSADAFDGVPLDVVGDMDLQISETEAIRSGEALKEHLRRDKKLILVV 180

Query: 180 DLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGSVLRPPP 239
           DLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGSVL+PPP
Sbjct: 181 DLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGSVLKPPP 240

Query: 240 VRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGKLFGDRILSRD 299
           VRKCWYYVKVRPGLKEFF KVAPLFEMHIYTMATRAYA+QIAKIVDPTG+LFGDRILSRD
Sbjct: 241 VRKCWYYVKVRPGLKEFFDKVAPLFEMHIYTMATRAYAIQIAKIVDPTGELFGDRILSRD 300

Query: 300 ENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQ 359
           ENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQ
Sbjct: 301 ENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQ 360

Query: 360 STGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLATAEEPPAN 419
           STGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLATAEEP AN
Sbjct: 361 STGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLATAEEPSAN 420

Query: 420 ESKEELTKKLEYSASLEVQQQNRPXXXXXXXXXXXXXXXXXXXXXXXXMGTLSNIHMTYY 479
           ESKEELTKKLEYSASLEVQQQNRP                        MGTLSNIH TYY
Sbjct: 421 ESKEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLLVDDDDELYYLMGTLSNIHNTYY 480

Query: 480 QMLSQENEPEPNLMEIIPSLKQKVFQNCFFVFSGLIPLGTDIQRSDIVIWTSTFGATSTS 539
           QM+SQ NEPEPNLMEIIPSLKQKVFQNC FVFSGLIPLGTDIQRSDIVIWTSTFGATSTS
Sbjct: 481 QMISQSNEPEPNLMEIIPSLKQKVFQNCHFVFSGLIPLGTDIQRSDIVIWTSTFGATSTS 540

Query: 540 DIDFLTTHLITKNPSTYKARLAKKFNPEIKIVHPDWIFECLVNWKKVDEKPYTLIVDSPI 599
           DID+LTTHLITKNPSTYKARLAKKFNPEIKI+HPDWIFECLVNWKKVDEKPYTLIVDSPI
Sbjct: 541 DIDYLTTHLITKNPSTYKARLAKKFNPEIKIIHPDWIFECLVNWKKVDEKPYTLIVDSPI 600

Query: 600 SDEELQNFQSQLQKRQEYLEENQEQQHMLTSQENLNLFATGTSWLXXXXXXXXXXXXXXX 659
           SDEELQNFQ QLQKRQEYLEENQ+QQHMLT QENLNLFA GTSWL               
Sbjct: 601 SDEELQNFQKQLQKRQEYLEENQQQQHMLTPQENLNLFAAGTSWLNNDDDEDIPDTASDE 660

Query: 660 XXXXXXXXXXXXXXXXXGIDRKRSIEDNHEDTSQKKTKAEPLQDGPVQQ-KREGDDNEDS 718
                            GIDRKRSIEDNH D SQKKTKAEP QDGPVQ  + E ++NEDS
Sbjct: 661 DEDDDHNDESNNENNPTGIDRKRSIEDNHNDASQKKTKAEPPQDGPVQHNEEEEENNEDS 720

Query: 719 DSQLEEELMDMLDG 732
           DSQLEEELMDMLDG
Sbjct: 721 DSQLEEELMDMLDG 734

>Suva_13.465 Chr13 (802947..805145) [2199 bp, 732 aa] {ON} YMR277W
           (REAL)
          Length = 732

 Score = 1205 bits (3118), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 613/733 (83%), Positives = 639/733 (87%), Gaps = 2/733 (0%)

Query: 1   MTTQIRSPEGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERASETGVDDNEHDASP 60
           MTTQIRSPEGLPYPIQIDKLIPSVGS+L EGDRLLVYKFWYLVER S+ G DDN+HD+SP
Sbjct: 1   MTTQIRSPEGLPYPIQIDKLIPSVGSFLQEGDRLLVYKFWYLVERPSDAGDDDNDHDSSP 60

Query: 61  GGGAGSNGVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEVATANQVICEIKRPCNHDI 120
           GGG G +   P TKQLRESIEFFESPYEGDLISWNVDVGDE+ATANQVICEIKRPCNHDI
Sbjct: 61  GGGGGGSVSPP-TKQLRESIEFFESPYEGDLISWNVDVGDEIATANQVICEIKRPCNHDI 119

Query: 121 VYGGLCTQCGKEVSADAFDGVPLDVVGDMDLQISETEAIRTGKALKEHLRRDKKLILVVD 180
           VYGGLCTQCGKEVSADAFDGVPLDVVGDMDLQISETEAIRTG+ALKEHLRRDKKLILVVD
Sbjct: 120 VYGGLCTQCGKEVSADAFDGVPLDVVGDMDLQISETEAIRTGRALKEHLRRDKKLILVVD 179

Query: 181 LDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGSVLRPPPV 240
           LDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYM EDGSV +PPPV
Sbjct: 180 LDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMAEDGSVPKPPPV 239

Query: 241 RKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGKLFGDRILSRDE 300
           RKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTG+LFGDRILSRDE
Sbjct: 240 RKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFGDRILSRDE 299

Query: 301 NGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQS 360
           NGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQS
Sbjct: 300 NGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQS 359

Query: 361 TGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLATAEEPPANE 420
           TGMLQLGRKTRQKSQESQEL+TDIMDNEKKLQEKID EVKRQEE+LNHQLATAEEP ANE
Sbjct: 360 TGMLQLGRKTRQKSQESQELITDIMDNEKKLQEKIDIEVKRQEEQLNHQLATAEEPSANE 419

Query: 421 SKEELTKKLEYSASLEVQQQNRPXXXXXXXXXXXXXXXXXXXXXXXXMGTLSNIHMTYYQ 480
           SKEELTKKLEYSASLEVQQQNRP                        M TL NIH TYYQ
Sbjct: 420 SKEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLLVDDDDELHYLMSTLLNIHKTYYQ 479

Query: 481 MLSQENEPEPNLMEIIPSLKQKVFQNCFFVFSGLIPLGTDIQRSDIVIWTSTFGATSTSD 540
           MLSQ  E EPNLMEIIPSLKQKVFQNC+FVFSGLIPLGTDIQRSDIVIWTSTFGATSTSD
Sbjct: 480 MLSQPGEIEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTSTFGATSTSD 539

Query: 541 IDFLTTHLITKNPSTYKARLAKKFNPEIKIVHPDWIFECLVNWKKVDEKPYTLIVDSPIS 600
           I++LTTHLITKNP TYKARLAKKFNPEIK+VHPDWIFECLVNWKKVDEKPYTLIVDSPIS
Sbjct: 540 INYLTTHLITKNPGTYKARLAKKFNPEIKVVHPDWIFECLVNWKKVDEKPYTLIVDSPIS 599

Query: 601 DEELQNFQSQLQKRQEYLEENQEQQHMLTSQENLNLFATGTSWLXXXXXXXXXXXXXXXX 660
           D+ELQ+FQ QLQK+QEYL+E+ EQQHML  QEN+NLFA GTSWL                
Sbjct: 600 DDELQSFQKQLQKKQEYLDEHHEQQHMLMPQENINLFAAGTSWLNDDDDEDIPDTASDDD 659

Query: 661 XXXXXXXXXXXXXXXXGIDRKRSIEDNHEDTSQKKTKAEPLQ-DGPVQQKREGDDNEDSD 719
                            IDRKRSIED  ++  QKKTKAE  Q DGP Q + EG++NEDSD
Sbjct: 660 DDNDDNSESDDERDSGDIDRKRSIEDGQDEAPQKKTKAEHSQEDGPAQHEEEGENNEDSD 719

Query: 720 SQLEEELMDMLDG 732
           SQLEEELM MLDG
Sbjct: 720 SQLEEELMGMLDG 732

>TDEL0B00580 Chr2 complement(111408..113549) [2142 bp, 713 aa] {ON}
           Anc_8.839 YMR277W
          Length = 713

 Score =  830 bits (2143), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/741 (57%), Positives = 519/741 (70%), Gaps = 39/741 (5%)

Query: 1   MTTQIRSPEGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERASETGVDDNEHDASP 60
           MTT + SPE LPYPI ID+LI  +GS++ +G RL  +KFWY+VE AS    D+NE     
Sbjct: 1   MTTPVFSPEVLPYPITIDQLIAPIGSHVEKGQRLFAFKFWYMVEIASSP--DENE----- 53

Query: 61  GGGAGSNGVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEVATANQVICEIKRPCNHDI 120
           GG           K +RESIEFFE+P+EGDL+SWNVDVGDEV   NQ ICEI RPCNHDI
Sbjct: 54  GGHR--------KKTVRESIEFFEAPFEGDLMSWNVDVGDEVVAPNQAICEISRPCNHDI 105

Query: 121 VYGGLCTQCGKEV-SADAFDGVPLDVVGDMDLQISETEAIRTGKALKEHLRRDKKLILVV 179
           VYGGLCT CGKEV  ++ F+G       D++L++S  EA      LK  LR  KKL+LVV
Sbjct: 106 VYGGLCTLCGKEVDESEQFNGNLAISHTDVNLKVSRKEATDIENNLKTRLRESKKLVLVV 165

Query: 180 DLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGSVLRPPP 239
           DLDQT+IHCGVDPTI EWK D +NPN+E L+DV+SF LDEE +LPL+YM         PP
Sbjct: 166 DLDQTVIHCGVDPTIGEWKRDSSNPNYEALKDVQSFALDEEPILPLLYMGPK------PP 219

Query: 240 VRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGKLFGDRILSRD 299
           VRKCWYYVKVRPGLKEFF KVAPLFEMHIYTMATRAYAL+IAKI+DP G LFGDRILSRD
Sbjct: 220 VRKCWYYVKVRPGLKEFFDKVAPLFEMHIYTMATRAYALEIAKIIDPDGSLFGDRILSRD 279

Query: 300 ENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQ 359
           ENGS+T KSL +LFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLP+Q
Sbjct: 280 ENGSITQKSLERLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPRQ 339

Query: 360 STGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLATAEEPPAN 419
              MLQLGR  R+K+QES EL+TDIMD EKKLQEKID+EVKRQEEKLNHQ+A+ EE PA 
Sbjct: 340 QNTMLQLGRGARKKTQESDELITDIMDTEKKLQEKIDEEVKRQEEKLNHQMASGEEVPAP 399

Query: 420 ESKEELTKKLEYSASLEVQQQNRPXXXXXXXXXXXXXXXXXXXXXXXXMGTLSNIHMTYY 479
           ESK++L KKLEYSASLEVQQQNRP                           L+ +H  YY
Sbjct: 400 ESKDQLAKKLEYSASLEVQQQNRPLATLQKHMHNQRLLVDDDDELNYLREILAKVHDEYY 459

Query: 480 QMLSQENEPEPNLMEIIPSLKQKVFQNCFFVFSGLIPLGTDIQRSDIVIWTSTFGATSTS 539
           + L Q++E + ++  ++P +K KVF++C FVFSGLIPLGT+I R+DIV+WT+ FGA S+ 
Sbjct: 460 KTLGQDSEKKADIKTLLPLMKSKVFEDCHFVFSGLIPLGTNINRADIVLWTNMFGAQSSP 519

Query: 540 DIDFLTTHLITKNPSTYKARLAKKFNPEIKIVHPDWIFECLVNWKKVDEKPYTLIVDSPI 599
           +ID  TTH+IT+ P TYKAR+AK FN  IK+VHPDW+FECLV+WK VDEKPY LIV+   
Sbjct: 520 EIDDSTTHVITRTPGTYKARIAKAFNENIKVVHPDWVFECLVSWKHVDEKPYELIVEQTA 579

Query: 600 SDEELQNFQSQLQKRQEYLEENQEQQHMLTSQEN--LNLFATGTSWLXXXXXXXXXXXXX 657
           +DEEL +++ +L +R   L E QE +  + S +N  +NLFA GTSWL             
Sbjct: 580 TDEELGDYKQKLARRSSALAE-QEMELAMESAKNGTINLFAGGTSWLNDDDDDEMPDGLD 638

Query: 658 XXXXXXXXXXXXXXXXXXXG--IDR-----KRSIEDNHEDTSQKKTKAEPLQDGPVQQKR 710
                                 +D      KRS+E++H+        + P +   V + +
Sbjct: 639 DSDDEDDDDEQEEEKTEDQNQVVDGHTSQPKRSLENDHDSLGD----SSPYKKSHVDELK 694

Query: 711 EGDDNEDSDSQLEEELMDMLD 731
           +  DN DSDS++EEEL++ LD
Sbjct: 695 Q--DN-DSDSEIEEELLNALD 712

>NCAS0C00420 Chr3 complement(65252..67429) [2178 bp, 725 aa] {ON}
           Anc_8.839 YMR277W
          Length = 725

 Score =  828 bits (2140), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/652 (62%), Positives = 491/652 (75%), Gaps = 25/652 (3%)

Query: 1   MTTQIRSPEGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERASETGVDDNEHDASP 60
           M+TQI +P GLPYPI ID+LI  VG  + +GDRLL YKFW++V+ AS    DDN+  + P
Sbjct: 1   MSTQILAPIGLPYPITIDQLITHVGDEVQKGDRLLAYKFWFVVDVASSP--DDNDVSSPP 58

Query: 61  GGGAGSNGVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEVATANQVICEIKRPCNHDI 120
             G          K +RESIEFFESPY+G LISWNVD+GDE+A+ NQV+ EI RPCNHD+
Sbjct: 59  TAGK---------KSIRESIEFFESPYKGQLISWNVDIGDEIASPNQVLAEIIRPCNHDV 109

Query: 121 VYGGLCTQCGKEVSADAFD----GVPLDVV-GDMDLQISETEAIRTGKALKEHLRRDKKL 175
           VYGGLCT CG+EV  D  D    G  L +   D +L+IS  EA+  G  ++  LR++KKL
Sbjct: 110 VYGGLCTLCGEEVDEDDNDASGSGANLTISHTDTNLKISTREALDIGLNVRTRLRKEKKL 169

Query: 176 ILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGSVL 235
           +LVVDLDQT+IHCGVDPTI EWKNDP NPNFETL+DVK F+L+EE +LP +YM       
Sbjct: 170 VLVVDLDQTVIHCGVDPTIGEWKNDPKNPNFETLKDVKQFSLEEEPILPTLYMGPK---- 225

Query: 236 RPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGKLFGDRI 295
             PP+RKCWYYVKVRPGLKEF  K+APLFEMHIYTMATRAYA +IAKI+DP G LFGDRI
Sbjct: 226 --PPLRKCWYYVKVRPGLKEFLEKIAPLFEMHIYTMATRAYASEIAKIIDPNGDLFGDRI 283

Query: 296 LSRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNF 355
           LSRDENGS+TTKSL +LFPTDQSMV+VIDDRGDVWNW PNLIKVVPYNFFVGVGDINSNF
Sbjct: 284 LSRDENGSMTTKSLERLFPTDQSMVIVIDDRGDVWNWSPNLIKVVPYNFFVGVGDINSNF 343

Query: 356 LPKQSTGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLATAEE 415
           LPKQ   MLQLGR++R+KS+++++LL DIMD+EKKL+EKID+EVKRQEE+L+HQ AT EE
Sbjct: 344 LPKQQATMLQLGRRSREKSKDTEDLLIDIMDSEKKLKEKIDQEVKRQEEELSHQSATTEE 403

Query: 416 PP--ANESKEELTKKLEYSASLEVQQQNRPXXXXXXXXXXXXXXXXXXXXXXXXMGTLSN 473
           PP  A E+KEE++KK+EYSASLEVQQQNRP                          TL  
Sbjct: 404 PPTSAGENKEEISKKIEYSASLEVQQQNRPLAALQKHFHDQRLLIDDDDELYHLKDTLVR 463

Query: 474 IHMTYYQMLSQENEPEPNLMEIIPSLKQKVFQNCFFVFSGLIPLGTDIQRSDIVIWTSTF 533
           IH  YY +L ++ E + ++  I+P++KQ V  NC FVFSGLIPLGTDIQR+DIVIWT+TF
Sbjct: 464 IHDKYYNVLKKDGELKADIKLIMPAMKQNVLDNCRFVFSGLIPLGTDIQRADIVIWTNTF 523

Query: 534 GATSTSDIDFLTTHLITKNPSTYKARLAKKFNPEIKIVHPDWIFECLVNWKKVDEKPYTL 593
           GA STSDID  TTH+ITK P TYKARLAK FNP+IKI+HPDW+FECL +WK VDEKPY L
Sbjct: 524 GAISTSDIDEKTTHVITKTPGTYKARLAKSFNPKIKILHPDWVFECLTSWKHVDEKPYEL 583

Query: 594 IVDSPISDEELQNFQSQLQKRQEYLEENQE-QQHMLTSQENLNLFATGTSWL 644
           IV+ P+S+ EL+ F+ +L KRQ     N+       T+   L LF+ G SWL
Sbjct: 584 IVEQPVSETELEEFKKKLAKRQLLATANENLSPANGTNSAELELFSGGMSWL 635

>ZYRO0G14168g Chr7 (1128601..1130895) [2295 bp, 764 aa] {ON} similar
           to uniprot|Q03254 Saccharomyces cerevisiae YMR277W FCP1
           Carboxy-terminal domain (CTD) phosphatase
          Length = 764

 Score =  822 bits (2122), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/652 (61%), Positives = 491/652 (75%), Gaps = 27/652 (4%)

Query: 1   MTTQIRSPEGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERASETGVDDNEHDASP 60
           M T + +PE LPYPI ID+LI  +GS + +G RL  YKFWY+VE AS           SP
Sbjct: 1   MATPVIAPESLPYPITIDQLIAPIGSTVKKGQRLFAYKFWYMVEIAS-----------SP 49

Query: 61  GGGAGSNGVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEVATANQVICEIKRPCNHDI 120
               G+ G     K +RESIEFFESP+EGDL+SW VD GDEVA+A QVICEI RPCNHD+
Sbjct: 50  DENDGNGGAQHSKKTVRESIEFFESPFEGDLVSWEVDRGDEVASARQVICEIMRPCNHDV 109

Query: 121 VYGGLCTQCGKEVSADAFDGVPLDVV---GDMDLQISETEAIRTGKALKEHLRRDKKLIL 177
           VYGGLCT CGKEV  D  D +  ++     D +L++S  EA      LK+ LR+ KKL+L
Sbjct: 110 VYGGLCTMCGKEV--DENDQMEANLAISHTDTNLKVSRKEAEDMEHFLKQRLRQSKKLVL 167

Query: 178 VVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGSVLRP 237
           VVDLDQT+IHCGVDPTI EWK DP+NPN+ETL+DV+ F+L+EE ++P MYM   G  L  
Sbjct: 168 VVDLDQTVIHCGVDPTIGEWKKDPSNPNYETLKDVQMFSLEEEPIVPPMYM---GPRL-- 222

Query: 238 PPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGKLFGDRILS 297
            P RKCWY+VKVRPGL+EFFA++APL+EMHIYTMATR YAL+IAKI+DP G LFGDRILS
Sbjct: 223 -PERKCWYFVKVRPGLREFFAQLAPLYEMHIYTMATRTYALEIAKIIDPDGSLFGDRILS 281

Query: 298 RDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLP 357
           RDENGSLT KSL +LFPTDQSMV+VIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLP
Sbjct: 282 RDENGSLTQKSLERLFPTDQSMVIVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLP 341

Query: 358 KQSTGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLATAEEPP 417
           +Q +G+LQLGR+T +K QES ELLTDIMD EK+LQEKID+EVKRQEEKL+HQL T +EP 
Sbjct: 342 RQQSGLLQLGRRTHKKPQESDELLTDIMDTEKRLQEKIDEEVKRQEEKLSHQLTTNDEPV 401

Query: 418 ANESKEELTKKLEYSASLEVQQQNRPXXXXXXXXXXXXXXXXXXXXXXXXMGTLSNIHMT 477
             ESKE+LTKKLEYSASLEVQQQNRP                          TL+ IH  
Sbjct: 402 QGESKEQLTKKLEYSASLEVQQQNRPLATLQKHMHNQRLLVDDDDELYYLKDTLAKIHRK 461

Query: 478 YYQMLSQENEPEPNLMEIIPSLKQKVFQNCFFVFSGLIPLGTDIQRSDIVIWTSTFGATS 537
           YY++L + NE   ++  ++P++K +VF++C+FVFSGLIPLGT+I+R+DIV+WT  FGA +
Sbjct: 462 YYKLLDEGNENSADIQSLVPTMKGQVFKDCYFVFSGLIPLGTNIRRADIVLWTGMFGAIT 521

Query: 538 TSDIDFLTTHLITKNPSTYKARLAKKFNPEIKIVHPDWIFECLVNWKKVDEKPYTLIVDS 597
           +S+ID  TTH+ITK P TYKAR+AK FN  +K+VHPDW+FECLV W  VDEKPY LI+  
Sbjct: 522 SSEIDENTTHVITKTPGTYKARIAKGFNENVKVVHPDWVFECLVTWTHVDEKPYELIIQD 581

Query: 598 PISDEELQNFQSQLQKRQEYLEENQEQ----QHMLTSQEN-LNLFATGTSWL 644
           P ++EE+Q+F+ ++++R    E+ +EQ      M T+Q++ LNLFA GTSWL
Sbjct: 582 PATEEEIQDFKRKIEQRHLIEEQRREQFESEALMKTAQDSTLNLFAGGTSWL 633

>KAFR0B03910 Chr2 (811940..814114) [2175 bp, 724 aa] {ON} Anc_8.839
           YMR277W
          Length = 724

 Score =  818 bits (2113), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/655 (61%), Positives = 493/655 (75%), Gaps = 25/655 (3%)

Query: 1   MTTQIRSPEGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERASETGVDDNEHDASP 60
           MTT + +PEGLPYPI ID+LI  +G+Y+ +G RL  YKFWY+VE AS    DDN+     
Sbjct: 1   MTTPVLAPEGLPYPITIDELICPIGTYIEKGIRLFAYKFWYMVEIASSP--DDND----- 53

Query: 61  GGGAGSNGVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEVATANQVICEIKRPCNHDI 120
                    S P K++RESIEFF++P+EG LISWN+DVGDE+++A+QVICEIKRPCNHDI
Sbjct: 54  -PANTDTQASHPKKKIRESIEFFDAPFEGTLISWNIDVGDELSSASQVICEIKRPCNHDI 112

Query: 121 VYGGLCTQCGKEV--SADAFDGVPLDVV-GDMDLQISETEAIRTGKALKEHLRRDKKLIL 177
           VYGGLCTQCGKEV  S  +  G    V   D +L+IS  EA+  G+  K+ LR +KKL+L
Sbjct: 113 VYGGLCTQCGKEVDESEQSQFGSNFTVSHTDTNLKISRKEALDIGEDFKKRLRNEKKLVL 172

Query: 178 VVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGSVLRP 237
           VVDLDQT+IHCGVDPTI EWK+DPNNPN++TL+DV+ F L+EE VLP MYM       +P
Sbjct: 173 VVDLDQTVIHCGVDPTIGEWKSDPNNPNYDTLKDVQMFALEEEPVLPFMYMGP-----KP 227

Query: 238 PPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGKLFGDRILS 297
            P RKCWYYVKVRPGLKEFF KVAPLFEMHIYTMATRAYAL+I KI+DPTG+LFG+RILS
Sbjct: 228 TP-RKCWYYVKVRPGLKEFFKKVAPLFEMHIYTMATRAYALEITKIIDPTGELFGNRILS 286

Query: 298 RDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLP 357
           RDENGSLT+KSL +LFPTDQSMV++IDDRGDVWNW PNLIKVVPY+FFVGVGDINSNFLP
Sbjct: 287 RDENGSLTSKSLERLFPTDQSMVIIIDDRGDVWNWSPNLIKVVPYSFFVGVGDINSNFLP 346

Query: 358 KQSTGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLATAEEPP 417
           KQ T MLQLGR++R+K++E+ ELLTDIMD EKKLQEKID+EVKRQE+ L+HQ+   EE  
Sbjct: 347 KQQTTMLQLGRRSREKAKEADELLTDIMDTEKKLQEKIDEEVKRQEKNLSHQVVPTEESV 406

Query: 418 ANESKEELTKKLEYSASLEVQQQNRPXXXXXXXXXXXXXXXXXXXXXXXXMGTLSNIHMT 477
           +NE+KEE TKKLE+SAS+EVQQQNRP                          TL+ +H  
Sbjct: 407 SNETKEEWTKKLEHSASVEVQQQNRPLAALQEHLHNQRLLIDDDDELYFLKDTLAKVHNE 466

Query: 478 YYQMLSQE--NEPEPNLMEIIPSLKQKVFQNCFFVFSGLIPLGTDIQRSDIVIWTSTFGA 535
           YY +L  +  +E   ++  I+P LKQ VF+ C FVFSGLIPL TDI+R+DIV+WTS FGA
Sbjct: 467 YYSILENKSLDESGADIKLIMPKLKQSVFEGCHFVFSGLIPLHTDIRRADIVVWTSMFGA 526

Query: 536 TSTSDIDFLTTHLITKNPSTYKARLAKKFNPEIKIVHPDWIFECLVNWKKVDEKPYTLIV 595
            S+S+I+ +TTH+ITK P T+KARLAK FN +IKIVHPDW+FECL+ W  VDEKPYTLIV
Sbjct: 527 ESSSEINEVTTHVITKTPGTFKARLAKSFNSDIKIVHPDWVFECLIRWTHVDEKPYTLIV 586

Query: 596 DSPISDEELQNFQSQLQKRQEYLEENQEQQHMLTS------QENLNLFATGTSWL 644
           + PISD EL+ F+  L  R+     N++    +T          ++LFATGTSWL
Sbjct: 587 EEPISDRELKKFREDLNNRKLTERNNEQNSGDITGTIVENFDNTVDLFATGTSWL 641

>CAGL0M02959g Chr13 (332990..335266) [2277 bp, 758 aa] {ON} similar
           to uniprot|Q03254 Saccharomyces cerevisiae YMR277w FCP1
          Length = 758

 Score =  805 bits (2080), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/608 (64%), Positives = 468/608 (76%), Gaps = 20/608 (3%)

Query: 1   MTTQIRSPEGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERASETGVDDNEHDASP 60
           M+T + +P GLPYPI +D+L+  +GSY+ +G RL  YKFWY+VE A+    DDN+ D   
Sbjct: 1   MSTPVLTPMGLPYPITVDELMVPIGSYVEKGQRLFAYKFWYMVEIANSP--DDNDIDYE- 57

Query: 61  GGGAGSNGVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEVATANQVICEIKRPCNHDI 120
                   +    +++RESIEF+E+P+EGDL+SWNVD  DE+A  N  +CEIKRPCNHDI
Sbjct: 58  -----GPEIEKSKRKVRESIEFYEAPFEGDLLSWNVDEKDEIAGPNMAVCEIKRPCNHDI 112

Query: 121 VYGGLCTQCGKEVSADAFDGVPLDVV---GDMDLQISETEAIRTGKALKEHLRRDKKLIL 177
           VYGGLCT CGKEV  D +D V  ++     D +L++S  EAI   K +   L+ +KKL+L
Sbjct: 113 VYGGLCTMCGKEV--DEYDQVDANLTISHTDTNLRVSRKEAIDLDKQITTRLKNEKKLVL 170

Query: 178 VVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGSVLRP 237
           VVDLDQT+IHCGVDPTI EWK DP+NPN+ETL+DVK F+L+EE +LPL+YM         
Sbjct: 171 VVDLDQTVIHCGVDPTIGEWKADPSNPNYETLKDVKCFSLEEEPILPLIYMGP------K 224

Query: 238 PPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGKLFGDRILS 297
           PPVR CWYYVK+RPGLKEFF K+APL+EMHIYTMATRAYAL+IAKI+DP   LFGDRILS
Sbjct: 225 PPVRTCWYYVKIRPGLKEFFEKIAPLYEMHIYTMATRAYALEIAKIIDPDKSLFGDRILS 284

Query: 298 RDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLP 357
           RDENGSLT KSL +LFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLP
Sbjct: 285 RDENGSLTQKSLTRLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLP 344

Query: 358 KQSTGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLATAEEPP 417
           KQ T MLQLGR+TRQK +ES+ELLTDIMD EKKLQEKID+EVKRQEEKLNHQ+ATAEE  
Sbjct: 345 KQQTTMLQLGRRTRQKIKESEELLTDIMDTEKKLQEKIDEEVKRQEEKLNHQMATAEEST 404

Query: 418 ANESKEELTKKLEYSASLEVQQQNRPXXXXXXXXXXXXXXXXXXXXXXXXMGTLSNIHMT 477
             ESKE++ KKLE+SASLEVQQQNRP                          TL+ IH  
Sbjct: 405 DQESKEKIAKKLEFSASLEVQQQNRPLAKLQKHLHDQRLLIDDDDELFYLKDTLAYIHKE 464

Query: 478 YYQML-SQENEPEPNLMEIIPSLKQKVFQNCFFVFSGLIPLGTDIQRSDIVIWTSTFGAT 536
           +Y +L    ++ E ++  ++P LK+KVF+ C FVFSGLIPLGTDI+R+DIVIWTS FGA 
Sbjct: 465 FYHLLEDASDQNEADITMLLPKLKKKVFKECHFVFSGLIPLGTDIKRADIVIWTSLFGAE 524

Query: 537 STSDIDFLTTHLITKNPSTYKARLAKKFNPEIKIVHPDWIFECLVNWKKVDEKPYTLIVD 596
           STSDID  TTH++TK P TYKARLAK FNP+IK+VHPDWIFECL +WK++DEKPY LIV+
Sbjct: 525 STSDIDEHTTHVVTKTPGTYKARLAKAFNPDIKVVHPDWIFECLASWKRIDEKPYLLIVE 584

Query: 597 SPISDEEL 604
            P+S++EL
Sbjct: 585 QPVSEDEL 592

>NDAI0K00420 Chr11 complement(94101..96437) [2337 bp, 778 aa] {ON}
           Anc_8.839 YMR277W
          Length = 778

 Score =  780 bits (2015), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/695 (57%), Positives = 491/695 (70%), Gaps = 61/695 (8%)

Query: 3   TQIRSPEGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERASETGVDDNEHDA---- 58
           T IR+P GLPYPI ID+L+  +G+ +++ DRLL YKFWY+VE A  T  D+ E D     
Sbjct: 5   TVIRAPLGLPYPITIDELMKPIGTEMNKDDRLLAYKFWYVVEIA--TSPDELEDDNDNDN 62

Query: 59  -----------SPGGGAGSNGVSPPTKQ------------------LRESIEFFESPYEG 89
                      +  G   +N  + P+ +                  +RESIEFF+ PY+G
Sbjct: 63  DNDPDGDVDKNTINGNNVTNLTNRPSIEPISRNTITHAHKKKKKKTVRESIEFFDCPYDG 122

Query: 90  DLISWNVDVGDEVATANQVICEIKRPCNHDIVYGGLCTQCGKEVSADAFD---GVPLDVV 146
            L SW V+ GD++   NQ +CEI+RPCNHD++YGGLCT CGKEV  +  D   G  L + 
Sbjct: 123 ILTSWLVEKGDQIVGPNQPLCEIQRPCNHDVIYGGLCTLCGKEVDENDIDDLSGPNLTIS 182

Query: 147 -GDMDLQISETEAIRTGKALKEHLRRDKKLILVVDLDQTIIHCGVDPTIAEWKNDPNNPN 205
             D +L+IS  EA+  G+++K+ LR DKKLILVVDLDQT+IHCGVDPTI EWK DP NPN
Sbjct: 183 HTDTNLKISTREAVDIGQSVKKRLRDDKKLILVVDLDQTVIHCGVDPTIGEWKRDPTNPN 242

Query: 206 FETLRDVKSFTLDEELVLPLMYMNEDGSVLRPPPVRKCWYYVKVRPGLKEFFAKVAPLFE 265
           FETL+DVK F L+EE +LPLMYM         PP RKCWYYVKVRPGLK+FF KVAPLFE
Sbjct: 243 FETLKDVKEFALEEEPILPLMYMGPK------PPARKCWYYVKVRPGLKDFFQKVAPLFE 296

Query: 266 MHIYTMATRAYALQIAKIVDPTGKLFGDRILSRDENGSLTTKSLAKLFPTDQSMVVVIDD 325
           MHIYTMATRAYA +IAKI+DPTG LFG+RILSRDENGSLTTKSL +LFPTDQSMV++IDD
Sbjct: 297 MHIYTMATRAYASEIAKIIDPTGDLFGNRILSRDENGSLTTKSLERLFPTDQSMVIIIDD 356

Query: 326 RGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQSTGMLQLGRKTRQ-----KSQESQEL 380
           RGDVWNW PNLIKV+PYNFFVGVGDINSNFLPKQ   MLQLGR++ +      ++E+ +L
Sbjct: 357 RGDVWNWSPNLIKVIPYNFFVGVGDINSNFLPKQQATMLQLGRRSSRGESKVSTKENDDL 416

Query: 381 LTDIMDNEKKLQEKIDKEVKRQEEKLNHQLATAEEPP--ANESKEELTKKLEYSASLEVQ 438
           LTDIMD EK LQ KI++EVKRQEEKLNHQLAT EEPP  A E+KEE++KK+EYSASLEVQ
Sbjct: 417 LTDIMDTEKVLQRKINEEVKRQEEKLNHQLATIEEPPTTAGENKEEISKKIEYSASLEVQ 476

Query: 439 QQNRPXXXXXXXXXXXXXXXXXXXXXXXXMGTLSNIHMTYYQMLSQENEP----EPNLME 494
           Q+NRP                          TLS IH  YY+ML + NE     EP++  
Sbjct: 477 QKNRPLATLQKHFHDQRLLIDDDEELYHLKDTLSKIHSKYYEMLQKANENKDSIEPDIKY 536

Query: 495 IIPSLKQKVFQNCFFVFSGLIPLGTDIQRSDIVIWTSTFGATSTSDIDFLTTHLITKNPS 554
           I+P +KQ V Q+C FVFSGLIPLGT+IQ+SDIVIWT+ FGA ST+DID  TTH+ITK P 
Sbjct: 537 IMPQMKQTVLQDCHFVFSGLIPLGTNIQKSDIVIWTNMFGARSTADIDENTTHVITKTPG 596

Query: 555 TYKARLAKKFNPEIKIVHPDWIFECLVNWKKVDEKPYTLIVDSPISDEELQNFQSQLQKR 614
           TYKARLAK ++P+IKIVHPDW+FECL+ WK V+EKPY L+V+  +SD+EL +F  +L++R
Sbjct: 597 TYKARLAKSYDPDIKIVHPDWVFECLMRWKHVEEKPYELLVEQLVSDKELADFNRKLERR 656

Query: 615 QEYLEENQEQQHMLTSQENL-----NLFATGTSWL 644
            +  E   E  +      N+     NLFA GTSWL
Sbjct: 657 IQLSELKDEGLYNKLPDGNIDINEVNLFAGGTSWL 691

>Kpol_1068.9 s1068 complement(15966..18203) [2238 bp, 745 aa] {ON}
           complement(15966..18203) [2238 nt, 746 aa]
          Length = 745

 Score =  744 bits (1922), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/663 (57%), Positives = 470/663 (70%), Gaps = 45/663 (6%)

Query: 1   MTTQIRSPEGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERA-----SETGVDDNE 55
           M+T + +P GLPYPI I KLI S+GS++ +G RL  YKFWY+VE A     ++ GV+D E
Sbjct: 1   MSTPVSAPLGLPYPITISKLIASIGSHVEKGQRLFAYKFWYIVEIAKSPDENDDGVND-E 59

Query: 56  HDASPGGGAGSNGVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEVATANQVICEIKRP 115
           H                 K +RESIEFF+SP+EGDL+SWNVDVGDE+   NQ ICEI RP
Sbjct: 60  HSK---------------KSIRESIEFFDSPFEGDLVSWNVDVGDEIVEPNQTICEIVRP 104

Query: 116 CNHDIVYGGLCTQCGKEVSADAFDGVPLDVV---GDMDLQISETEAIRTGKALKEHLRRD 172
           CNHDIVY G+CT CGKEV  D  D V  ++     D +L++S  EA   G+ +K+ L R+
Sbjct: 105 CNHDIVYAGICTMCGKEV--DESDQVSANLTISHTDTNLKVSRREANDIGQGIKKRLIRE 162

Query: 173 KKLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDG 232
           KKLILVVDLDQT+IHCGVDPTIAEWKNDP NPNFETLRDVKSF L+EE +LP MYM    
Sbjct: 163 KKLILVVDLDQTVIHCGVDPTIAEWKNDPTNPNFETLRDVKSFVLEEEPILPPMYMGP-- 220

Query: 233 SVLRPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGKLFG 292
                PP  KCWYYVK+RPGLKEFF +V+ L+EMHIYTMATR+YA +IAKI+DP G LF 
Sbjct: 221 ----KPPTHKCWYYVKIRPGLKEFFEEVSKLYEMHIYTMATRSYAQEIAKIIDPDGTLFA 276

Query: 293 DRILSRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDIN 352
           DRILSR+ENGSLT KSL +LFPTDQSMVVVIDDRGDVWNWCPNLIKV PYNFFVG+GDIN
Sbjct: 277 DRILSRNENGSLTHKSLERLFPTDQSMVVVIDDRGDVWNWCPNLIKVTPYNFFVGIGDIN 336

Query: 353 SNFLPKQSTGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLAT 412
           SNFLP+Q T MLQLGR+  +K++++ ELLTDIMD EKKLQEKID+EVKRQEE L+HQ A 
Sbjct: 337 SNFLPRQQTTMLQLGRRNHKKTEDTDELLTDIMDTEKKLQEKIDEEVKRQEENLSHQSAA 396

Query: 413 -AEEPPANESKEELTKKLEYSASLEVQQQNRPXXXXXXXXXXXXXXXXXXXXXXXXMGTL 471
             EE  +   KE++TKK+E+SASLEVQQQNRP                           L
Sbjct: 397 LGEEISSQVRKEDITKKIEFSASLEVQQQNRPLAELQKHMHNQQLLTDDDDELFYLKDIL 456

Query: 472 SNIHMTYYQMLSQENEPEPNLMEIIPSLKQKVFQNCFFVFSGLIPLGTDIQRSDIVIWTS 531
            N+   YY+ L  + E +  +  ++P LK+KV + C FVFSGLIPLGT+IQ++DIV+WT+
Sbjct: 457 KNVQQKYYEELKTDKEIQ--IQTLMPKLKKKVLEGCNFVFSGLIPLGTNIQKADIVLWTN 514

Query: 532 TFGATSTSDIDFLTTHLITKNPSTYKARLAKKFNPEIKIVHPDWIFECLVNWKKVDEKPY 591
            FGA S++DI   TTH+ITK P TYKA++AK F  +IK++HPDW+FECL+NWK + E PY
Sbjct: 515 MFGAQSSADITEDTTHVITKTPHTYKAKIAKAFKSDIKVLHPDWVFECLLNWKYMPEFPY 574

Query: 592 TLIVDSPISDEELQNFQSQLQKRQEYL--------EENQEQQHMLTSQE--NLNLFATGT 641
              +    +D+EL  F+  L++R++          EE+ E      S +  +++LFA+G 
Sbjct: 575 EYNIIPTATDKELNEFKEALERRKKKETKTKITVSEESLEGDSNSPSSQGASVDLFASGA 634

Query: 642 SWL 644
           SWL
Sbjct: 635 SWL 637

>TBLA0D03260 Chr4 (810350..812656) [2307 bp, 768 aa] {ON} Anc_8.839
           YMR277W
          Length = 768

 Score =  745 bits (1923), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/767 (52%), Positives = 505/767 (65%), Gaps = 49/767 (6%)

Query: 1   MTTQIRSPEGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERASETGVDD----NEH 56
           M+T + SP  LP+PI ID+LI  +GS++ +G RL  YKFWY+VE A     +D    N  
Sbjct: 1   MSTPVLSPADLPFPITIDQLITPIGSHVEKGQRLFAYKFWYMVEIAQSPDNNDPTSENSS 60

Query: 57  DASPGGGAGSN----GVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEVATANQVICEI 112
           D S G  + SN      S   K +RESIEFFESP+EGDLI WNVD GDE+ + NQ++C+I
Sbjct: 61  DLS-GNNSDSNENGNNASHQKKSIRESIEFFESPFEGDLIGWNVDKGDEIISENQLLCDI 119

Query: 113 KRPCNHDIVYGGLCTQCGKEVS-ADAFDGVPLDVVGDMDLQISETEAIRTGKALKEHLRR 171
           KRPCNHDIVY G+CTQCGKEV  +D  D        D +L+IS  EA    ++    L++
Sbjct: 120 KRPCNHDIVYAGICTQCGKEVDDSDIMDASLSISHTDTNLKISRKEARDIDQSSMSRLKK 179

Query: 172 DKKLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNED 231
            KKLILVVDLDQT+IHCGVDPTI EWKNDP NPN+ETL+DV+SF+LDEE +LP  YM   
Sbjct: 180 IKKLILVVDLDQTVIHCGVDPTIGEWKNDPKNPNYETLKDVRSFSLDEEPILPPSYMGP- 238

Query: 232 GSVLRPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGKLF 291
                 PPVRKCWYYVKVRPGLKEFFAK+APL+EMHIYTMATRAYAL+IAKI+DP G LF
Sbjct: 239 -----RPPVRKCWYYVKVRPGLKEFFAKIAPLYEMHIYTMATRAYALEIAKIIDPDGSLF 293

Query: 292 GDRILSRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDI 351
           G RILSRDENGSLT KSL +LFPTDQSMV++IDDRGDVWNWC NLIKV+PYNFFVG+GDI
Sbjct: 294 GSRILSRDENGSLTQKSLERLFPTDQSMVIIIDDRGDVWNWCNNLIKVIPYNFFVGIGDI 353

Query: 352 NSNFLPKQSTGMLQLGRKTRQKSQ----------------------ESQELLTDIMDNEK 389
           NSNFLP+Q + MLQLG ++ +K                        +++ELLTDIMD EK
Sbjct: 354 NSNFLPRQQSTMLQLGIRSHKKKNTNETLNSEDDKSDSTLSVHEKDKTEELLTDIMDTEK 413

Query: 390 KLQEKIDKEVKRQEEKLNHQLATAEEPPANE-SKEELTKKLEYSASLEVQQQNRPXXXXX 448
           KLQ+KID+EV+RQE+KL        +  ++E S  EL+KK+E+SASLEVQQQNRP     
Sbjct: 414 KLQKKIDEEVRRQEKKLIKDEMPKRKSISDESSNNELSKKIEFSASLEVQQQNRPLATLQ 473

Query: 449 XXXXXXXXXXXXXXXXXXXMGTLSNIHMTYYQMLSQENEPEPNLMEIIPSLKQKVFQNCF 508
                                 L+ +H T+Y+ L ++     ++  ++P LK  VF    
Sbjct: 474 RHRQNQRLLIDDDDELFYLKDILTEVHDTFYEQLDEDKNESVSIQTLMPRLKFSVFSGYN 533

Query: 509 FVFSGLIPLGTDIQRSDIVIWTSTFGATSTSDIDFLTTHLITKNPSTYKARLAKKFNPEI 568
           FVFSGLIPLGTDI+R+DIV+WT+ FGA ST+DID  TTH+ITK   TYKARLAK FNPEI
Sbjct: 534 FVFSGLIPLGTDIRRADIVLWTNMFGANSTADIDENTTHVITKTAGTYKARLAKAFNPEI 593

Query: 569 KIVHPDWIFECLVNWKKVDEKPYTLIVDSPISDEELQNFQSQLQKRQEYLE----ENQEQ 624
           K+VHPDWIFECLV+WK++ EKPY LI++ P S+EEL+ F+ +L+ + E LE    E + Q
Sbjct: 594 KVVHPDWIFECLVSWKRMPEKPYELIIEQPASEEELEEFKKKLELKNELLEKREMETEAQ 653

Query: 625 QHMLTSQE-NLNLFATGTSWLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGIDRKRS 683
              L +++  ++LFA+GTSWL                                  D KRS
Sbjct: 654 FEALNTRDPAIDLFASGTSWLNDDDDDIPISDSDSSIESDTEKNEEDYEPNLS--DGKRS 711

Query: 684 IEDNHEDTSQKKTKAEPLQDGPVQQKREGDDNEDSDSQLEEELMDML 730
            ++   D  +   K + L +   + K+   + E  D+ LEEEL++ L
Sbjct: 712 FKEESTDQMRNNKKLKILDESESEVKK---NEEQEDTDLEEELLNAL 755

>TPHA0I00240 Chr9 (43854..46052) [2199 bp, 732 aa] {ON} Anc_8.839
           YMR277W
          Length = 732

 Score =  730 bits (1885), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/664 (56%), Positives = 460/664 (69%), Gaps = 39/664 (5%)

Query: 1   MTTQIRSPEGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERAS---ETGVDDNEHD 57
           M T ++ P+G+PYPI I KLI  VGSY+++GDRL  YKFWYLVE A    E  V+ N  D
Sbjct: 1   MATPVKFPDGMPYPITISKLIAPVGSYINKGDRLFAYKFWYLVEIAKSPDELDVNGNVQD 60

Query: 58  ASPGGGAGSNGVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEVATANQVICEIKRPCN 117
                           K +RESI+FF++P+EG +I WNVDVGDE+    +++CE+KRPC+
Sbjct: 61  GEQS-----------KKTIRESIDFFDAPFEGTIIGWNVDVGDEIVEPGRIVCEVKRPCD 109

Query: 118 HDIVYGGLCTQCGKEVSADAFDGVPLDVV---GDMDLQISETEAIRTGKALKEHLRRDKK 174
           HDIVY G+CT CGKEV  D  D V  ++     D +L++S  EA   G+  K  L R KK
Sbjct: 110 HDIVYAGICTMCGKEV--DERDQVSANLTISHTDTNLKVSRQEANNIGQTNKSRLIRSKK 167

Query: 175 LILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGSV 234
           LILVVDLDQT+IHCGVDPTI+EWKNDP+NPN+ETLR+VKSF L+EE +LP MYM      
Sbjct: 168 LILVVDLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGP---- 223

Query: 235 LRPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGKLFGDR 294
              PPV KC YYVKVRPGLKEFF KVAP++EMHIYTMATRAYA +IAKI+DP G LFG+R
Sbjct: 224 --KPPVHKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSLFGNR 281

Query: 295 ILSRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSN 354
           ILSRDENGSLT KSL +LFPTDQSMVV+IDDRGDVWNW PNLIKV PYNFFVG+GDINSN
Sbjct: 282 ILSRDENGSLTHKSLERLFPTDQSMVVIIDDRGDVWNWSPNLIKVTPYNFFVGIGDINSN 341

Query: 355 FLPKQSTGMLQLGRKTRQK--SQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLAT 412
           FLP+Q   MLQ+GR+       +ES+ELLTDI+D EKKLQEKIDKEVKRQE  L H+ A 
Sbjct: 342 FLPRQQATMLQMGRRNHNAEKEKESEELLTDIIDTEKKLQEKIDKEVKRQEADLTHKSAA 401

Query: 413 -AEEPPANESKEELTKKLEYSASLEVQQQNRPXXXXXXXXXXXXXXXXXXXXXXXXMGTL 471
             EE  A     ++TKK+E+SASLEVQQQNRP                           L
Sbjct: 402 LGEEAVAQVRNGDITKKIEFSASLEVQQQNRPLAELQKHMHNQQLLRDDDDELSYLKEIL 461

Query: 472 SNIHMTYYQMLSQE--NEPEPNLMEIIPSLKQKVFQNCFFVFSGLIPLGTDIQRSDIVIW 529
           + +   +Y+ L  +  N  + ++ E++P LK+ VF++C FVFSGLIPLGTDIQ++DIV+W
Sbjct: 462 ATVQSEFYKALELKNGNSDDTSIQELMPKLKRSVFKDCNFVFSGLIPLGTDIQKADIVLW 521

Query: 530 TSTFGATSTSDIDFLTTHLITKNPSTYKARLAKKFNPEIKIVHPDWIFECLVNWKKVDEK 589
           T  FGA+STS+I   TTH+ITK P T KAR+AK FNP IK+VHPDW+FECL  WK VDEK
Sbjct: 522 TKMFGASSTSNITENTTHVITKTPGTLKARIAKSFNPSIKVVHPDWVFECLSTWKHVDEK 581

Query: 590 PYTLIVDSPISDEELQNFQSQLQKRQEYL---------EENQEQQHMLTSQENLNLFATG 640
            + L VD   S+ EL+ F+  L+KR +           + N     M ++   ++LFA G
Sbjct: 582 SFELKVDQVASERELEEFKKNLEKRNKNKLTDAVNFSGDLNNGTATMSSTDNVVDLFAGG 641

Query: 641 TSWL 644
           +SWL
Sbjct: 642 SSWL 645

>KNAG0J00280 Chr10 complement(41831..44059) [2229 bp, 742 aa] {ON}
           Anc_8.839 YMR277W
          Length = 742

 Score =  726 bits (1875), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/761 (50%), Positives = 495/761 (65%), Gaps = 58/761 (7%)

Query: 3   TQIRSPEGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERASETGVDDNEHDASPGG 62
           T + S  GLPYP+ +D+LIP VG  +  GDRL  YKFWY+VE A   GVD      S G 
Sbjct: 7   TPVVSGAGLPYPVTVDELIPQVGDRVSRGDRLFAYKFWYVVELA---GVDAAAEGDSDGT 63

Query: 63  GAGSNGVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEVATANQVICEIKRPCNHDIVY 122
           G  +       K +RES+EFFESP+EG ++SW+VD GDE+      +C ++RPCNHD+VY
Sbjct: 64  GTTAK------KSVRESVEFFESPFEGTVVSWDVDAGDEIPGPGAPLCLLRRPCNHDVVY 117

Query: 123 GGLCTQCGKEVSADAFDGVPLDVVG----------DMDLQISETEAIRTGKALKEHLRRD 172
            GLCT CG+EV             G          D +LQIS  EA +    L++ LR  
Sbjct: 118 NGLCTLCGREVDEYEIQAAAAASGGVGPNLTVSHRDTNLQISRVEAQQLDLQLQQRLRAA 177

Query: 173 KKLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDG 232
           +KL+LVVDLDQT++HCGVDPTI EWK DP NPN+E LRDV+SF L+EE +LP +Y+    
Sbjct: 178 QKLVLVVDLDQTVVHCGVDPTIGEWKRDPRNPNYEALRDVQSFALEEEPILPFLYVGGK- 236

Query: 233 SVLRPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGKLFG 292
              RP P RKCWYYVKVRPGLK+FF ++APLFEMHIYTMATRAYAL+IAKI+DP   LFG
Sbjct: 237 ---RPAP-RKCWYYVKVRPGLKQFFKRLAPLFEMHIYTMATRAYALEIAKIIDPDKSLFG 292

Query: 293 DRILSRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDIN 352
           DRILSRDENGSLT KSL +LFPTDQSMV VIDDRGDVWNWC NLIKVVPYNFFVGVGDIN
Sbjct: 293 DRILSRDENGSLTHKSLERLFPTDQSMVTVIDDRGDVWNWCANLIKVVPYNFFVGVGDIN 352

Query: 353 SNFLPKQSTGMLQLGRKTR--QKSQESQE---------LLTDIMDNEKKLQEKIDKEVKR 401
           SNFLPKQ   MLQ+GR+++  ++  ES++         LLTDIM+ EK+LQEKID+EVKR
Sbjct: 353 SNFLPKQQPTMLQMGRRSKLNERGHESKQQQDDVKDDLLLTDIMNTEKQLQEKIDQEVKR 412

Query: 402 QEEKLNHQLATAEEPPA-NESKEELTKKLEYSASLEVQQQNRPXXXXXXXXXXXXXXXXX 460
           QE KLN   A  +E     +SKEE TKKLE+SAS+EVQQ+NRP                 
Sbjct: 413 QEHKLNKGNAAGDEQQTPGQSKEEWTKKLEFSASVEVQQKNRPLATLQKHLHNQKLLVDN 472

Query: 461 XXXXXXXMGTLSNIHMTYYQMLSQENEPEPNLMEIIPSLKQKVFQNCFFVFSGLIPLGTD 520
                     L+++H  YY  L +EN  + N+  I+  LK +VFQ+C FVFSGLIPL T+
Sbjct: 473 DDELFYLKDRLADLHKRYYSTL-KENPQDTNIQSIMTQLKTRVFQDCHFVFSGLIPLNTN 531

Query: 521 IQRSDIVIWTSTFGATSTSDIDFLTTHLITKNPSTYKARLAKKFNPEIKIVHPDWIFECL 580
           +Q +DIVIWT+ FGAT+T+D+D  TTHLITK P T KARLAK FNP+IKIVHPDWIFECL
Sbjct: 532 VQAADIVIWTNKFGATTTNDLDETTTHLITKTPGTNKARLAKAFNPDIKIVHPDWIFECL 591

Query: 581 VNWKKVDEKPYTLIVDSPISDEELQNFQSQLQKRQEYLEENQEQQHMLTSQE----NLNL 636
           + W++VD KPY LIV+ P+S+ +++ F+ +L +++E  E    +  +L + +    +++L
Sbjct: 592 IKWERVDVKPYLLIVEDPVSEAQVREFKEKLTRQKERAERQTSRTALLPANKPAEPDIDL 651

Query: 637 FATGTSWLXXXXXXXXXXXXXXXXXXXXXXXXXXXXX------XXXGIDRKRSIEDNHED 690
           FA G SWL                                      G   KRS+ +N + 
Sbjct: 652 FAGGISWLNDEDDEEIPKEDEESEDDEDENDENNTTMLDDGEPETGGTPDKRSLFENPDQ 711

Query: 691 TSQKKTKAEPLQDGPVQQKREGDDNEDSDSQLEEELMDMLD 731
            ++KK +   +QD         + + +SDS+LE+EL+++LD
Sbjct: 712 PAEKKPR---IQD--------AEPSSESDSELEDELLNVLD 741

>SAKL0D01496g Chr4 complement(120202..122268) [2067 bp, 688 aa] {ON}
           similar to uniprot|Q03254 Saccharomyces cerevisiae
           YMR277W FCP1 Carboxy-terminal domain (CTD) phosphatase
          Length = 688

 Score =  707 bits (1824), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/651 (54%), Positives = 451/651 (69%), Gaps = 34/651 (5%)

Query: 1   MTTQIRSPEGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERASETGVDDNEHDASP 60
           MTT ++ P+ LPYPI I +L  S G  + +G RL  YK+W   +  +           SP
Sbjct: 1   MTTALKLPDNLPYPITIAQLCASTGDPIKKGQRLFAYKYWEFQDVVT-----------SP 49

Query: 61  GGGAGSNGVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEVATANQVICEIKRPCNHDI 120
              +     + P KQ  + I  F+SP EG L+S+N+ +GDE   +N V+ EIK+ C HD+
Sbjct: 50  NDTS-----TKPKKQRVDLIGTFDSPVEGALVSFNLSLGDEFVNSNHVVAEIKQACTHDV 104

Query: 121 VYGGLCTQCGKEV----SADAFDGVPLDVV---GDMDLQISETEAIRTGKALKEHLRRDK 173
            YGGLC  CGK V    S  A D     +     + +++ISE +A    +  ++ LR+ K
Sbjct: 105 TYGGLCVICGKSVEEYSSNSASDPSQNKLTMSHTNTNIKISERQAAAIEETAQKQLRKLK 164

Query: 174 KLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGS 233
           KL+LVVDLDQT+IHCGVDPTI EW  DP NPN+E L+D+KSF L EE +LP  YM     
Sbjct: 165 KLVLVVDLDQTVIHCGVDPTIGEWSRDPKNPNYEALKDIKSFALVEEPILPPFYMGPK-- 222

Query: 234 VLRPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGKLFGD 293
               PP RKCWYYVK+RPGLKEFF K+AP FE+HIYTMATRAYAL+IAKI+DP GKLFGD
Sbjct: 223 ----PPARKCWYYVKLRPGLKEFFEKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGD 278

Query: 294 RILSRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINS 353
           RILSRDENGS+T KSL +LFP DQSMVV+IDDRGDVWNWC NLIKVVPY+FFVGVGDINS
Sbjct: 279 RILSRDENGSITHKSLERLFPMDQSMVVIIDDRGDVWNWCENLIKVVPYSFFVGVGDINS 338

Query: 354 NFLPKQSTGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLATA 413
           NFLP+Q   ML LGR+ R+K++E +ELLTDI+D EKKLQEKID+EVKRQEEKL+ ++   
Sbjct: 339 NFLPRQQNSMLHLGRRHRKKAEE-EELLTDILDTEKKLQEKIDEEVKRQEEKLS-KMTEE 396

Query: 414 EEPPANESKEELTKKLEYSASLEVQQQNRPXXXXXXXXXXXXXXXXXXXXXXXXMGTLSN 473
           ++P    SKE+L KKLE+SASLEVQQQNRP                           L  
Sbjct: 397 KQPEDTNSKEDLAKKLEHSASLEVQQQNRPLAELQKHLHNQKLLIDDDDELPHLSRILLQ 456

Query: 474 IHMTYYQMLSQENEPEPNLMEIIPSLKQKVFQNCFFVFSGLIPLGTDIQRSDIVIWTSTF 533
           +H  YY+ LS+ + P PN+  ++P LK++VF  C FVFSGLIPLGTD++++DI +WTS F
Sbjct: 457 VHGKYYEDLSKHSSP-PNIKNLMPQLKKRVFCKCSFVFSGLIPLGTDVRKADIALWTSMF 515

Query: 534 GATSTSDIDFLTTHLITKNPSTYKARLAKKFNPEIKIVHPDWIFECLVNWKKVDEKPYTL 593
           GA +T+DID  TTH+ITK P T+KARLAK FNPEIK+VHPDWIFECLVNWK+VDEK Y L
Sbjct: 516 GAKTTADIDEATTHIITKTPGTFKARLAKAFNPEIKVVHPDWIFECLVNWKRVDEKAYEL 575

Query: 594 IVDSPISDEELQNFQSQLQKRQEYLEENQEQQHMLTSQENLNLFATGTSWL 644
           +++ P+S+EEL +F+ +L+  ++  +  +E   +  S + +NL A   SWL
Sbjct: 576 LIEQPVSEEELDDFKKKLENEKKDAQIQEEVDRV--SSDEINLLAGNDSWL 624

>Kwal_27.10263 s27 complement(268744..270975) [2232 bp, 743 aa] {ON}
           YMR277W (FCP1) - TFIIF interacting component of CTD
           phosphatase [contig 37] FULL
          Length = 743

 Score =  687 bits (1773), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/652 (54%), Positives = 448/652 (68%), Gaps = 35/652 (5%)

Query: 1   MTTQIRSPEGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERASETGVDDNEHDASP 60
           MTT IR P  LP+PI I KL  S G  + +G RL VYK+W L +  +             
Sbjct: 1   MTTPIRLPPNLPFPITIAKLYVSKGESVTKGQRLFVYKYWELQDVIT------------- 47

Query: 61  GGGAGSNGVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEVATANQVICEIKRPCNHDI 120
                 N  +   K+  + I  F+SP EG L+S  V VGDE    + +I E+++PC+H++
Sbjct: 48  ----APNEEASKKKRRVDLIGTFDSPIEGTLVSLKVRVGDEFVNDSNIIAELRQPCSHEV 103

Query: 121 VYGGLCTQCGKEVSAD----AFDGVP---LDVV-GDMDLQISETEAIRTGKALKEHLRRD 172
            YG LC  CGK V  D    +  GV    L V   + ++++SE +A    K  ++ LR  
Sbjct: 104 TYGALCVVCGKAVDEDDSNMSGSGVSNGKLTVAHNNTNIKVSERQAASIEKTAQKELRER 163

Query: 173 KKLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDG 232
           KKL+LVVDLDQT+IHCGVDPTI EW NDP+NPN++ L++VK+F+LDE+ +LP  YM    
Sbjct: 164 KKLVLVVDLDQTVIHCGVDPTIKEWANDPSNPNYDALKNVKTFSLDEDPILPPFYMGP-- 221

Query: 233 SVLRPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGKLFG 292
              RPPP R+C YYVK+RPGL+EFF KVAP FE+HIYTMATRAYAL+IAKI+DPT  LFG
Sbjct: 222 ---RPPP-RRCQYYVKLRPGLQEFFDKVAPHFELHIYTMATRAYALEIAKIIDPTSALFG 277

Query: 293 DRILSRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDIN 352
           DRILSRDENGSLT KSL +LFP DQSMVV+IDDRGDVW+WC NLIKVVPYNFFVGVGDIN
Sbjct: 278 DRILSRDENGSLTHKSLERLFPMDQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDIN 337

Query: 353 SNFLPKQSTGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLAT 412
           SNFLP+Q   ML +GR+ R+K++E +ELLTDIMD EKKLQEKID+EVK+QEEK N +++ 
Sbjct: 338 SNFLPRQQNSMLHMGRRHRKKAEE-EELLTDIMDTEKKLQEKIDQEVKKQEEKFN-KISE 395

Query: 413 AEEPPANESKEELTKKLEYSASLEVQQQNRPXXXXXXXXXXXXXXXXXXXXXXXXMGTLS 472
             +P  + SKE+LTKKLE++ASLEVQQQNRP                           L 
Sbjct: 396 ENQPDRSMSKEDLTKKLEHNASLEVQQQNRPLAELQKHMNNQKLLIDDDDELPHLSEILL 455

Query: 473 NIHMTYYQMLSQENEPEPNLMEIIPSLKQKVFQNCFFVFSGLIPLGTDIQRSDIVIWTST 532
           N+H TYY+ L++  E  P++  ++P +K KVF  C FVFSGLIPLGT+I+ +DIV+WT+ 
Sbjct: 456 NVHRTYYEELAK-TEVFPDIKLLMPQMKAKVFAQCHFVFSGLIPLGTNIRHADIVLWTNM 514

Query: 533 FGATSTSDIDFLTTHLITKNPSTYKARLAKKFNPEIKIVHPDWIFECLVNWKKVDEKPYT 592
           FGA ++SDID  TTH+ITK P T+KARLAK +NP+IKIVHPDWIFECLV W + DEKPY 
Sbjct: 515 FGAQTSSDIDENTTHVITKTPGTFKARLAKSYNPDIKIVHPDWIFECLVKWVRADEKPYE 574

Query: 593 LIVDSPISDEELQNFQSQLQKRQEYLEENQEQQHMLTSQENLNLFATGTSWL 644
           LI++  +S +EL+ FQ  L+KRQ   +  +E     T +E LNL A    WL
Sbjct: 575 LIIEQEVSSDELEEFQRNLKKRQMAEKAARESLQQETGEE-LNLLAGNDMWL 625

>Ecym_4610 Chr4 (1188871..1191126) [2256 bp, 751 aa] {ON} similar to
           Ashbya gossypii ABL127W
          Length = 751

 Score =  686 bits (1770), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/658 (51%), Positives = 440/658 (66%), Gaps = 35/658 (5%)

Query: 1   MTTQIRSPEGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERASETGVDDNEHDASP 60
           M+T IR P+ LPYPI + +L  S G  +  G RL  YK+W   +  +  G      D S 
Sbjct: 1   MSTPIRLPDNLPYPITVAQLAVSAGDMVERGQRLFAYKYWDFEQIVTSPG------DESA 54

Query: 61  GGGAGSNGVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEVATANQVICEIKRPCNHDI 120
           GG +         +Q  + +  F+SP  G ++S N+ +GDE   +   + EIK+PC HD+
Sbjct: 55  GGKS--------KRQRIDLVGTFDSPVSGQVVSLNITLGDEFVNSQCTVAEIKQPCTHDV 106

Query: 121 VYGGLCTQCGKEVSADAFDGVPLDVVG-------DMDLQISETEAIRTGKALKEHLRRDK 173
            YGGLC QCG+ V  +   G  LD          +M+++ISE +A    K+ ++ LR  +
Sbjct: 107 TYGGLCVQCGQTVEDEQTSGSLLDNQAKLTMSHTNMNIRISEKQAYTLEKSAQKQLREAR 166

Query: 174 KLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGS 233
           KL+LVVDLDQT+IHCGVDPTI EW  DP+NPN+E+L+DV+SF+L EE VLP  YM     
Sbjct: 167 KLVLVVDLDQTVIHCGVDPTIGEWSKDPDNPNYESLKDVRSFSLHEEPVLPPFYMGP--- 223

Query: 234 VLRPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGKLFGD 293
               PP RKCWYYVK+RPGL++FF+ +AP FE+HIYTMATR YAL+IAKI+DP G LFGD
Sbjct: 224 ---KPPTRKCWYYVKLRPGLQDFFSNIAPHFELHIYTMATRTYALEIAKIIDPDGTLFGD 280

Query: 294 RILSRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINS 353
           RILSRDENGSLT KSL +LFP DQSMVV+IDDRGDVWNWC NLIKVVPY+FFVG+GDINS
Sbjct: 281 RILSRDENGSLTQKSLERLFPMDQSMVVIIDDRGDVWNWCENLIKVVPYDFFVGIGDINS 340

Query: 354 NFLPKQSTGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLATA 413
           NFLP+Q   ML LGR+ R+K ++ +ELLTDI+D EKKL+ KI +EVKRQEE++  +L+  
Sbjct: 341 NFLPRQQNSMLHLGRRNRKKLKQDEELLTDILDTEKKLKVKISEEVKRQEEEM-QKLSEE 399

Query: 414 EEPPANESKEELTKKLEYSASLEVQQQNRPXXXXXXXXXXXXXXXXXXXXXXXXMGTLSN 473
           + P    SKE++ KKLE++ASLEVQQQNRP                           L  
Sbjct: 400 KIPDHTTSKEDIAKKLEHNASLEVQQQNRPLAELQKHLHNERLLIDDDDELPHLTDILLR 459

Query: 474 IHMTYYQMLSQE----NEPEPNLMEIIPSLKQKVFQNCFFVFSGLIPLGTDIQRSDIVIW 529
           +H  YY  L +      E  P++  +IPSLK+ VF+ C FVFSGLIPL T+I R+DIV+W
Sbjct: 460 VHSAYYDQLEKNKHGATELSPDIKHLIPSLKEIVFKGCNFVFSGLIPLHTNIDRADIVLW 519

Query: 530 TSTFGATSTSDIDFLTTHLITKNPSTYKARLAKKFNPEIKIVHPDWIFECLVNWKKVDEK 589
           T+TFGA +T +ID+ TTHLITK P T KARLA  FN +IKIVHPDWIFEC+VNWK+VDEK
Sbjct: 520 TNTFGAKTTINIDYNTTHLITKTPGTMKARLASSFNRDIKIVHPDWIFECIVNWKRVDEK 579

Query: 590 PYTLIVDSPISDEELQNFQSQL---QKRQEYLEENQEQQHMLTSQENLNLFATGTSWL 644
           PY LIV+ P+S E L+NF+ +L   +K +  ++ N   Q   T  + + L     SWL
Sbjct: 580 PYELIVEEPVSKEYLENFKKELEETEKSKNSVDANISSQKYETFNDAMILLGGSDSWL 637

>KLTH0C03894g Chr3 complement(339897..342134) [2238 bp, 745 aa] {ON}
           similar to uniprot|Q03254 Saccharomyces cerevisiae
           YMR277W FCP1 Carboxy-terminal domain (CTD) phosphatase
          Length = 745

 Score =  683 bits (1763), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/646 (53%), Positives = 443/646 (68%), Gaps = 35/646 (5%)

Query: 1   MTTQIRSPEGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERASETGVDDNEHDASP 60
           MTT IR P  LP+P+ I KL  S G  + +G RL VYK+W L +  +             
Sbjct: 1   MTTPIRLPSNLPFPVTIAKLCVSTGDSVKKGQRLFVYKYWELQDIIT------------- 47

Query: 61  GGGAGSNGVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEVATANQVICEIKRPCNHDI 120
                 N  +P  K+  + I  F+SP EG L+S N+ +GDE      VI E+ + C+H++
Sbjct: 48  ----APNEEAPKKKRRVDLIGTFDSPVEGTLVSLNIGLGDEFVNDANVIAEVNQLCSHEV 103

Query: 121 VYGGLCTQCGKEVSAD-------AFDGVPLDVV-GDMDLQISETEAIRTGKALKEHLRRD 172
            YGGLC  CGK V  D             L V   + ++++SE +A    K  ++HLR  
Sbjct: 104 TYGGLCVVCGKTVEEDDQNVSDNGISNSKLTVAHNNTNIKVSERQAATIEKTAQKHLREH 163

Query: 173 KKLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDG 232
           KKL+LVVDLDQT+IHCGVDPTI EW NDP+NPN++ L++VK+F+LDE+ +LP  YM    
Sbjct: 164 KKLVLVVDLDQTVIHCGVDPTIHEWANDPSNPNYDALKNVKTFSLDEDPILPPFYMGP-- 221

Query: 233 SVLRPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGKLFG 292
              RPPP RKC YYVK+RPGL+EFF K+AP FE+HIYTMATRAYAL+IAKI+DP G+LFG
Sbjct: 222 ---RPPP-RKCQYYVKLRPGLQEFFDKIAPHFELHIYTMATRAYALEIAKIIDPKGELFG 277

Query: 293 DRILSRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDIN 352
           DRILSRDENGSLT KSL +LFP DQSMVV+IDDRGDVW+WC NLIKVVPYNFFVGVGDIN
Sbjct: 278 DRILSRDENGSLTHKSLERLFPMDQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDIN 337

Query: 353 SNFLPKQSTGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLAT 412
           SNFLP+Q   ML LGR+ R+K++E +ELLTDIMD EKKLQEKID+EVK+QEEK N ++  
Sbjct: 338 SNFLPRQQNSMLHLGRRNRKKAEE-EELLTDIMDTEKKLQEKIDQEVKKQEEKFN-KINE 395

Query: 413 AEEPPANESKEELTKKLEYSASLEVQQQNRPXXXXXXXXXXXXXXXXXXXXXXXXMGTLS 472
             +P    SKE+LTKKLE++ASLEVQQQNRP                           L 
Sbjct: 396 ENQPERPISKEDLTKKLEHNASLEVQQQNRPLAELQKHMNNQKLLTDDDDELPHLSNILL 455

Query: 473 NIHMTYYQMLSQENEPEPNLMEIIPSLKQKVFQNCFFVFSGLIPLGTDIQRSDIVIWTST 532
           N+H TYY  L+++ +P P++  ++P +K +VF+ C FVFSGLIPLGT+++++DIV+WTS 
Sbjct: 456 NVHKTYYDKLAEQGQP-PDIKTLMPQMKSQVFKRCHFVFSGLIPLGTNVRQADIVLWTSM 514

Query: 533 FGATSTSDIDFLTTHLITKNPSTYKARLAKKFNPEIKIVHPDWIFECLVNWKKVDEKPYT 592
           FGAT++ D+D  TTH+ITK P T+KARLAK +NP IK++HPDWIFECLV W +V+EKPY 
Sbjct: 515 FGATTSVDVDEATTHVITKTPGTFKARLAKTYNPNIKVIHPDWIFECLVKWVRVNEKPYE 574

Query: 593 LIVDSPISDEELQNFQSQLQKRQEYLEENQEQQHMLTSQENLNLFA 638
           L  +  +S EEL+ F+ +L K+++  +   E      +QE LNL  
Sbjct: 575 LTTEQDVSPEELEEFKKRLDKKKQSEKALSESIQQEATQE-LNLLT 619

>ABL127W Chr2 (156798..158984) [2187 bp, 728 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR277W (FCP1)
          Length = 728

 Score =  677 bits (1748), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/653 (52%), Positives = 445/653 (68%), Gaps = 40/653 (6%)

Query: 1   MTTQIRSPEGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERASETGVDDNEHDASP 60
           M+T IR P+ LPYPI I +L  S G  + +G RLL YK+W LV+  +  G ++       
Sbjct: 1   MSTPIRLPDSLPYPITIAQLGVSTGDTVEKGQRLLAYKYWDLVDVITAPGEEE------- 53

Query: 61  GGGAGSNGVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEVATANQVICEIKRPCNHDI 120
            G A         KQ  + +  F+SP  G ++S +V VGDE   + + + EI++ C HD+
Sbjct: 54  AGKA--------RKQRVDLVGTFDSPVAGTVVSLDVRVGDEFVNSQRPVVEIRQACPHDV 105

Query: 121 VYGGLCTQCGKEV-----SADAFDGVPLDVV-GDMDLQISETEAIRTGKALKEHLRRDKK 174
            YGGLC QCG+ V     +AD  +   L V   +  +++SE +A   G++ +  LR  +K
Sbjct: 106 TYGGLCVQCGQAVEDEAGAADGVEQAKLTVSHTNTHIRVSERQAASLGQSAQLKLREARK 165

Query: 175 LILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGSV 234
           L+LVVDLDQT+IHCGVDPTI EW  DPNNPN+E L+DV+SF+LDEE VLP  YM      
Sbjct: 166 LVLVVDLDQTVIHCGVDPTIGEWSKDPNNPNYEALKDVQSFSLDEEPVLPPFYMGPK--- 222

Query: 235 LRPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGKLFGDR 294
              PP RKCWYYVK+RPGLKEFFAK+AP FE+HIYTMATRAYAL+IAKI+DP GKLFGDR
Sbjct: 223 ---PPTRKCWYYVKLRPGLKEFFAKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGDR 279

Query: 295 ILSRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSN 354
           ILSRDENGSLT KSL +LFP DQSMVVVIDDRGDVWNWC NLIKVVPY+FFVG+GDINSN
Sbjct: 280 ILSRDENGSLTQKSLERLFPMDQSMVVVIDDRGDVWNWCENLIKVVPYDFFVGIGDINSN 339

Query: 355 FLPKQSTGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLATAE 414
           FLP Q   ML LGR+ R+K ++ +ELLTDI+D EKKL+EKI++EVKRQE+++ H+L   +
Sbjct: 340 FLPIQQNSMLHLGRRNRKKPKQEEELLTDILDTEKKLKEKINEEVKRQEDQM-HRLTDEK 398

Query: 415 EPPANESKEELTKKLEYSASLEVQQQNRPXXXXXXXXXXXXXXXXXXXXXXXXMGTLSNI 474
            P       ++ KKLE++ASLEVQQQNRP                           L  +
Sbjct: 399 LP----DTRDIAKKLEHNASLEVQQQNRPLAELQKHMRNERLLFDDDDELPHLGNILLKV 454

Query: 475 HMTYYQMLSQEN---EPEPNLMEIIPSLKQKVFQNCFFVFSGLIPLGTDIQRSDIVIWTS 531
           H  YY  L + N   +P P++  ++P LK+ VF+ C FVFSGLIPL T+I+R+DIV+WT+
Sbjct: 455 HSAYYDQLQRYNSGEDPIPDIKILMPKLKETVFEGCRFVFSGLIPLHTNIERADIVLWTN 514

Query: 532 TFGATSTSDIDFLTTHLITKNPSTYKARLAKKFNPEIKIVHPDWIFECLVNWKKVDEKPY 591
            FGA++T+++D+ TTHLIT+ P T KARLAK FNP IKIVHPDWIFECLV W++V+E PY
Sbjct: 515 MFGASTTANLDYNTTHLITRTPGTMKARLAKSFNPAIKIVHPDWIFECLVGWERVEESPY 574

Query: 592 TLIVDSPISDEELQNFQSQLQKRQEYLEENQEQQHMLTSQENLNLFATGTSWL 644
            LIV+ P+ +E L+NF+  L + Q+ ++   +      S+ +L L     SWL
Sbjct: 575 ELIVEEPVGEEYLENFKRDLAEAQKKVDPPAQD-----SRSSLLLLDGNGSWL 622

>KLLA0D01595g Chr4 complement(141459..143618) [2160 bp, 719 aa] {ON}
           similar to uniprot|Q03254 Saccharomyces cerevisiae
           YMR277W FCP1 Carboxy-terminal domain (CTD) phosphatase ,
          Length = 719

 Score =  628 bits (1620), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/659 (48%), Positives = 428/659 (64%), Gaps = 50/659 (7%)

Query: 1   MTTQIRSPEGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFW----YLVERASETGVDDNEH 56
           + T ++    LPYPI + +L    G ++ +G RL  Y++W     LV+   +T       
Sbjct: 3   LETNVKVTSDLPYPITVAQLYVKPGDHVEKGQRLFAYEYWDFQDVLVKYEEKT------- 55

Query: 57  DASPGGGAGSNGVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEVATANQVICEIKRPC 116
                            KQ  + +  F+SP  G +  W+  V DE A+AN  +  I++ C
Sbjct: 56  ----------------KKQRVDRVATFDSPVSGTVKEWHCSVKDEFASANHEVITIRQDC 99

Query: 117 NHDIVYGGLCTQCGKEVSA-DAFDGVPLDVVGDMDLQISETEAIRTGKALKEHLRRDKKL 175
           NHDI YGGLC QCG  V   D    + +  V + ++++SE +A    ++    LR +KKL
Sbjct: 100 NHDITYGGLCVQCGNTVDEEDNSKNLTISHV-NTNIKVSEQQAETLERSSLTRLREEKKL 158

Query: 176 ILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGSVL 235
           +LVVDLDQT+IHCGVDPTI EW  DP NPN++ L+DVKSFTL++E ++P  Y        
Sbjct: 159 VLVVDLDQTVIHCGVDPTIGEWMRDPKNPNYKALQDVKSFTLEDEPIIPSFYFGP----- 213

Query: 236 RPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGKLFGDRI 295
             PP RK WYYVK+RPGLKEFF  V+P FEMHIYTMATR+YA +IAKI+DPTG+LFGDRI
Sbjct: 214 -KPPARKSWYYVKLRPGLKEFFEAVSPHFEMHIYTMATRSYAHEIAKIIDPTGELFGDRI 272

Query: 296 LSRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNF 355
           LSRDENGSLTTKSL +LFP DQSMVVVIDDRGDVWNW  NLIKVVPY+FFVG+GDINSNF
Sbjct: 273 LSRDENGSLTTKSLERLFPMDQSMVVVIDDRGDVWNWFENLIKVVPYSFFVGIGDINSNF 332

Query: 356 LPKQSTGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNH---QLAT 412
           LP+Q   +L LGR  R+K QE ++L++DI+DNEKKL+EKID+EVKRQEE ++H       
Sbjct: 333 LPRQQNSVLHLGRHHRRK-QEEEKLISDIIDNEKKLKEKIDEEVKRQEEIISHIGDDNTR 391

Query: 413 AEEPPANESKEELTKKLEYSASLEVQQQNRPXXXXXXXXXXXXXXXXXXXXXXXXMGTLS 472
            E  P N  KE+++KKLE+SASLEVQQQNRP                           L 
Sbjct: 392 KEGGPPN--KEDISKKLEHSASLEVQQQNRPLAELQKHLHNQTLLIDDDDELPHLSQILL 449

Query: 473 NIHMTYYQMLSQENEPEPNLMEIIPSLKQKVFQNCFFVFSGLIPLGTDIQRSDIVIWTST 532
            +H  Y+   ++  +  P++  ++P +K KVFQ C FVFSGLIPL TD++++DIV+WT  
Sbjct: 450 RVHKEYFNQYTEAPKNPPDIKYLLPQMKYKVFQGCHFVFSGLIPLETDVRKADIVLWTDM 509

Query: 533 FGATSTSDIDFLTTHLITKNPSTYKARLAKKFNPEIKIVHPDWIFECLVNWKKVDEKPYT 592
           FGAT++SDI++ TTH+IT    T+KARLAK FNP+IKIVHPDW+FECLV W++V E PY 
Sbjct: 510 FGATTSSDINYKTTHIITTTSRTFKARLAKSFNPDIKIVHPDWLFECLVQWERVKESPYE 569

Query: 593 LIVDSPISDEELQNFQSQLQKRQEY-------LEENQEQQHMLTSQENLNLFATGTSWL 644
           L++  P+ +++++ F+ +L K+           E+  E + +L  +   +L A   SWL
Sbjct: 570 LLIQDPVDEDKVKEFKEKLDKKISNPSSSVNPFEDGNEDEEVLGDE--FHLLAGNDSWL 626

>TPHA0E03070 Chr5 (644651..646135) [1485 bp, 494 aa] {ON} Anc_5.202
           YLL010C
          Length = 494

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 38/159 (23%), Positives = 64/159 (40%), Gaps = 35/159 (22%)

Query: 138 FDGVPLDVVGDMDLQISETEAIRTGKALKEHLRRDKKLILVVDLDQTIIHCGVDPTIAEW 197
            DG  +D+      Q+S T    T  A KE  R  +K  L++DLD+T++H          
Sbjct: 288 IDGNLIDLSKLQANQVSAT-GYETLLAPKEIKRFGRKKCLILDLDETLVHSSF------- 339

Query: 198 KNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGSVLRPPPVRKCWYYVKVRPGLKEFF 257
                            +    + V+P+   N+   V           YV  RPG+ EF 
Sbjct: 340 ----------------KYVDSADFVIPVTIDNQTHHV-----------YVIKRPGVDEFL 372

Query: 258 AKVAPLFEMHIYTMATRAYALQIAKIVDPTGKLFGDRIL 296
            +V+ L+E+ ++T +   Y   +  I+DP   +   R+ 
Sbjct: 373 KRVSELYEVVVFTASVSRYGDPLLNILDPANTIIHHRLF 411

>NDAI0D01860 Chr4 (437370..438914) [1545 bp, 514 aa] {ON} Anc_5.202
          Length = 514

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 35/131 (26%), Positives = 56/131 (42%), Gaps = 34/131 (25%)

Query: 166 KEHLRRDKKLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPL 225
           K+ ++   K  LV+DLD+T++H       + +K  PN                 +  LP+
Sbjct: 335 KDEIKFKHKKCLVLDLDETLVH-------SSFKYLPN----------------ADFNLPV 371

Query: 226 MYMNEDGSVLRPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVD 285
              ++  +V           YV  RPG+ EF  KV  LFE+ I+T +   Y   +   +D
Sbjct: 372 NIDDQIHNV-----------YVIKRPGVDEFLEKVGKLFEVVIFTASVSRYGDPLLDRLD 420

Query: 286 PTGKLFGDRIL 296
           P GK    R+ 
Sbjct: 421 PKGKSIHHRLF 431

>SAKL0G12870g Chr7 (1100535..1101734) [1200 bp, 399 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 399

 Score = 44.3 bits (103), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 35/132 (26%), Positives = 58/132 (43%), Gaps = 38/132 (28%)

Query: 174 KLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGS 233
           K  LV+DLD+T++H                 +F+ LR         + V+P+   ++  +
Sbjct: 229 KKCLVLDLDETLVHS----------------SFKYLRTA-------DFVIPVEIDDQVHN 265

Query: 234 VLRPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTG----K 289
           V           YV  RPG+ EF  +V  L+E+ ++T +   Y   +  I+DP G    +
Sbjct: 266 V-----------YVIKRPGVDEFLERVGKLYEVVVFTASVSRYGDPLLDILDPRGAVHHR 314

Query: 290 LFGDRILSRDEN 301
           LF D   + D N
Sbjct: 315 LFRDSCYNYDGN 326

>NCAS0A06800 Chr1 (1346677..1348098) [1422 bp, 473 aa] {ON}
           Anc_5.202
          Length = 473

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/131 (26%), Positives = 58/131 (44%), Gaps = 38/131 (29%)

Query: 170 RRDKKLI----LVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPL 225
           + +KKLI    LV+DLD+T++H                  F+ L+         + VLP+
Sbjct: 294 KTEKKLIGKKCLVLDLDETLVHSS----------------FKYLQTA-------DFVLPV 330

Query: 226 MYMNEDGSVLRPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVD 285
               +  +V           YV  RPG++EF  +V  LFE+ ++T +   Y   +  I+D
Sbjct: 331 NIDEQIHNV-----------YVIKRPGVEEFLKRVGELFEVVVFTASVARYGDPLLDILD 379

Query: 286 PTGKLFGDRIL 296
           P  +L   R+ 
Sbjct: 380 PGRQLIHHRLF 390

>Kpol_1010.61 s1010 (148944..151325,151327..151743) [2799 bp, 932
           aa] {ON} (148944..151325,151327..151743) [2799 nt, 933
           aa]
          Length = 932

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/92 (31%), Positives = 50/92 (54%), Gaps = 7/92 (7%)

Query: 519 TDIQRSDIVIWTSTFGATSTSDIDFL---TTHLITKNPS--TYKARLAKKFNPEIKIVHP 573
           T   R++ ++++    A   S  D +   TTHLI+ +P+     A +A   +  IK V+P
Sbjct: 133 TVFNRTENILYSELINALGGSVSDMISNKTTHLISSDPTDPALIAIVASDCHSRIKQVYP 192

Query: 574 DWIFECLVNWKKVDEKPYTLIVDSPISDEELQ 605
            W+ +C +  K VDEK +  I+DS +S E+ +
Sbjct: 193 AWLCQCFLEVKYVDEKNF--ILDSSLSPEDAE 222

>TPHA0H01070 Chr8 (229632..232679) [3048 bp, 1015 aa] {ON} Anc_5.94
           YHR154W
          Length = 1015

 Score = 42.7 bits (99), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 48/100 (48%), Gaps = 4/100 (4%)

Query: 531 STFGATSTSDIDFLTTHLITKNPS--TYKARLAKKFNPEIKIVHPDWIFECLVNWKKVDE 588
           +  G T+   I  LTTHLIT +P+     A +A +    I  V+P W+ +C  +   V+E
Sbjct: 145 NALGGTTVDHISTLTTHLITNDPTDQAVIATIASEQKQNISFVYPTWLCQCFKSMTLVNE 204

Query: 589 KPYTLIVDSPISDEE--LQNFQSQLQKRQEYLEENQEQQH 626
             + + + S   D +  LQ+  + +++ Q     N   QH
Sbjct: 205 SDHLINIQSSAEDSKNRLQDLWNMVEESQPLRTLNILNQH 244

>Ecym_2066 Chr2 complement(110523..113165) [2643 bp, 880 aa] {ON}
           similar to Ashbya gossypii ADL145C
          Length = 880

 Score = 42.0 bits (97), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 42/81 (51%), Gaps = 6/81 (7%)

Query: 528 IWTSTFGATSTSDIDFLTT---HLITKNPSTYKARLAKKFNP-EIKIVHPDWIFECLVNW 583
           ++TS         +D+L+T   H+IT +P      + K+FN  E+  V   W+ EC V  
Sbjct: 138 LYTSMLTYMGGCCMDYLSTKVTHIITSDPKDQAVLVLKRFNKFEVLTVSSAWLAECFVRQ 197

Query: 584 KKVDEKPYTLIVDSPISDEEL 604
           + V E  Y  +V S +S+EE+
Sbjct: 198 EYVSEAAY--LVGSEMSNEEV 216

>Smik_12.82 Chr12 (167115..168293) [1179 bp, 392 aa] {ON} YLR019W
           (REAL)
          Length = 392

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 27/118 (22%), Positives = 50/118 (42%), Gaps = 34/118 (28%)

Query: 173 KKLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDG 232
           +K  L++DLD+T++H                           +    + VLP+   ++  
Sbjct: 221 QKKCLILDLDETLVHSSF-----------------------KYMHTADFVLPVEIDDQVH 257

Query: 233 SVLRPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGKL 290
           +V           YV  RPG+ EF ++V  L+E+ ++T +   YA  +   +DP G +
Sbjct: 258 NV-----------YVIKRPGVDEFLSRVCQLYEVVVFTASVSRYANPLLDTLDPNGTI 304

>Suva_10.65 Chr10 complement(134276..135523) [1248 bp, 415 aa] {ON}
           YLL010C (REAL)
          Length = 415

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 57/126 (45%), Gaps = 36/126 (28%)

Query: 171 RDKKLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNE 230
           +DKK  L++DLD+T++H                  F+ LR         + VLP+   ++
Sbjct: 243 KDKKC-LILDLDETLVHSS----------------FKYLRSA-------DFVLPVEIDDQ 278

Query: 231 DGSVLRPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGKL 290
             +V           YV  RPG++EF  +V  LFE+ ++T +   Y   +  I+D T K+
Sbjct: 279 VHNV-----------YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILD-TDKV 326

Query: 291 FGDRIL 296
              R+ 
Sbjct: 327 IHHRLF 332

>YLR019W Chr12 (180288..181481) [1194 bp, 397 aa] {ON}
           PSR2Functionally redundant Psr1p homolog, a plasma
           membrane phosphatase involved in the general stress
           response; required with Psr1p and Whi2p for full
           activation of STRE-mediated gene expression, possibly
           through dephosphorylation of Msn2p
          Length = 397

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 27/118 (22%), Positives = 50/118 (42%), Gaps = 34/118 (28%)

Query: 173 KKLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDG 232
           +K  L++DLD+T++H                           +    + VLP+   ++  
Sbjct: 226 QKKCLILDLDETLVHSSF-----------------------KYMHSADFVLPVEIDDQVH 262

Query: 233 SVLRPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGKL 290
           +V           YV  RPG+ EF  +V+ L+E+ ++T +   YA  +   +DP G +
Sbjct: 263 NV-----------YVIKRPGVDEFLNRVSQLYEVVVFTASVSRYANPLLDTLDPNGTI 309

>Skud_12.57 Chr12 complement(120706..121953) [1248 bp, 415 aa] {ON}
           YLL010C (REAL)
          Length = 415

 Score = 40.8 bits (94), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 55/123 (44%), Gaps = 35/123 (28%)

Query: 174 KLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGS 233
           K  L++DLD+T++H                 +F+ LR         + VLP+   ++  +
Sbjct: 245 KKCLILDLDETLVHS----------------SFKYLRSA-------DFVLPVEIDDQVHN 281

Query: 234 VLRPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGKLFGD 293
           V           YV  RPG++EF  +V  LFE+ ++T +   Y   +  I+D T K+   
Sbjct: 282 V-----------YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILD-TNKVIHH 329

Query: 294 RIL 296
           R+ 
Sbjct: 330 RLF 332

>Kpol_1050.63 s1050 (138268..141444) [3177 bp, 1058 aa] {ON}
           (138268..141444) [3177 nt, 1059 aa]
          Length = 1058

 Score = 40.8 bits (94), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 59/123 (47%), Gaps = 6/123 (4%)

Query: 470 TLSNIHMTYYQM-LSQENEPEPNLMEIIPSLKQKVFQNCFFVFSGLIPLGTDIQRSDIVI 528
           +L N+   +Y + L +  +PE N+M      K+ VF     + +     G   QR+ I  
Sbjct: 312 SLGNVSWLFYLLNLKKFQKPE-NIM--YHPYKKSVFNKDELILTYTNLFGP--QRTYIKT 366

Query: 529 WTSTFGATSTSDIDFLTTHLITKNPSTYKARLAKKFNPEIKIVHPDWIFECLVNWKKVDE 588
            T+  G  +T+ +  +   L+   P   K + A+K+  ++ IV P+W+ EC    KK+D 
Sbjct: 367 LTNALGGVTTATLSHINNCLVYGIPEGMKYKTAEKWGDKLIIVGPNWLEECYKANKKLDP 426

Query: 589 KPY 591
           K +
Sbjct: 427 KLF 429

>ZYRO0B10428g Chr2 (823155..824603) [1449 bp, 482 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 482

 Score = 40.4 bits (93), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 49/112 (43%), Gaps = 34/112 (30%)

Query: 174 KLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGS 233
           K  LV+DLD+T++H                 +F+ L+         + VLP+   ++  +
Sbjct: 312 KKCLVLDLDETLVHS----------------SFKYLKGA-------DFVLPVDIDDQIHN 348

Query: 234 VLRPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVD 285
           V           YV  RPG+ EF  KV  LFE+ I+T +   Y   +  I+D
Sbjct: 349 V-----------YVMKRPGVDEFLKKVGSLFEVVIFTASVARYGDPLLDILD 389

>TBLA0C06090 Chr3 complement(1478726..1480180) [1455 bp, 484 aa]
           {ON} Anc_5.202 YLL010C
          Length = 484

 Score = 39.3 bits (90), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 50/123 (40%), Gaps = 33/123 (26%)

Query: 174 KLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGS 233
           K  L++DLD+T++H              NNP+F               +LP+    EDG 
Sbjct: 312 KKCLILDLDETLVHSSFKFI--------NNPDF---------------ILPIEI--EDGQ 346

Query: 234 VLRPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGKLFGD 293
           +           YV  RPG+  F  +V   +E+ I+T +   YA  +  ++D    L   
Sbjct: 347 IHN--------VYVIKRPGVDRFLREVKKWYEIVIFTASLSRYANPLLDLLDKDHNLINH 398

Query: 294 RIL 296
           R+ 
Sbjct: 399 RLF 401

>Kpol_478.16 s478 complement(58800..59852) [1053 bp, 350 aa] {ON}
           complement(58800..59852) [1053 nt, 351 aa]
          Length = 350

 Score = 38.9 bits (89), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 47/94 (50%), Gaps = 7/94 (7%)

Query: 246 YVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGKLFGDRILSRDE----N 301
           YV  RPG+  F    + LFE+ I+T +   Y   +  I+D T  L   R+  RD     N
Sbjct: 217 YVIKRPGVDAFLQYTSKLFEVVIFTASVEKYGNPLLDILDSTNDLVHHRLF-RDACYNYN 275

Query: 302 GSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPN 335
           G+   K+LA+L     S ++++D+    + + PN
Sbjct: 276 GNY-IKNLAQL-GRPLSDIIILDNSPTSYLFHPN 307

>Smik_12.53 Chr12 complement(116428..117672) [1245 bp, 414 aa] {ON}
           YLL010C (REAL)
          Length = 414

 Score = 38.9 bits (89), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 50/112 (44%), Gaps = 34/112 (30%)

Query: 174 KLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGS 233
           K  L++DLD+T++H                 +F+ LR         + VLP+   ++  +
Sbjct: 244 KKCLILDLDETLVHS----------------SFKYLRSA-------DFVLPVEIDDQVHN 280

Query: 234 VLRPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVD 285
           V           YV  RPG++EF  +V  LFE+ ++T +   Y   +  I+D
Sbjct: 281 V-----------YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILD 321

>NDAI0C03230 Chr3 (734531..737635) [3105 bp, 1034 aa] {ON} Anc_5.94
           YHR154W
          Length = 1034

 Score = 39.3 bits (90), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 46/96 (47%), Gaps = 8/96 (8%)

Query: 504 FQNCFFVFSGLIPLGTDIQRSDIVIWTSTFGATSTSDIDFLTTHLIT---KNPSTYKARL 560
           FQ C   +S  +     I  S+++   ++ G T T  I+  TTHLI     +P+    + 
Sbjct: 136 FQICISTYS--MKFSEYIFYSELI---NSLGGTITHVINNKTTHLIAIAIDDPAIIAIKE 190

Query: 561 AKKFNPEIKIVHPDWIFECLVNWKKVDEKPYTLIVD 596
             + N  IK V+P W+ +C    K +DE P+ +  D
Sbjct: 191 KGQNNTIIKSVYPTWLVQCFKERKYIDESPHLITED 226

 Score = 37.0 bits (84), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 46/99 (46%), Gaps = 2/99 (2%)

Query: 478 YYQMLSQENEPEPNLMEIIPSLKQKVFQNCFFVFSGLIPLGTDIQRSDIVIWTSTFGATS 537
           ++ M S      PN   +    K+K+F++   + +     G   QRS I   T   G  S
Sbjct: 331 FFHMWSICEFVPPNTNLLFEPFKKKIFKSSELILTYTNYFGR--QRSYIQRLTEMLGGIS 388

Query: 538 TSDIDFLTTHLITKNPSTYKARLAKKFNPEIKIVHPDWI 576
           T+++    THL+++ P   K   AKK+    ++++  W+
Sbjct: 389 TTELSKRNTHLVSRMPVGKKFFQAKKWKDRCQVINHLWL 427

>KAFR0E02140 Chr5 (426065..428920) [2856 bp, 951 aa] {ON} Anc_5.94
           YHR154W
          Length = 951

 Score = 39.3 bits (90), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 53/102 (51%), Gaps = 11/102 (10%)

Query: 517 LGTDIQRSDIVIWT---STFGATSTSDIDFLTTHLITKNP--STYKARLAKKFNPEIKIV 571
           L    + S+ +++T    + G T   +I+  TTH+IT NP  S ++  L +     IK +
Sbjct: 133 LKPSFEASEYLLYTELIHSMGGTCVENINNKTTHIITTNPKESCFEI-LKRNGTTSIKYI 191

Query: 572 HPDWIFECLVNWKKVDEKPYTLIVDSPISD--EELQNFQSQL 611
           +P W+  C+   + +DE  + ++   P +D  E+L +  +Q+
Sbjct: 192 YPTWLIHCVKESQLIDESEHEIV---PFTDDTEKLNDLWNQV 230

>Kwal_33.15140 s33 complement(975769..977001) [1233 bp, 410 aa] {ON}
           YLR019W (PSR2) - Plasma membrane Sodium Response 2
           [contig 94] FULL
          Length = 410

 Score = 38.9 bits (89), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 56/132 (42%), Gaps = 38/132 (28%)

Query: 174 KLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGS 233
           K  LV+DLD+T++H                 +F+ LR         + V+P+   N+  +
Sbjct: 240 KKCLVLDLDETLVHS----------------SFKFLRTA-------DFVIPVEIDNQIHN 276

Query: 234 VLRPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPT----GK 289
           V           YV  RPG+ EF   V  L+E+ ++T +   Y   +  ++D T     +
Sbjct: 277 V-----------YVIKRPGVDEFLKLVGQLYEVVVFTASVSRYGDPLLDVLDQTQCIHHR 325

Query: 290 LFGDRILSRDEN 301
           LF D   + D N
Sbjct: 326 LFRDSCYNYDGN 337

>Skud_12.87 Chr12 (172096..173274) [1179 bp, 392 aa] {ON} YLR019W
           (REAL)
          Length = 392

 Score = 38.9 bits (89), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 26/118 (22%), Positives = 50/118 (42%), Gaps = 34/118 (28%)

Query: 173 KKLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDG 232
           +K  L++DLD+T++H                           +    + VLP+   ++  
Sbjct: 221 QKKCLILDLDETLVHSSF-----------------------KYMQTADFVLPVEIDDQVH 257

Query: 233 SVLRPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGKL 290
           +V           YV  RPG+ EF  +V+ ++E+ ++T +   YA  +   +DP G +
Sbjct: 258 NV-----------YVIKRPGVDEFLHRVSQVYEVVVFTASVSRYANPLLDTLDPNGTI 304

>Ecym_5052 Chr5 (112351..114972) [2622 bp, 873 aa] {ON} similar to
           Ashbya gossypii ADR369C
          Length = 873

 Score = 38.5 bits (88), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 44/97 (45%), Gaps = 6/97 (6%)

Query: 501 QKVFQNCFFVFSGLIPLGTDIQRSDIVIWTSTFGATSTSDIDFLTTHLITKNPSTYKARL 560
           ++VF+ C    +G      +  R +IV+    F    T   D   TH++ +N S  K   
Sbjct: 88  RRVFEGCKVYINGRTDPDREQLRKEIVLHGGQFVQYLTKKSD--VTHIVAQNLSAAKCIE 145

Query: 561 AKKFNPEIKIVHPDWIFECLVNWKKVDEKPYTLIVDS 597
            + F    K+V P WI  C+   K +  + Y++IV S
Sbjct: 146 FRNF----KVVQPGWIGACVRIGKMLSWREYSVIVRS 178

>SAKL0G15620g Chr7 (1342049..1344688) [2640 bp, 879 aa] {ON} some
           similarities with uniprot|P38850 Saccharomyces
           cerevisiae YHR154W RTT107 Regulator of Ty1 Transposition
           Establishes Silent Chromatin involved in silencing
          Length = 879

 Score = 38.5 bits (88), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 39/164 (23%), Positives = 73/164 (44%), Gaps = 10/164 (6%)

Query: 479 YQMLSQENEPEPNLMEIIPSLKQKVFQNCFFVFSGLIPLGTDIQRSDIVIWTSTFGATST 538
           + M S +    P+   ++  L+ K+F     + S    LG   QR  I       G  ST
Sbjct: 316 FFMWSMQEFISPSSKLLLSPLRPKIFHKNELLLSYTNYLGQ--QRFYIQKLVEALGGAST 373

Query: 539 SDIDFLTTHLITKNPSTYKARLAKKFNPEIKIVHPDWIFECLVNWKKVD-------EKPY 591
           +++    TH+++  P   K + A +++   K+V+  W+ EC    KK+D       E P 
Sbjct: 374 TELSKKNTHVLSCMPYGQKYQAAVRWSDTCKVVNHLWLEECYKFAKKLDTDTTRYREIPV 433

Query: 592 TLIVDSPISDEELQNFQSQLQKRQEYLEENQEQQHMLTSQENLN 635
              + + +    L++++    K QE  EE ++   +  +QEN +
Sbjct: 434 RGGLKNVLGQLSLEDYEENTGK-QELHEEKEQLSTITDTQENFD 476

>CAGL0D03234g Chr4 (334913..336145) [1233 bp, 410 aa] {ON} similar
           to uniprot|Q07949 Saccharomyces cerevisiae YLR019w PSR2
           oruniprot|Q07800 Saccharomyces cerevisiae YLL010c PSR1
          Length = 410

 Score = 37.7 bits (86), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 47/112 (41%), Gaps = 34/112 (30%)

Query: 174 KLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGS 233
           K  LV+DLD+T++H                  F+ LR         + VLP+   N D  
Sbjct: 240 KKCLVLDLDETLVHSS----------------FKYLRTA-------DFVLPV---NIDDQ 273

Query: 234 VLRPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVD 285
           V           YV  RPG+ EF  +V  L+E+ ++T +   Y   +  I+D
Sbjct: 274 VHN--------VYVIKRPGVDEFLKRVGELYEVVVFTASVARYGDPLLDILD 317

>TDEL0E04270 Chr5 (798352..799713) [1362 bp, 453 aa] {ON} Anc_5.202
           YLL010C
          Length = 453

 Score = 37.7 bits (86), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 49/112 (43%), Gaps = 34/112 (30%)

Query: 174 KLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGS 233
           K  LV+DLD+T++H                 +F+ LR         + VLP+   ++  +
Sbjct: 283 KKCLVLDLDETLVHS----------------SFKYLRTA-------DFVLPVDIDDQIHN 319

Query: 234 VLRPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVD 285
           V           YV  RPG+ EF  +V  L+E+ ++T +   Y   +  I+D
Sbjct: 320 V-----------YVIKRPGVDEFLKRVGALYEVVVFTASVSRYGDPLLDILD 360

>KLLA0F15620g Chr6 complement(1441560..1442804) [1245 bp, 414 aa]
           {ON} similar to uniprot|Q07800 Saccharomyces cerevisiae
           YLL010C
          Length = 414

 Score = 37.7 bits (86), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 39/149 (26%), Positives = 64/149 (42%), Gaps = 40/149 (26%)

Query: 139 DGVPLDVVGDMDLQISETEAIRTGKAL--KEHLRRDKKLILVVDLDQTIIHCGVDPTIAE 196
           DG PLD+     LQ  +  A      L  K  + + KK  LV+DLD+T++H         
Sbjct: 211 DGEPLDL---SQLQPDQAHAPGCNTLLLPKADMFKGKK-CLVLDLDETLVHS-------- 258

Query: 197 WKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGSVLRPPPVRKCWYYVKVRPGLKEF 256
                   +F+ LR         + V+P+   N+  +V           YV  RPG+ EF
Sbjct: 259 --------SFKYLRTA-------DFVIPVEIDNQVHNV-----------YVIKRPGVDEF 292

Query: 257 FAKVAPLFEMHIYTMATRAYALQIAKIVD 285
             ++  L+E+ ++T +   Y   +  I+D
Sbjct: 293 LRRITELYEVVVFTASVSRYGDPLLDILD 321

>KAFR0J00990 Chr10 complement(178980..180431) [1452 bp, 483 aa] {ON}
           Anc_5.202 YLL010C
          Length = 483

 Score = 37.7 bits (86), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 53/124 (42%), Gaps = 35/124 (28%)

Query: 173 KKLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDG 232
           +K  LV+DLD+T++H                  F+ L+         + VLP+   ++  
Sbjct: 312 RKKCLVLDLDETLVHSS----------------FKYLKSA-------DFVLPVDIDDQIH 348

Query: 233 SVLRPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGKLFG 292
           +V           YV  RPG+ EF  +V  +FE+ ++T +   Y   +  ++D  GK   
Sbjct: 349 NV-----------YVIKRPGVDEFLKRVGEIFEVVVFTASVSRYGDPLLDVLD-KGKSIH 396

Query: 293 DRIL 296
            R+ 
Sbjct: 397 HRLF 400

>TPHA0N00670 Chr14 complement(147329..148687) [1359 bp, 452 aa] {ON}
           Anc_5.202 YLL010C
          Length = 452

 Score = 37.7 bits (86), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 48/110 (43%), Gaps = 34/110 (30%)

Query: 177 LVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGSVLR 236
           LV+DLD+T++H                  F+ L ++  F      VLP+   N+  +V  
Sbjct: 285 LVLDLDETLVHSS----------------FKYL-NIADF------VLPVDIDNQVQNV-- 319

Query: 237 PPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDP 286
                    YV  RPG+ EF   V  L+E+ ++T +   Y   +  I+DP
Sbjct: 320 ---------YVSKRPGVDEFLKIVGDLYEVIVFTASVSRYGNPLMDILDP 360

>Suva_10.99 Chr10 (186341..187498) [1158 bp, 385 aa] {ON} YLR019W
           (REAL)
          Length = 385

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 28/114 (24%), Positives = 50/114 (43%), Gaps = 34/114 (29%)

Query: 173 KKLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDG 232
           +K  L++DLD+T++H                  F+ L          + VLP+   ++  
Sbjct: 214 QKKCLILDLDETLVHSS----------------FKYLHTA-------DFVLPVEIDDQVH 250

Query: 233 SVLRPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDP 286
           +V           YV  RPG+ EF  +V+ L+E+ ++T +   YA  +   +DP
Sbjct: 251 NV-----------YVIKRPGVDEFLHRVSQLYEVVVFTASVSRYANPLLDTLDP 293

>YLL010C Chr12 complement(129330..130613) [1284 bp, 427 aa] {ON}
           PSR1Plasma membrane associated protein phosphatase
           involved in the general stress response; required along
           with binding partner Whi2p for full activation of
           STRE-mediated gene expression, possibly through
           dephosphorylation of Msn2p
          Length = 427

 Score = 37.4 bits (85), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 29/51 (56%), Gaps = 1/51 (1%)

Query: 246 YVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGKLFGDRIL 296
           YV  RPG++EF  +V  LFE+ ++T +   Y   +  I+D T K+   R+ 
Sbjct: 295 YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILD-TDKVIHHRLF 344

>NCAS0D02740 Chr4 complement(525116..526312) [1197 bp, 398 aa] {ON}
           Anc_5.202
          Length = 398

 Score = 37.4 bits (85), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 28/118 (23%), Positives = 50/118 (42%), Gaps = 34/118 (28%)

Query: 173 KKLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDG 232
            K  LV+DLD+T++H                  F+ +R         + VLP+   ++  
Sbjct: 227 NKKCLVLDLDETLVHSS----------------FKYVRTA-------DFVLPVEIEDQIH 263

Query: 233 SVLRPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGKL 290
           +V           YV  RPG+ EF  +V  L+E+ ++T +   Y   +  I+D +  +
Sbjct: 264 NV-----------YVIKRPGVDEFLKRVGELYEVVVFTASVSRYGDPLLNILDQSNSV 310

>NDAI0I02170 Chr9 (498399..499574) [1176 bp, 391 aa] {ON} Anc_5.202
          Length = 391

 Score = 37.0 bits (84), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 29/117 (24%), Positives = 50/117 (42%), Gaps = 34/117 (29%)

Query: 174 KLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGS 233
           K  LV+DLD+T++H                  F+ L          + VLP+   ++  +
Sbjct: 221 KKCLVLDLDETLVHSS----------------FKYLHTA-------DFVLPVDIDDQIHN 257

Query: 234 VLRPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGKL 290
           V           YV  RPG+ EF  +VA L+E+ ++T +   Y   +  I+D +  +
Sbjct: 258 V-----------YVIKRPGVDEFLRRVAQLYEVVVFTASVSRYGDPLLDILDSSNSI 303

>Kpol_2002.100 s2002 complement(238947..240380) [1434 bp, 477 aa]
           {ON} complement(238947..240380) [1434 nt, 478 aa]
          Length = 477

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 29/127 (22%), Positives = 53/127 (41%), Gaps = 35/127 (27%)

Query: 164 ALKEHLRRDKKLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVL 223
           A K+ + ++KK  LV+DLD+T++H                           +    + VL
Sbjct: 298 AKKDPVFKNKKC-LVLDLDETLVHSSF-----------------------KYIDTADFVL 333

Query: 224 PLMYMNEDGSVLRPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKI 283
           P+   ++   V           YV  RPG+ EF  +V  +FE+ ++T +   Y   +  I
Sbjct: 334 PVTIDDQTHQV-----------YVIKRPGVDEFLKRVGKIFEVVVFTASVSRYGDPLLDI 382

Query: 284 VDPTGKL 290
           +D +  +
Sbjct: 383 LDSSKSI 389

>AAL158W Chr1 (67892..69328) [1437 bp, 478 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLL010C (PSR1) and YLR019W
           (PSR2)
          Length = 478

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 48/112 (42%), Gaps = 34/112 (30%)

Query: 174 KLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGS 233
           +  LV+DLD+T++H                 +F+ L          + V+P+   N+  +
Sbjct: 308 RKCLVLDLDETLVHS----------------SFKYLHTA-------DFVIPVEIDNQVHN 344

Query: 234 VLRPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVD 285
           V           YV  RPG+ EF  +V  LFE+ ++T +   Y   +  I+D
Sbjct: 345 V-----------YVIKRPGVDEFLKRVGELFEVVVFTASVSRYGDPLLDILD 385

>Smik_8.238 Chr8 (379729..382956) [3228 bp, 1075 aa] {ON} YHR154W
           (REAL)
          Length = 1075

 Score = 37.0 bits (84), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 59/142 (41%), Gaps = 17/142 (11%)

Query: 471 LSNIHMTYYQMLSQENEPEPNLMEIIPSLKQKVFQNCFFVFSGLIPLGTDIQRSDIVIWT 530
           + N+   +Y    Q+  P      I      K+F +     +     G+  QR  I    
Sbjct: 342 VGNVSWLFYMFALQQFVPAAQCKLIHQPFHAKLFTSKELTVAYTNYFGS--QRFYIQRLV 399

Query: 531 STFGATSTSDIDFLTTHLITKNPSTYKARLAKKF--NPEIKIVHPD--WIFECLVNWKKV 586
              G  ST ++    THLITKN    K ++AKK+  +P+  I+  +  W+ EC +N  K+
Sbjct: 400 EILGGLSTPELTRKNTHLITKNAIGKKFKVAKKWSLDPQNAIIVTNHLWLEECYMNNSKL 459

Query: 587 DEKPYTLIVDSPISDEELQNFQ 608
           + K           D   QNF+
Sbjct: 460 NPK-----------DSRFQNFK 470

>Ecym_7104 Chr7 (203366..204844) [1479 bp, 492 aa] {ON} similar to
           Ashbya gossypii AAL158W
          Length = 492

 Score = 36.2 bits (82), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 27/113 (23%), Positives = 49/113 (43%), Gaps = 34/113 (30%)

Query: 173 KKLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDG 232
           ++  LV+DLD+T++H                 +F+ L          + V+P+   N+  
Sbjct: 321 RRKCLVLDLDETLVH----------------SSFKYLHTA-------DFVIPVEIDNQVH 357

Query: 233 SVLRPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVD 285
           +V           YV  RPG+ EF  +V  L+E+ ++T +   Y   +  I+D
Sbjct: 358 NV-----------YVIKRPGVDEFLRRVGELYEVVVFTASVSRYGDPLLDILD 399

>CAGL0D05610g Chr4 complement(534849..536192) [1344 bp, 447 aa] {ON}
           similar to uniprot|Q07800 Saccharomyces cerevisiae
           YLL010c PSR1 or uniprot|Q07949 Saccharomyces cerevisiae
           YLR019w PSR2
          Length = 447

 Score = 35.8 bits (81), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 31/132 (23%), Positives = 55/132 (41%), Gaps = 38/132 (28%)

Query: 174 KLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGS 233
           K  LV+DLD+T++H                  F+ L          + VLP+   ++  +
Sbjct: 277 KKCLVLDLDETLVHSS----------------FKYLHTA-------DFVLPVDIDDQIHN 313

Query: 234 VLRPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTG----K 289
           V           YV  RPG+ EF  +V  L+E+ ++T +   Y   +  ++D +     +
Sbjct: 314 V-----------YVIKRPGVDEFLQRVGELYEVVVFTASVSRYGDPLLDVLDKSNNIHHR 362

Query: 290 LFGDRILSRDEN 301
           LF D   + + N
Sbjct: 363 LFRDACYTYEGN 374

>KAFR0A06560 Chr1 complement(1329583..1331250) [1668 bp, 555 aa]
           {ON} Anc_4.156 YLR330W
          Length = 555

 Score = 35.8 bits (81), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 25/55 (45%)

Query: 545 TTHLITKNPSTYKARLAKKFNPEIKIVHPDWIFECLVNWKKVDEKPYTLIVDSPI 599
           TTH I  +     A L +  N  I IV P+WI  C V  + V  + + L  D  I
Sbjct: 212 TTHFICNDEEEEDAELIRAKNSNIPIVRPEWIRACAVEKRIVGVRGFYLDADKSI 266

>KNAG0M01740 Chr13 (321477..322922) [1446 bp, 481 aa] {ON} Anc_5.202
           YLL010C
          Length = 481

 Score = 35.8 bits (81), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 27/109 (24%), Positives = 47/109 (43%), Gaps = 34/109 (31%)

Query: 177 LVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGSVLR 236
           LV+DLD+T++H                  F+ L+         + VLP+   ++  +V  
Sbjct: 314 LVLDLDETLVHSS----------------FKYLKSA-------DFVLPVDIDDQIHNV-- 348

Query: 237 PPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVD 285
                    YV  RPG+ EF  +V  L+E+ ++T +   Y   +  I+D
Sbjct: 349 ---------YVIKRPGVDEFLRRVGKLYEVVVFTASVSRYGDPLLDILD 388

>KLTH0B03388g Chr2 (272914..274143) [1230 bp, 409 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 409

 Score = 35.4 bits (80), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 32/132 (24%), Positives = 55/132 (41%), Gaps = 38/132 (28%)

Query: 174 KLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGS 233
           K  LV+DLD+T++H                 +F+ LR         + V+P+   N+  +
Sbjct: 239 KKCLVLDLDETLVHS----------------SFKFLRTA-------DFVIPVEIDNQVHN 275

Query: 234 VLRPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPT----GK 289
           V           YV  RPG+ +F   V  L+E+ ++T +   Y   +  ++D       +
Sbjct: 276 V-----------YVIKRPGVDDFLRLVGQLYEVVVFTASVSRYGDPLLDVLDQNHCIHHR 324

Query: 290 LFGDRILSRDEN 301
           LF D   + D N
Sbjct: 325 LFRDSCYNYDGN 336

>CAGL0I01958g Chr9 (162266..165565) [3300 bp, 1099 aa] {ON} weakly
           similar to uniprot|P38850 Saccharomyces cerevisiae
           YHR154w ESC4 Establishes Silent Chromatin
          Length = 1099

 Score = 35.8 bits (81), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 42/170 (24%), Positives = 74/170 (43%), Gaps = 27/170 (15%)

Query: 488 PEPNLMEIIPSLKQKVFQNCFFVFSGLIPLGTDIQRSDIVIWTSTFGATSTSDIDFLTTH 547
           P+ N +  +P  ++K+F+      +     G   QR+ +       G ++T ++    TH
Sbjct: 356 PDTNAI-CLPRRRRKLFRKQDLAVTYTNYFGE--QRTYLQQLIELLGGSATMELSKQNTH 412

Query: 548 LITKNPSTYKARLAKKFN---PEIKIVHPDWIFECLVNWKKV-----------DEKPYTL 593
           LI   P   K  +A K+     +I I    W+ EC ++ KKV           D+  Y+L
Sbjct: 413 LICNLPFGKKYEVAMKWKESGSKIVICSHRWLEECYISGKKVPVDEAYTRLERDDNTYSL 472

Query: 594 IVDSPIS---------DEELQNFQSQLQKRQEYLEENQEQQHMLTSQENL 634
            +   +S         DEE    +SQ+    EYL+ +Q + H LT  +++
Sbjct: 473 TLGQQLSPKLDSENSSDEETDIEESQVFAL-EYLKTSQSRAHDLTGLDDI 521

>Smik_16.172 Chr16 (313129..314562) [1434 bp, 477 aa] {ON} YPL063W
           (REAL)
          Length = 477

 Score = 35.4 bits (80), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 50/100 (50%), Gaps = 10/100 (10%)

Query: 250 RPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDP-----TGKLFGDRILSRDENGSL 304
           RPG   F   ++  FE+ +++     Y+ +IA+ +DP     +  LF +  + +D    +
Sbjct: 218 RPGADYFLGYLSQYFEIVLFSSNYMMYSDKIAEKLDPIHAFVSYNLFKEHCVYKD---GV 274

Query: 305 TTKSLAKLFPTDQSMVVVIDDRGDVWNWCP-NLIKVVPYN 343
             K L+KL   D S V++ID   + +   P N I + P+N
Sbjct: 275 HIKDLSKL-NRDLSKVIIIDTEPNSYKLQPENAIPMDPWN 313

>Suva_16.249 Chr16 (440525..441967) [1443 bp, 480 aa] {ON} YPL063W
           (REAL)
          Length = 480

 Score = 35.4 bits (80), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 50/100 (50%), Gaps = 10/100 (10%)

Query: 250 RPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDP-----TGKLFGDRILSRDENGSL 304
           RPG   F   ++  FE+ +++     Y+ +IA+ +DP     +  LF +  + +D    +
Sbjct: 223 RPGADYFLGYLSQYFEIVLFSSNYMMYSEKIAEKLDPIHAFVSYNLFKEHCVYKD---GV 279

Query: 305 TTKSLAKLFPTDQSMVVVIDDRGDVWNWCP-NLIKVVPYN 343
             K L+KL   D S V++ID   + +   P N I + P+N
Sbjct: 280 HIKDLSKL-NRDLSKVIIIDTDPNSYKLQPENAIPMEPWN 318

>Ecym_7276 Chr7 complement(579526..581307) [1782 bp, 593 aa] {ON}
           similar to Ashbya gossypii AGL051C
          Length = 593

 Score = 34.7 bits (78), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 27/53 (50%)

Query: 545 TTHLITKNPSTYKARLAKKFNPEIKIVHPDWIFECLVNWKKVDEKPYTLIVDS 597
           TTH +  +  +    LA+  N  I +V P+WI  C +  + V  + + L VDS
Sbjct: 211 TTHFVCNDAQSDDKELARAKNGNIPVVRPEWIRACELEKRIVGVRGFYLDVDS 263

>KLLA0E23101g Chr5 complement(2059506..2060948) [1443 bp, 480 aa]
           {ON} similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063W TIM50 Protein of the inner mitochondrial
           membrane required for import of mitochondrial matrix
           proteins
          Length = 480

 Score = 34.7 bits (78), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 52/106 (49%), Gaps = 11/106 (10%)

Query: 244 WYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDP-----TGKLFGDRILSR 298
           W   K RPG+  F   ++  +E+ +++     YA +IA+ +DP     T  LF +  L +
Sbjct: 216 WRTAK-RPGVDYFLGYLSQYYEIVLFSSNYMMYAEKIAEKLDPIHAFITYNLFKEHCLYK 274

Query: 299 DENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCP-NLIKVVPYN 343
           D    +  K L+KL   D   V++ID   + +   P N I + P++
Sbjct: 275 D---GVHIKDLSKL-NRDLGKVLIIDTDENSFKLQPENAIYLEPWD 316

>Smik_12.335 Chr12 (603893..605929) [2037 bp, 678 aa] {ON} YLR260W
           (REAL)
          Length = 678

 Score = 34.7 bits (78), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 43/96 (44%), Gaps = 5/96 (5%)

Query: 125 LCTQCGKEVSADAFDGVPLDVVGDMDLQISETEAIRTGKALKEHL-----RRDKKLILVV 179
           L +QC  EV    + G  +++  +MD+   +T A  +G  +   +     RR   +    
Sbjct: 288 LASQCSIEVVYTKYPGHAIEIAREMDIDQYDTIACASGDGIPHEVINGLYRRPDHVKAFN 347

Query: 180 DLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSF 215
            L  T I CG    ++   +  NNP++ TL  +KS 
Sbjct: 348 KLAITEIPCGSGNAMSVSCHWTNNPSYSTLCLIKSI 383

>KNAG0E00570 Chr5 (95945..98890) [2946 bp, 981 aa] {ON} Anc_5.94
           YHR154W
          Length = 981

 Score = 34.7 bits (78), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 49/102 (48%), Gaps = 3/102 (2%)

Query: 479 YQMLSQENEPEPNLMEIIPSLKQKVFQNCFFVFSGLIPLGTDIQRSDIVIWTSTFGATST 538
           + M S ++   P+   I   LKQ V ++   + S     G  +QRS I   T   G  ST
Sbjct: 324 FNMWSLDSFTLPSSKIIWGPLKQSVVRSDELILSFTNYFG--LQRSYIQRITERLGGVST 381

Query: 539 SDIDFLTTHLITKNPSTYKARLAKKFNPE-IKIVHPDWIFEC 579
           + +    THL+++     K  LAK++  +  ++V+  W+ EC
Sbjct: 382 TSLTKRNTHLVSRMAIGKKFELAKQWGGQRCRVVNHLWLEEC 423

>Skud_12.340 Chr12 (606790..608832) [2043 bp, 680 aa] {ON} YLR260W
           (REAL)
          Length = 680

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 44/95 (46%), Gaps = 5/95 (5%)

Query: 125 LCTQCGKEVSADAFDGVPLDVVGDMDLQISETEAIRTGKALKEHL-----RRDKKLILVV 179
           L ++C  EV    + G  +++  +MD+   +T A  +G  +   +     RR  ++    
Sbjct: 288 LASRCSIEVVYTKYPGHAIEIAREMDIDKYDTIACASGDGIPHEVINGLYRRPDRVKAFN 347

Query: 180 DLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKS 214
            L  T I CG    ++   +  NNP++ TL  +KS
Sbjct: 348 QLAITEIPCGSGNAMSVSCHWTNNPSYSTLCLIKS 382

>NCAS0D01510 Chr4 complement(282977..285679) [2703 bp, 900 aa] {ON}
           Anc_5.94 YHR154W
          Length = 900

 Score = 34.3 bits (77), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 55/120 (45%), Gaps = 11/120 (9%)

Query: 474 IHMTYYQMLSQENEPEPNLMEIIPSLKQKVFQNCFFVFSGLIPLGTDI---QRSDIVIWT 530
           I M +   +SQ  EP+ N++        + FQ   F  + L P  T+    QRS I    
Sbjct: 320 IWMFHMWSMSQFIEPKENII-------FEPFQPVIFKRNELRPAYTNYFGRQRSYIQRLV 372

Query: 531 STFGATSTSDIDFLTTHLITKNPSTYKARLAKKFN-PEIKIVHPDWIFECLVNWKKVDEK 589
              G  ST++     THLI+++    K + A K+    + +V+  W+ EC    KK+D K
Sbjct: 373 ELLGGVSTTEFSKRNTHLISRSNVGKKFKTAMKWGESSVIVVNHLWLEECYKLNKKLDPK 432

>YPL063W Chr16 (429939..431369) [1431 bp, 476 aa] {ON}
           TIM50Essential component of the Translocase of the Inner
           Mitochondrial membrane (TIM23 complex); acts as receptor
           for the TIM23 complex guiding incoming precursors from
           the TOM complex; may control the gating of the
           Tim23p-Tim17p channel
          Length = 476

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 50/100 (50%), Gaps = 10/100 (10%)

Query: 250 RPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDP-----TGKLFGDRILSRDENGSL 304
           RPG   F   ++  +E+ +++     Y+ +IA+ +DP     +  LF +  + +D    +
Sbjct: 218 RPGADYFLGYLSQYYEIVLFSSNYMMYSDKIAEKLDPIHAFVSYNLFKEHCVYKD---GV 274

Query: 305 TTKSLAKLFPTDQSMVVVIDDRGDVWNWCP-NLIKVVPYN 343
             K L+KL   D S V++ID   + +   P N I + P+N
Sbjct: 275 HIKDLSKL-NRDLSKVIIIDTDPNSYKLQPENAIPMEPWN 313

>SAKL0H20592g Chr8 complement(1805321..1806847) [1527 bp, 508 aa]
           {ON} some similarities with uniprot|Q12114 Saccharomyces
           cerevisiae YLR330W CHS5 Protein of unknown function
           involved in chitin biosynthesis by regulating Chs3p
           localization also involved in cell fusion during mating
          Length = 508

 Score = 33.9 bits (76), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 33/77 (42%), Gaps = 1/77 (1%)

Query: 521 IQRSDIVIWTSTFGATSTSD-IDFLTTHLITKNPSTYKARLAKKFNPEIKIVHPDWIFEC 579
           + ++ I    S  GA +  D +   TTH I     +    L K  N  I +V P+W+  C
Sbjct: 186 VTKNQIETSLSNIGAKALQDHVGLDTTHFICNEKDSEDPELEKAQNSNIPVVRPEWVRAC 245

Query: 580 LVNWKKVDEKPYTLIVD 596
            +  + V  + + L  D
Sbjct: 246 ELERRIVGVRGFYLDAD 262

>ADR369C Chr4 complement(1362309..1364792) [2484 bp, 827 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR346W
           (REV1)
          Length = 827

 Score = 33.9 bits (76), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 39/92 (42%), Gaps = 6/92 (6%)

Query: 500 KQKVFQNCFFVFSGLIPLGTDIQRSDIVIWTSTFGATSTSDIDFLTTHLITKNPSTYKAR 559
           +  +F+ C    +G      +  R +IV+   TF        D   TH++ ++    K R
Sbjct: 40  RTPIFRGCRVHVNGHTDPDREELRREIVMHGGTFVHYLARPSD--VTHIVAEHVPVAKRR 97

Query: 560 LAKKFNPEIKIVHPDWIFECLVNWKKVDEKPY 591
           L        K+V P W+  CL + + V  KPY
Sbjct: 98  LWHA----CKVVRPAWVSACLCSGELVPWKPY 125

>NDAI0I02370 Chr9 (540379..542661) [2283 bp, 760 aa] {ON} Anc_6.48
           YLR260W
          Length = 760

 Score = 33.1 bits (74), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 44/95 (46%), Gaps = 5/95 (5%)

Query: 125 LCTQCGKEVSADAFDGVPLDVVGDMDLQISETEAIRTGKALKEHL-----RRDKKLILVV 179
           L + C  EV    + G  +++  +MD+   +T A  +G  +   +     RR+ ++    
Sbjct: 380 LASDCFLEVHYTKYVGHAIEIAKEMDIDKFDTIACASGDGIPHEVINGLYRREDRVKAFN 439

Query: 180 DLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKS 214
            L  T I CG    ++   +  NNP++ TL  +KS
Sbjct: 440 KLTITQIPCGSGNAMSVSCHWTNNPSYATLCLIKS 474

>KLLA0E15621g Chr5 complement(1397950..1400625) [2676 bp, 891 aa]
           {ON} some similarities with uniprot|P38850 Saccharomyces
           cerevisiae YHR154W RTT107 Regulator of Ty1 Transposition
           Establishes Silent Chromatin involved in silencing
          Length = 891

 Score = 33.1 bits (74), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 33/68 (48%), Gaps = 1/68 (1%)

Query: 530 TSTFGATSTSDIDFLTTHLITKNPSTYKARLAKKFNPEIKI-VHPDWIFECLVNWKKVDE 588
            S FG T    +    TH+IT + +    +  +KF+    I + P+W+ +CL   + + E
Sbjct: 146 VSVFGGTCMDYLSTKATHIITWDKNDVAIKAMQKFHKYTVIYLMPNWLVDCLCGLEYIKE 205

Query: 589 KPYTLIVD 596
             Y + V+
Sbjct: 206 DEYLINVN 213

>Skud_16.218 Chr16 (401347..402789) [1443 bp, 480 aa] {ON} YPL063W
           (REAL)
          Length = 480

 Score = 32.7 bits (73), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 50/100 (50%), Gaps = 10/100 (10%)

Query: 250 RPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDP-----TGKLFGDRILSRDENGSL 304
           RPG + F   ++  +E+ +++     Y+ + A+ +DP     +  LF +  + +D    +
Sbjct: 221 RPGAEYFLGYLSQYYEIVLFSSNYMMYSEKTAEKLDPIHAFVSYNLFKEHCVYKD---GV 277

Query: 305 TTKSLAKLFPTDQSMVVVIDDRGDVWNWCP-NLIKVVPYN 343
             K L+KL   D S V++ID   + +   P N I + P+N
Sbjct: 278 HIKDLSKL-KRDLSKVIIIDTDPNSYKLQPENAIPMDPWN 316

>SAKL0C02200g Chr3 (194464..196458) [1995 bp, 664 aa] {ON} similar
           to uniprot|P53835 Saccharomyces cerevisiae YNL279W PRM1
           Pheromone-regulated multispanning membrane protein
           involved in membrane fusion during mating predicted to
           have 5 transmembrane segments and a coiled coil domain
           localizes to the shmoo tip regulated by Ste12p
          Length = 664

 Score = 32.7 bits (73), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 33/75 (44%), Gaps = 5/75 (6%)

Query: 20  LIPSVGSYLHEGDRLLVYKFWYLVERASETGVDDNEHDASPGGGAGSNGVSPPTKQLRES 79
           L+P+  S   +  RL +     L E      VD+N++D      +GS  + PPT+ + ES
Sbjct: 314 LVPAAWSEYRQWKRLCI-----LQEHYGHAAVDNNDNDGKNECASGSGTLQPPTRDIIES 368

Query: 80  IEFFESPYEGDLISW 94
            ++    Y      W
Sbjct: 369 YQYAYHRYPAMFGEW 383

>Skud_8.218 Chr8 (374359..377589) [3231 bp, 1076 aa] {ON} YHR154W
           (REAL)
          Length = 1076

 Score = 32.7 bits (73), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 36/145 (24%), Positives = 59/145 (40%), Gaps = 23/145 (15%)

Query: 471 LSNIHMTYYQMLSQENEPEPNLMEIIPSLKQKVFQNCFFVFSGLIPLGTDI---QRSDIV 527
           + N+   +Y    Q+  P          L  + F    F F  L    T+    QR  I 
Sbjct: 342 VGNVSWLFYMFAIQQFAPVSQC-----KLIHQPFHAKLFTFKELTVAYTNYFGSQRFYIQ 396

Query: 528 IWTSTFGATSTSDIDFLTTHLITKNPSTYKARLAKKF--NPEIKIVHPD--WIFECLVNW 583
                 G  ST ++    THLITKN    K ++AKK+  +P+  I+  +  W+ +C +  
Sbjct: 397 RLVEILGGLSTPELTRKNTHLITKNTIGKKFKVAKKWSLDPQNAIIVTNHMWLEQCYMKN 456

Query: 584 KKVDEKPYTLIVDSPISDEELQNFQ 608
            K++ +           D + QNF+
Sbjct: 457 AKLNPR-----------DSKFQNFK 470

>TPHA0A05110 Chr1 (1149460..1152657) [3198 bp, 1065 aa] {ON}
           Anc_5.94 YHR154W
          Length = 1065

 Score = 32.7 bits (73), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 57/139 (41%), Gaps = 20/139 (14%)

Query: 480 QMLSQENEPEPNLMEIIPSLKQKVFQNCFFVFSGLIPLGTDI---QRSDIVIWTSTFGAT 536
           QMLS +N   P +     +L   +     F  + LI   T I   QR  I    +  G  
Sbjct: 323 QMLSLDNFISPTI-----NLSNSLLPEPLFNVNELILTYTTIYGQQRHYIKNLVTALGGK 377

Query: 537 STSDIDFLTTHLITKNPSTYKARLAKKFNPEIKIVHPDWIFECLVNWKKVD----EKPYT 592
           ST  +    THLI   P   K   A+    +I +V+  W+ +C++   +V     EKP T
Sbjct: 378 STPTLSKRNTHLIFGVPYGKKYNYARSKLNKINVVNIKWLEQCVLLKSRVPENLFEKPIT 437

Query: 593 --------LIVDSPISDEE 603
                    I  +PI DE+
Sbjct: 438 SNCFNDSSFIEHAPIQDED 456

>ADL145C Chr4 complement(435983..438610) [2628 bp, 875 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR154W
           (ESC4)
          Length = 875

 Score = 32.7 bits (73), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 39/135 (28%), Positives = 58/135 (42%), Gaps = 9/135 (6%)

Query: 479 YQMLSQENEPEPNLMEIIPSLKQKVFQNCFFVFSGLIPLGTDIQRSDIVIWTSTFGATST 538
           + MLS +    P    ++     K+F     V +    LG   QR  I       G +ST
Sbjct: 313 FYMLSMQQFIAPTAKLVLSPRYPKLFTEKELVLAFTNYLGQ--QRYYIQRLVDLLGGSST 370

Query: 539 SDIDFLTTHLITKNPSTYKARLAKKFNPEIKIVHPDWIFECLVNWKKVDEKP--YTLIVD 596
           +++    THLI+  P   K   A K+N  I + H  W+ +C    KK+D     +T I  
Sbjct: 371 TELSRKNTHLISLFPHGKKHETALKWNSCIVVNHL-WLEQCYKLRKKLDPNAPEFTRI-- 427

Query: 597 SPISDEELQNFQSQL 611
            P+ D EL N   Q+
Sbjct: 428 -PVPD-ELSNAIGQM 440

>NCAS0C02210 Chr3 (411245..412720) [1476 bp, 491 aa] {ON} Anc_8.527
          Length = 491

 Score = 32.3 bits (72), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 50/100 (50%), Gaps = 10/100 (10%)

Query: 250 RPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDP-----TGKLFGDRILSRDENGSL 304
           RPG+  F   ++  +E+ +++     Y  +IA+ +DP     +  LF +  + +D    +
Sbjct: 229 RPGVDYFLGYLSQYYEIVLFSSNYMMYGEKIAEKLDPLHAFISYNLFKEHCVYKD---GV 285

Query: 305 TTKSLAKLFPTDQSMVVVIDDRGDVWNWCP-NLIKVVPYN 343
             K L+KL   D + V++ID   + +   P N I V P++
Sbjct: 286 HIKDLSKL-NRDVNKVLIIDTEPNNYKLQPENAIPVKPWD 324

>YHR154W Chr8 (402966..406178) [3213 bp, 1070 aa] {ON}
           RTT107Protein implicated in Mms22-dependent DNA repair
           during S phase; involved in recruiting the SMC5/6
           complex to double-strand breaks; DNA damage induces
           phosphorylation by Mec1p at one or more SQ/TQ motifs;
           interacts with Mms22p and Slx4p; has four BRCT domains;
           has a role in regulation of Ty1 transposition
          Length = 1070

 Score = 32.3 bits (72), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 35/142 (24%), Positives = 59/142 (41%), Gaps = 17/142 (11%)

Query: 471 LSNIHMTYYQMLSQENEPEPNLMEIIPSLKQKVFQNCFFVFSGLIPLGTDIQRSDIVIWT 530
           + N+   +Y    Q+  P      I      K+F +     +     G+  QR  I    
Sbjct: 342 VGNVSWLFYMFALQKFTPVSQCKLIHQPFHAKLFTSKELTVAYTNYFGS--QRFYIQRLV 399

Query: 531 STFGATSTSDIDFLTTHLITKNPSTYKARLAKKF--NPEIKIVHPD--WIFECLVNWKKV 586
              G  ST ++    THLITK+    K ++AKK+  +P+  I+  +  W+ +C +N  K+
Sbjct: 400 EILGGLSTPELTRKNTHLITKSTIGKKFKVAKKWSLDPQNAIIVTNHMWLEQCYMNNSKL 459

Query: 587 DEKPYTLIVDSPISDEELQNFQ 608
           + K           D   QNF+
Sbjct: 460 NPK-----------DSRFQNFK 470

>KLTH0C01584g Chr3 complement(139563..142304) [2742 bp, 913 aa] {ON}
           some similarities with uniprot|P38850 Saccharomyces
           cerevisiae YHR154W RTT107 Regulator of Ty1 Transposition
           Establishes Silent Chromatin involved in silencing
          Length = 913

 Score = 32.3 bits (72), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 28/114 (24%), Positives = 48/114 (42%), Gaps = 5/114 (4%)

Query: 479 YQMLSQENEPEPNLMEIIPSLKQKVFQNCFFVFSGLIPLGTDIQRSDIVIWTSTFGATST 538
           + M S ++   P    ++  L+  VF     + S    LG   QR  I       G  ST
Sbjct: 316 FHMWSLQSFVLPQFKLLLSPLRPPVFNKGQLILSYTNYLGQ--QRYYIQKLVEALGGVST 373

Query: 539 SDIDFLTTHLITKNPSTYKARLAKKFNPEIKIVHPDWIFECLVNWKKVDEKPYT 592
           +++    THL+T  P   K   A ++    KI +  W+ +C   ++K  + P+ 
Sbjct: 374 TELTKKNTHLLTCLPLGQKYEAALRWEGTCKIANHLWLEDC---YRKQTQVPFV 424

>CAGL0H05159g Chr8 complement(501094..502551) [1458 bp, 485 aa] {ON}
           similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063w
          Length = 485

 Score = 32.0 bits (71), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 49/100 (49%), Gaps = 10/100 (10%)

Query: 250 RPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDP-----TGKLFGDRILSRDENGSL 304
           RPG   F   ++  +E+ +++     YA +IA+ +DP     +  LF +  + +D    +
Sbjct: 224 RPGADYFLGYLSQYYEIVLFSSNYMMYAEKIAEKMDPIHAFISYNLFKEHCVYKD---GV 280

Query: 305 TTKSLAKLFPTDQSMVVVIDDRGDVWNWCP-NLIKVVPYN 343
             K L+KL   D   V++ID   + +   P N I + P++
Sbjct: 281 HIKDLSKL-NRDLKKVMIIDTDENSYKLQPENAIPMDPWD 319

>SAKL0H10296g Chr8 complement(880969..882405) [1437 bp, 478 aa] {ON}
           similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063W TIM50 Protein of the inner mitochondrial
           membrane required for import of mitochondrial matrix
           proteins
          Length = 478

 Score = 31.6 bits (70), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 47/99 (47%), Gaps = 10/99 (10%)

Query: 250 RPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDP-----TGKLFGDRILSRDENGSL 304
           RPG   F   ++  +E+ +++     YA ++A+ +DP     T  L+ +  L +D    +
Sbjct: 217 RPGADYFLGYLSQYYEIVLFSSNYMMYAEKVAEKMDPIHAFVTYNLYKEHCLYKD---GV 273

Query: 305 TTKSLAKLFPTDQSMVVVIDDRGDVWNWCP-NLIKVVPY 342
             K L+KL   D    ++ID   + +   P N I V P+
Sbjct: 274 HIKDLSKL-NRDLGKTMIIDTDPNSYKLQPENAIPVKPW 311

>NDAI0B01960 Chr2 complement(477552..478871) [1320 bp, 439 aa] {ON}
           Anc_8.258 YLR085C
          Length = 439

 Score = 31.6 bits (70), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 44/100 (44%), Gaps = 7/100 (7%)

Query: 287 TGKLFGDRILSRDENGSLTTKSLA---KLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYN 343
           +GK   D ++ + EN +++T +L    K F  D     ++ D G    W   +IK VPY 
Sbjct: 154 SGKKNDDDMIGQSENVTISTDNLKDDKKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYY 213

Query: 344 FFVGVGDINSNFLPKQSTGMLQLGRKTRQKSQESQELLTD 383
             +   DI   FL    TG+L+     R      + LL +
Sbjct: 214 KAIKKLDIGGRFL----TGLLKETLSFRHYDLMDETLLVN 249

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.134    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 77,798,640
Number of extensions: 3564995
Number of successful extensions: 21659
Number of sequences better than 10.0: 240
Number of HSP's gapped: 22105
Number of HSP's successfully gapped: 265
Length of query: 732
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 615
Effective length of database: 40,065,477
Effective search space: 24640268355
Effective search space used: 24640268355
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 70 (31.6 bits)