Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_13.4898.837ON37237214440.0
YMR276W (DSK2)8.837ON37337613640.0
Skud_13.4488.837ON36437213480.0
Suva_13.4648.837ON36637413330.0
NCAS0C004308.837ON36938910241e-138
KAFR0B039008.837ON37938210131e-136
CAGL0M02937g8.837ON37338010111e-136
TDEL0B006008.837ON3693809781e-131
SAKL0D01540g8.837ON3653779661e-129
TPHA0I002208.837ON3773859501e-126
Kpol_1068.118.837ON3813909431e-125
Kwal_27.102758.837ON3793839251e-123
ZYRO0G14124g8.837ON3692357562e-97
NDAI0K004408.837ON4042207105e-90
TBLA0D032308.837ON3752217051e-89
KLTH0C03938g8.837ON3762307041e-89
KLLA0D01859g8.837ON3712186868e-87
ABL129W8.837ON3452126664e-84
KNAG0J002908.837ON3672306451e-80
Ecym_46088.837ON4062276481e-80
TBLA0B032408.837ON2842191592e-11
SAKL0H15818g8.311ON77711172e-07
Kpol_1036.628.311ON77591153e-07
CAGL0B01589g8.311ON77561145e-07
KLLA0F17974g8.311ON77711146e-07
KLTH0G12540g8.311ON77711136e-07
TPHA0C008908.311ON77561092e-06
ZYRO0D05962g8.311ON77561083e-06
NDAI0J010708.311ON77561083e-06
NCAS0B035208.311ON77561074e-06
TDEL0G017504.16ON77561075e-06
NDAI0H002704.16ON77561058e-06
TDEL0F043808.311ON77561059e-06
AFR358W1.480ON413791122e-05
Suva_10.32singletonON62561012e-05
NDAI0F003005.701ON187771073e-05
Kwal_YGOB_Anc_5.7015.701ON128561044e-05
YDR139C (RUB1)8.311ON77591014e-05
KLTH0E01078g5.701ON128561044e-05
Smik_9.215.701ON124561044e-05
ZYRO0G06622g5.701ON128561044e-05
KAFR0D022305.701ON128561044e-05
KAFR0H002205.701ON128561044e-05
Suva_11.3305.701ON128561044e-05
Skud_11.3335.701ON128561044e-05
YIL148W (RPL40A)5.701ON128561044e-05
YKR094C (RPL40B)5.701ON128561044e-05
Skud_9.205.701ON125561044e-05
Smik_11.3575.701ON125561044e-05
SAKL0E14894g5.701ON128561044e-05
KLLA0A00616g5.701ON128561044e-05
TPHA0E002405.701ON128561044e-05
TPHA0D046005.701ON128561044e-05
TBLA0E021105.701ON128561044e-05
CAGL0G02475g5.701ON128561044e-05
Kpol_1043.695.701ON128561044e-05
NDAI0E050305.701ON128561044e-05
NCAS0A032105.701ON128561044e-05
NCAS0G002405.701ON128561044e-05
KAFR0E005301.480ON379781104e-05
TDEL0B022005.701ON128561034e-05
Ecym_40195.701ON128561035e-05
AFR285C5.701ON128561035e-05
KNAG0L021205.701ON128561035e-05
Suva_9.405.701ON144561046e-05
Ecym_84084.16ON153561047e-05
KNAG0J028804.16ON153561037e-05
TPHA0K022504.16ON153561037e-05
Suva_10.34singletonON151561038e-05
KNAG0C065805.701ON149561011e-04
KLLA0E22133g1.480ON383681061e-04
TBLA0G006704.16ON229561032e-04
NDAI0D049304.16ON229561032e-04
KAFR0I014704.16ON229561032e-04
Ecym_41818.386ON152561012e-04
Kwal_55.206074.16ON231561032e-04
ZYRO0C04026g8.386ON152561002e-04
Suva_10.33singletonON254561032e-04
SAKL0H13926g8.386ON154561002e-04
KLTH0F08734g8.386ON150561002e-04
AGL128W8.386ON152561002e-04
TPHA0C023908.386ON150561002e-04
KLTH0E05852g4.16ON409561052e-04
Kwal_23.33118.386ON150561002e-04
SAKL0H25784g4.16ON305561042e-04
KLLA0D18304g8.386ON15056992e-04
KLLA0E00749g4.16ON381561033e-04
Suva_10.304.16ON381561033e-04
ACL062C4.16ON382561033e-04
Skud_12.294.16ON381561033e-04
YLL039C (UBI4)4.16ON381561033e-04
KAFR0H020008.386ON15256993e-04
YLR167W (RPS31)8.386ON15256993e-04
ZYRO0G07854g4.16ON460561033e-04
NCAS0C058504.16ON388561033e-04
KLTH0C03410g1.480ON391471033e-04
NCAS0C029408.386ON15256983e-04
NDAI0G022808.386ON15256983e-04
Kpol_1070.64.16ON533561043e-04
Smik_12.184.16ON460561033e-04
TDEL0F051008.386ON15056983e-04
Kpol_1030.58.386ON15256983e-04
Kpol_1024.168.386ON15256983e-04
NDAI0G003301.480ON427661033e-04
CAGL0D05082g4.16ON533561033e-04
CAGL0G08173g8.386ON15256983e-04
KNAG0A027308.386ON15056983e-04
Kwal_27.101521.480ON381471015e-04
Suva_10.2668.386ON15256975e-04
Skud_12.2348.386ON15256975e-04
Smik_12.2298.386ON15256975e-04
TBLA0H031808.386ON15254966e-04
Suva_5.321.480ON409661016e-04
Ecym_35721.480ON443771016e-04
CAGL0L01309g1.480ON392661007e-04
Skud_5.531.480ON397661008e-04
KAFR0I027801.480ON21480988e-04
Smik_5.561.480ON39766990.001
YEL037C (RAD23)1.480ON39866980.001
SAKL0D11814g1.480ON40066970.002
KAFR0C030008.142ON39740960.002
SAKL0H24772g8.142ON41443920.008
AGL185W8.311ON5049810.008
NDAI0B01850singletonON40344900.012
TBLA0D022108.142ON56338900.016
NCAS0B045908.142ON44742890.016
ZYRO0D08140g6.343ON7358800.019
CAGL0L06028g8.142ON50538880.022
KLLA0C08470g6.343ON7459790.030
TBLA0B021601.480ON40471870.030
Ecym_42448.311ON5034760.049
TPHA0O004401.480ON36964840.069
NCAS0G041201.480ON39267830.082
YGL181W (GTS1)8.142ON39638820.11
ZYRO0F05192g1.480ON38472820.13
Smik_7.918.142ON39938810.14
TDEL0B046908.142ON44238810.18
Kwal_56.238838.311ON5249700.28
TBLA0H013108.311ON7134720.28
Kpol_370.61.480ON40454780.32
Suva_7.818.142ON40138770.43
SAKL0A01210g6.343ON7358690.58
NCAS0A053906.343ON7358680.87
Ecym_25016.343ON7358680.90
TBLA0F041406.343ON7355680.96
Skud_4.3988.311ON9482691.1
Kpol_325.46.343ON7459652.3
Smik_14.3626.343ON7358643.0
CAGL0M10912g6.343ON7361643.3
TDEL0C025901.480ON36826703.3
Skud_14.3646.343ON7358643.4
TBLA0A071401.51ON9672653.4
KLTH0A06820g6.343ON7352643.5
KNAG0D003706.343ON7358634.3
Suva_14.3876.343ON7350634.3
Skud_7.908.142ON39638694.4
Kpol_2002.451.51ON10472654.5
CAGL0K05731g1.51ON10872654.5
KLTH0F01650g1.51ON9472645.4
TPHA0E036501.51ON10572645.8
TPHA0H004008.142ON46638677.4
Kpol_541.508.142ON51138677.9
Suva_2.6891.51ON10172629.5
Skud_4.7851.51ON10172629.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_13.489
         (372 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_13.489 Chr13 (801868..802986) [1119 bp, 372 aa] {ON} YMR276...   560   0.0  
YMR276W Chr13 (818827..819948) [1122 bp, 373 aa] {ON}  DSK2Nucle...   530   0.0  
Skud_13.448 Chr13 (792186..793277) [1092 bp, 364 aa] {ON} YMR276...   523   0.0  
Suva_13.464 Chr13 (801516..802616) [1101 bp, 366 aa] {ON} YMR276...   518   0.0  
NCAS0C00430 Chr3 complement(67718..68827) [1110 bp, 369 aa] {ON}...   399   e-138
KAFR0B03900 Chr2 (810391..811530) [1140 bp, 379 aa] {ON} Anc_8.8...   394   e-136
CAGL0M02937g Chr13 (331097..332218) [1122 bp, 373 aa] {ON} highl...   394   e-136
TDEL0B00600 Chr2 complement(115615..116724) [1110 bp, 369 aa] {O...   381   e-131
SAKL0D01540g Chr4 complement(124423..125520) [1098 bp, 365 aa] {...   376   e-129
TPHA0I00220 Chr9 (39858..40991) [1134 bp, 377 aa] {ON} Anc_8.837...   370   e-126
Kpol_1068.11 s1068 complement(21199..22344) [1146 bp, 381 aa] {O...   367   e-125
Kwal_27.10275 s27 complement(273277..274416) [1140 bp, 379 aa] {...   360   e-123
ZYRO0G14124g Chr7 (1125418..1126527) [1110 bp, 369 aa] {ON} simi...   295   2e-97
NDAI0K00440 Chr11 complement(99224..100438) [1215 bp, 404 aa] {O...   278   5e-90
TBLA0D03230 Chr4 complement(796939..798066) [1128 bp, 375 aa] {O...   276   1e-89
KLTH0C03938g Chr3 complement(344354..345484) [1131 bp, 376 aa] {...   275   1e-89
KLLA0D01859g Chr4 (161628..162743) [1116 bp, 371 aa] {ON} simila...   268   8e-87
ABL129W Chr2 (153723..154760) [1038 bp, 345 aa] {ON} Syntenic ho...   261   4e-84
KNAG0J00290 Chr10 complement(44234..45337) [1104 bp, 367 aa] {ON...   253   1e-80
Ecym_4608 Chr4 (1185310..1186530) [1221 bp, 406 aa] {ON} similar...   254   1e-80
TBLA0B03240 Chr2 (756434..757288) [855 bp, 284 aa] {ON} Anc_8.83...    66   2e-11
SAKL0H15818g Chr8 (1379077..1379225,1379297..1379381) [234 bp, 7...    50   2e-07
Kpol_1036.62 s1036 complement(173662..173746,173844..173992) [23...    49   3e-07
CAGL0B01589g Chr2 (145132..145280,145404..145488) [234 bp, 77 aa...    49   5e-07
KLLA0F17974g Chr6 (1644903..1645051,1645153..1645237) [234 bp, 7...    49   6e-07
KLTH0G12540g Chr7 (1065801..1065949,1066013..1066097) [234 bp, 7...    48   6e-07
TPHA0C00890 Chr3 (187882..188030,188103..188187) [234 bp, 77 aa]...    47   2e-06
ZYRO0D05962g Chr4 (506710..506858,506936..507020) [234 bp, 77 aa...    46   3e-06
NDAI0J01070 Chr10 (247102..247250,247366..247450) [234 bp, 77 aa...    46   3e-06
NCAS0B03520 Chr2 complement(621285..621369,621473..621621) [234 ...    46   4e-06
TDEL0G01750 Chr7 (343412..343645) [234 bp, 77 aa] {ON} Anc_4.16 ...    46   5e-06
NDAI0H00270 Chr8 complement(45883..46116) [234 bp, 77 aa] {ON} A...    45   8e-06
TDEL0F04380 Chr6 complement(823866..823950,824011..824159) [234 ...    45   9e-06
AFR358W Chr6 (1087725..1088966) [1242 bp, 413 aa] {ON} Syntenic ...    48   2e-05
Suva_10.32 Chr10 complement(68200..68385) [186 bp, 62 aa] {ON} Y...    44   2e-05
NDAI0F00300 Chr6 (66116..66679) [564 bp, 187 aa] {ON} Anc_5.701        46   3e-05
Kwal_YGOB_Anc_5.701 s55 (88799..88806,89169..89547) [387 bp, 128...    45   4e-05
YDR139C Chr4 complement(733618..733702,733776..733924) [234 bp, ...    44   4e-05
KLTH0E01078g Chr5 (105372..105379,105743..106121) [387 bp, 128 a...    45   4e-05
Smik_9.21 Chr9 (46848..47219) [372 bp, 124 aa] {ON} YKR094C (REAL)     45   4e-05
ZYRO0G06622g Chr7 (527968..527975,528043..528421) [387 bp, 128 a...    45   4e-05
KAFR0D02230 Chr4 (449707..449714,450088..450466) [387 bp, 128 aa...    45   4e-05
KAFR0H00220 Chr8 (32171..32178,32513..32891) [387 bp, 128 aa] {O...    45   4e-05
Suva_11.330 Chr11 complement(602690..603068,603446..603453) [387...    45   4e-05
Skud_11.333 Chr11 complement(599496..599874,600245..600252) [387...    45   4e-05
YIL148W Chr9 (68708..68715,69150..69528) [387 bp, 128 aa] {ON}  ...    45   4e-05
YKR094C Chr11 complement(617996..618374,618743..618750) [387 bp,...    45   4e-05
Skud_9.20 Chr9 (46249..46623) [375 bp, 125 aa] {ON} YKR094C (REAL)     45   4e-05
Smik_11.357 Chr11 complement(608082..608456) [375 bp, 125 aa] {O...    45   4e-05
SAKL0E14894g Chr5 complement(1235488..1235866,1236205..1236212) ...    45   4e-05
KLLA0A00616g Chr1 (59180..59187,59727..60105) [387 bp, 128 aa] {...    45   4e-05
TPHA0E00240 Chr5 (33468..33475,34104..34482) [387 bp, 128 aa] {O...    45   4e-05
TPHA0D04600 Chr4 complement(1005511..1005889,1006076..1006083) [...    45   4e-05
TBLA0E02110 Chr5 complement(516651..517029,517297..517304) [387 ...    45   4e-05
CAGL0G02475g Chr7 complement(220990..221368,222103..222110) [387...    45   4e-05
Kpol_1043.69 s1043 complement(145335..145721) [387 bp, 128 aa] {...    45   4e-05
NDAI0E05030 Chr5 complement(1148916..1149294,1149627..1149634) [...    45   4e-05
NCAS0A03210 Chr1 (633779..633786,634077..634455) [387 bp, 128 aa...    45   4e-05
NCAS0G00240 Chr7 (39394..39401,39701..40079) [387 bp, 128 aa] {O...    45   4e-05
KAFR0E00530 Chr5 complement(113019..114158) [1140 bp, 379 aa] {O...    47   4e-05
TDEL0B02200 Chr2 (395520..395527,395598..395976) [387 bp, 128 aa...    44   4e-05
Ecym_4019 Chr4 (48709..48716,49112..49490) [387 bp, 128 aa] {ON}...    44   5e-05
AFR285C Chr6 complement(950588..950966,951128..951135) [387 bp, ...    44   5e-05
KNAG0L02120 Chr12 complement(379968..380346,380662..380669) [387...    44   5e-05
Suva_9.40 Chr9 (63806..64240) [435 bp, 144 aa] {ON} YIL148W (REAL)     45   6e-05
Ecym_8408 Chr8 (845058..845519) [462 bp, 153 aa] {ON} similar to...    45   7e-05
KNAG0J02880 Chr10 (550889..551350) [462 bp, 153 aa] {ON} Anc_4.1...    44   7e-05
TPHA0K02250 Chr11 (482029..482490) [462 bp, 153 aa] {ON} Anc_4.1...    44   7e-05
Suva_10.34 Chr10 complement(69167..69622) [456 bp, 151 aa] {ON} ...    44   8e-05
KNAG0C06580 Chr3 complement(1275504..1275945,1276297..1276304) [...    44   1e-04
KLLA0E22133g Chr5 complement(1974635..1975786) [1152 bp, 383 aa]...    45   1e-04
TBLA0G00670 Chr7 (142636..143325) [690 bp, 229 aa] {ON} Anc_4.16...    44   2e-04
NDAI0D04930 Chr4 (1172741..1173430) [690 bp, 229 aa] {ON}              44   2e-04
KAFR0I01470 Chr9 (306964..307653) [690 bp, 229 aa] {ON} Anc_5.70...    44   2e-04
Ecym_4181 Chr4 complement(379972..380430) [459 bp, 152 aa] {ON} ...    44   2e-04
Kwal_55.20607 s55 complement(488683..489378) [696 bp, 231 aa] {O...    44   2e-04
ZYRO0C04026g Chr3 (318229..318687) [459 bp, 152 aa] {ON} similar...    43   2e-04
Suva_10.33 Chr10 complement(68388..69152) [765 bp, 254 aa] {ON} ...    44   2e-04
SAKL0H13926g Chr8 complement(1189515..1189979) [465 bp, 154 aa] ...    43   2e-04
KLTH0F08734g Chr6 complement(754886..755338) [453 bp, 150 aa] {O...    43   2e-04
AGL128W Chr7 (470174..470632) [459 bp, 152 aa] {ON} Syntenic hom...    43   2e-04
TPHA0C02390 Chr3 complement(536137..536589) [453 bp, 150 aa] {ON...    43   2e-04
KLTH0E05852g Chr5 complement(528861..530090) [1230 bp, 409 aa] {...    45   2e-04
Kwal_23.3311 s23 complement(238458..238910) [453 bp, 150 aa] {ON...    43   2e-04
SAKL0H25784g Chr8 (2259314..2260231) [918 bp, 305 aa] {ON} highl...    45   2e-04
KLLA0D18304g Chr4 (1545371..1545823) [453 bp, 150 aa] {ON} simil...    43   2e-04
KLLA0E00749g Chr5 complement(74948..76093) [1146 bp, 381 aa] {ON...    44   3e-04
Suva_10.30 Chr10 complement(67747..67841,68061..68288,68558..690...    44   3e-04
ACL062C Chr3 complement(255353..256501) [1149 bp, 382 aa] {ON} S...    44   3e-04
Skud_12.29 Chr12 complement(55051..55829,56058..56424) [1146 bp,...    44   3e-04
YLL039C Chr12 complement(64062..65207) [1146 bp, 381 aa] {ON}  U...    44   3e-04
KAFR0H02000 Chr8 complement(369778..370236) [459 bp, 152 aa] {ON...    43   3e-04
YLR167W Chr12 (498947..499405) [459 bp, 152 aa] {ON}  RPS31Fusio...    43   3e-04
ZYRO0G07854g Chr7 complement(634289..635671) [1383 bp, 460 aa] {...    44   3e-04
NCAS0C05850 Chr3 (1203331..1204497) [1167 bp, 388 aa] {ON}             44   3e-04
KLTH0C03410g Chr3 complement(295299..296474) [1176 bp, 391 aa] {...    44   3e-04
NCAS0C02940 Chr3 complement(552015..552473) [459 bp, 152 aa] {ON...    42   3e-04
NDAI0G02280 Chr7 complement(511522..511980) [459 bp, 152 aa] {ON...    42   3e-04
Kpol_1070.6 s1070 complement(16980..18581) [1602 bp, 533 aa] {ON...    45   3e-04
Smik_12.18 Chr12 complement(49088..49552,49091..49552,49091..495...    44   3e-04
TDEL0F05100 Chr6 (959574..960026) [453 bp, 150 aa] {ON} Anc_8.38...    42   3e-04
Kpol_1030.5 s1030 complement(10263..10721) [459 bp, 152 aa] {ON}...    42   3e-04
Kpol_1024.16 s1024 complement(58683..59141) [459 bp, 152 aa] {ON...    42   3e-04
NDAI0G00330 Chr7 complement(54805..56088) [1284 bp, 427 aa] {ON}...    44   3e-04
CAGL0D05082g Chr4 (488733..490334) [1602 bp, 533 aa] {ON} simila...    44   3e-04
CAGL0G08173g Chr7 (776549..777007) [459 bp, 152 aa] {ON} highly ...    42   3e-04
KNAG0A02730 Chr1 complement(296966..297418) [453 bp, 150 aa] {ON...    42   3e-04
Kwal_27.10152 s27 complement(216695..217840) [1146 bp, 381 aa] {...    44   5e-04
Suva_10.266 Chr10 (471118..471576) [459 bp, 152 aa] {ON} YLR167W...    42   5e-04
Skud_12.234 Chr12 (445677..446135) [459 bp, 152 aa] {ON} YLR167W...    42   5e-04
Smik_12.229 Chr12 (446071..446529) [459 bp, 152 aa] {ON} YLR167W...    42   5e-04
TBLA0H03180 Chr8 (775282..775740) [459 bp, 152 aa] {ON} Anc_8.38...    42   6e-04
Suva_5.32 Chr5 complement(56798..58027) [1230 bp, 409 aa] {ON} Y...    44   6e-04
Ecym_3572 Chr3 complement(1083184..1084515) [1332 bp, 443 aa] {O...    44   6e-04
CAGL0L01309g Chr12 complement(148931..150109) [1179 bp, 392 aa] ...    43   7e-04
Skud_5.53 Chr5 complement(79502..80695) [1194 bp, 397 aa] {ON} Y...    43   8e-04
KAFR0I02780 Chr9 (560687..561331) [645 bp, 214 aa] {ON} Anc_1.48...    42   8e-04
Smik_5.56 Chr5 complement(83505..84698) [1194 bp, 397 aa] {ON} Y...    43   0.001
YEL037C Chr5 complement(81407..82603) [1197 bp, 398 aa] {ON}  RA...    42   0.001
SAKL0D11814g Chr4 (981832..983034) [1203 bp, 400 aa] {ON} simila...    42   0.002
KAFR0C03000 Chr3 (597127..598320) [1194 bp, 397 aa] {ON} Anc_8.1...    42   0.002
SAKL0H24772g Chr8 complement(2155837..2157081) [1245 bp, 414 aa]...    40   0.008
AGL185W Chr7 (350325..350477) [153 bp, 50 aa] {ON} Syntenic homo...    36   0.008
NDAI0B01850 Chr2 complement(440321..441532) [1212 bp, 403 aa] {O...    39   0.012
TBLA0D02210 Chr4 (555236..556927) [1692 bp, 563 aa] {ON} Anc_8.1...    39   0.016
NCAS0B04590 Chr2 complement(835478..836821) [1344 bp, 447 aa] {O...    39   0.016
ZYRO0D08140g Chr4 (705216..705437) [222 bp, 73 aa] {ON} similar ...    35   0.019
CAGL0L06028g Chr12 complement(677581..679098) [1518 bp, 505 aa] ...    39   0.022
KLLA0C08470g Chr3 (742530..742754) [225 bp, 74 aa] {ON} highly s...    35   0.030
TBLA0B02160 Chr2 complement(496901..498115) [1215 bp, 404 aa] {O...    38   0.030
Ecym_4244 Chr4 complement(507884..508036) [153 bp, 50 aa] {ON} s...    34   0.049
TPHA0O00440 Chr15 (78697..79806) [1110 bp, 369 aa] {ON} Anc_1.48...    37   0.069
NCAS0G04120 Chr7 (768760..769938) [1179 bp, 392 aa] {ON} Anc_1.4...    37   0.082
YGL181W Chr7 (157906..159096) [1191 bp, 396 aa] {ON}  GTS1Protei...    36   0.11 
ZYRO0F05192g Chr6 (434982..436136) [1155 bp, 384 aa] {ON} simila...    36   0.13 
Smik_7.91 Chr7 (152642..153637,153905..154108) [1200 bp, 399 aa]...    36   0.14 
TDEL0B04690 Chr2 (832571..833899) [1329 bp, 442 aa] {ON} Anc_8.1...    36   0.18 
Kwal_56.23883 s56 complement(755602..755760) [159 bp, 52 aa] {ON...    32   0.28 
TBLA0H01310 Chr8 (293921..294136) [216 bp, 71 aa] {ON} Anc_8.311...    32   0.28 
Kpol_370.6 s370 (10094..11308) [1215 bp, 404 aa] {ON} (10094..11...    35   0.32 
Suva_7.81 Chr7 (153418..154434,154933..155121) [1206 bp, 401 aa]...    34   0.43 
SAKL0A01210g Chr1 (118298..118519) [222 bp, 73 aa] {ON} similar ...    31   0.58 
NCAS0A05390 Chr1 complement(1067778..1067999) [222 bp, 73 aa] {O...    31   0.87 
Ecym_2501 Chr2 complement(982410..982631) [222 bp, 73 aa] {ON} s...    31   0.90 
TBLA0F04140 Chr6 complement(1022911..1023132) [222 bp, 73 aa] {O...    31   0.96 
Skud_4.398 Chr4 complement(705294..705386,705390..705431,705435....    31   1.1  
Kpol_325.4 s325 complement(7253..7477) [225 bp, 74 aa] {ON} comp...    30   2.3  
Smik_14.362 Chr14 complement(645208..645426) [219 bp, 73 aa] {ON...    29   3.0  
CAGL0M10912g Chr13 complement(1083434..1083655) [222 bp, 73 aa] ...    29   3.3  
TDEL0C02590 Chr3 complement(448900..450006) [1107 bp, 368 aa] {O...    32   3.3  
Skud_14.364 Chr14 complement(655336..655554) [219 bp, 73 aa] {ON...    29   3.4  
TBLA0A07140 Chr1 (1774301..1774591) [291 bp, 96 aa] {ON} Anc_1.5...    30   3.4  
KLTH0A06820g Chr1 complement(569895..570116) [222 bp, 73 aa] {ON...    29   3.5  
KNAG0D00370 Chr4 (51604..51825) [222 bp, 73 aa] {ON} Anc_6.343 Y...    29   4.3  
Suva_14.387 Chr14 complement(668510..668728) [219 bp, 73 aa] {ON...    29   4.3  
Skud_7.90 Chr7 (163529..164719) [1191 bp, 396 aa] {ON} YGL181W (...    31   4.4  
Kpol_2002.45 s2002 (93655..93969) [315 bp, 104 aa] {ON} (93655.....    30   4.5  
CAGL0K05731g Chr11 complement(561289..561615) [327 bp, 108 aa] {...    30   4.5  
KLTH0F01650g Chr6 (126388..126672) [285 bp, 94 aa] {ON} highly s...    29   5.4  
TPHA0E03650 Chr5 complement(773947..774264) [318 bp, 105 aa] {ON...    29   5.8  
TPHA0H00400 Chr8 (77122..78522) [1401 bp, 466 aa] {ON} Anc_8.142...    30   7.4  
Kpol_541.50 s541 complement(162130..163665) [1536 bp, 511 aa] {O...    30   7.9  
Suva_2.689 Chr2 (1222165..1222470) [306 bp, 101 aa] {ON} YDR510W...    28   9.5  
Skud_4.785 Chr4 (1389558..1389863) [306 bp, 101 aa] {ON} YDR510W...    28   9.9  

>Smik_13.489 Chr13 (801868..802986) [1119 bp, 372 aa] {ON} YMR276W
           (REAL)
          Length = 372

 Score =  560 bits (1444), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/372 (77%), Positives = 288/372 (77%)

Query: 1   MSLNIHIKSGQDKWEVSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESY 60
           MSLNIHIKSGQDKWEVSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESY
Sbjct: 1   MSLNIHIKSGQDKWEVSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESY 60

Query: 61  HIQDGHSVHLVKSQPKPQPXXXXXXXXXXXXXXXXXXXXXPNMSSGQSAGFNPLADLTSA 120
           HIQDGHSVHLVKSQPKPQP                     PNMSSGQSAGFNPLADLTSA
Sbjct: 61  HIQDGHSVHLVKSQPKPQPGAAAGTNNATATGAAAGTVATPNMSSGQSAGFNPLADLTSA 120

Query: 121 RYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDFMIQS 180
           RYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDFMIQS
Sbjct: 121 RYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDFMIQS 180

Query: 181 NPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMMDPNXXXXXXXXXXXXXXXXX 240
           NPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMMDPN                 
Sbjct: 181 NPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMMDPNAGTGSTGGAASAFPAPG 240

Query: 241 XXXPEEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLLNPALNPFASAGNATGTGMPAF 300
              PEE                               LLNPALNPFASAGNATGTGMPAF
Sbjct: 241 GDAPEESANTNTNTNTASSPNAGSNASSSTAANPFASLLNPALNPFASAGNATGTGMPAF 300

Query: 301 DPALLASMFXXXXXXXXXXXXEDTRPPEERYEHQLRQLNDMGFFDFDRNVAALRRSGGSV 360
           DPALLASMF            EDTRPPEERYEHQLRQLNDMGFFDFDRNVAALRRSGGSV
Sbjct: 301 DPALLASMFQPQQASAQASQPEDTRPPEERYEHQLRQLNDMGFFDFDRNVAALRRSGGSV 360

Query: 361 QGALDSLLNGDV 372
           QGALDSLLNGDV
Sbjct: 361 QGALDSLLNGDV 372

>YMR276W Chr13 (818827..819948) [1122 bp, 373 aa] {ON}
           DSK2Nuclear-enriched ubiquitin-like
           polyubiquitin-binding protein, required for spindle pole
           body (SPB) duplication and for transit through the G2/M
           phase of the cell cycle, involved in proteolysis,
           interacts with the proteasome
          Length = 373

 Score =  530 bits (1364), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/376 (74%), Positives = 284/376 (75%), Gaps = 7/376 (1%)

Query: 1   MSLNIHIKSGQDKWEVSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESY 60
           MSLNIHIKSGQDKWEV+VAPESTV QFKEAI+KANG+PVANQRLIYSGKILKDDQTVESY
Sbjct: 1   MSLNIHIKSGQDKWEVNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESY 60

Query: 61  HIQDGHSVHLVKSQPKPQPXXXXXXXXXXXXXXXXXXXXXPNMSSGQSAGFNPLADLTSA 120
           HIQDGHSVHLVKSQPKPQ                      PNMSSGQSAGFNPLADLTSA
Sbjct: 61  HIQDGHSVHLVKSQPKPQTASAAGANNATATGAAAGTGATPNMSSGQSAGFNPLADLTSA 120

Query: 121 RYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDFMIQS 180
           RYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDFMIQS
Sbjct: 121 RYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDFMIQS 180

Query: 181 NPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMMDPNXXXXXXXXXXXXXXXXX 240
           NPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMMDPN                 
Sbjct: 181 NPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMMDPNAGMGSAGGAASAFPAPG 240

Query: 241 XXXPEEXXXXXXXXXXXXXXXXXXXXXXXXXXXXX----XXLLNPALNPFASAGNATGTG 296
              PEE                                   LLNPALNPFA+AGNA  TG
Sbjct: 241 GDAPEEGSNTNTTSSSNTGNNAGTNAGTNAGANTAANPFASLLNPALNPFANAGNAASTG 300

Query: 297 MPAFDPALLASMFXXXXXXXXXXXXEDTRPPEERYEHQLRQLNDMGFFDFDRNVAALRRS 356
           MPAFDPALLASMF            EDTRPPEERYEHQLRQLNDMGFFDFDRNVAALRRS
Sbjct: 301 MPAFDPALLASMF---QPPVQASQAEDTRPPEERYEHQLRQLNDMGFFDFDRNVAALRRS 357

Query: 357 GGSVQGALDSLLNGDV 372
           GGSVQGALDSLLNGDV
Sbjct: 358 GGSVQGALDSLLNGDV 373

>Skud_13.448 Chr13 (792186..793277) [1092 bp, 364 aa] {ON} YMR276W
           (REAL)
          Length = 364

 Score =  523 bits (1348), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/372 (72%), Positives = 278/372 (74%), Gaps = 8/372 (2%)

Query: 1   MSLNIHIKSGQDKWEVSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESY 60
           MSLNIHIKSGQDKWEV+VAPE TV QFKEAISKAN +PVANQRLIYSGKILKDDQTV+SY
Sbjct: 1   MSLNIHIKSGQDKWEVAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSY 60

Query: 61  HIQDGHSVHLVKSQPKPQPXXXXXXXXXXXXXXXXXXXXXPNMSSGQSAGFNPLADLTSA 120
           HIQDGHSVHLVKSQPKP                       PNMSSGQSAGFNPLADLTSA
Sbjct: 61  HIQDGHSVHLVKSQPKPDAGGATGANNATATSAAVGTSATPNMSSGQSAGFNPLADLTSA 120

Query: 121 RYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDFMIQS 180
           RYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDFMIQS
Sbjct: 121 RYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDFMIQS 180

Query: 181 NPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMMDPNXXXXXXXXXXXXXXXXX 240
           NPQLQAMGPQARQMLQSPMFRQMLTNP+M+RQSMQFARMMDPN                 
Sbjct: 181 NPQLQAMGPQARQMLQSPMFRQMLTNPEMMRQSMQFARMMDPNADNSAASAFPAPGG--- 237

Query: 241 XXXPEEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLLNPALNPFASAGNATGTGMPAF 300
                +                               LLNPALNPFA+AGN   TGMPAF
Sbjct: 238 -----DASEEGANTNAVPSSNAGTNGSANAAANPFASLLNPALNPFANAGNTAPTGMPAF 292

Query: 301 DPALLASMFXXXXXXXXXXXXEDTRPPEERYEHQLRQLNDMGFFDFDRNVAALRRSGGSV 360
           DPALLASMF            ED+RPPEERYEHQLRQLNDMGFFDFDRNVAALRRSGGSV
Sbjct: 293 DPALLASMFQPQQASAQASQPEDSRPPEERYEHQLRQLNDMGFFDFDRNVAALRRSGGSV 352

Query: 361 QGALDSLLNGDV 372
           QGALDSLLNGDV
Sbjct: 353 QGALDSLLNGDV 364

>Suva_13.464 Chr13 (801516..802616) [1101 bp, 366 aa] {ON} YMR276W
           (REAL)
          Length = 366

 Score =  518 bits (1333), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/374 (73%), Positives = 283/374 (75%), Gaps = 10/374 (2%)

Query: 1   MSLNIHIKSGQDKWEVSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESY 60
           MSLN+++KSGQDKWEVSVAPESTV QFKEAIS+ANG+PVANQRLIYSGKILKDDQTVESY
Sbjct: 1   MSLNVYVKSGQDKWEVSVAPESTVLQFKEAISEANGIPVANQRLIYSGKILKDDQTVESY 60

Query: 61  HIQDGHSVHLVKSQPKPQPXXXXXXXXXXXXXXX-XXXXXXPNMSSGQSAGFNPLADLTS 119
           HIQDGHSVHLVKSQP+PQ                       PNMSSGQSAGFNPLADLTS
Sbjct: 61  HIQDGHSVHLVKSQPRPQAGAATGAGGDAGASATNASVSATPNMSSGQSAGFNPLADLTS 120

Query: 120 ARYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDFMIQ 179
           ARYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMM+NPIFQSQMNEMLSNPQMLDFMIQ
Sbjct: 121 ARYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMDNPIFQSQMNEMLSNPQMLDFMIQ 180

Query: 180 SNPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMMDPNXXXXXXXXXXXXXXXX 239
           SNPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMMDPN                
Sbjct: 181 SNPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMMDPNAGNGSAGGAASAFPAP 240

Query: 240 XXXXPEEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLLNPALNPFASAGN-ATGTGMP 298
               PEE                               LLNPALNPFA+AGN A  TGMP
Sbjct: 241 GGDAPEE--------TTDTDAAPSSNAGANAAANPFASLLNPALNPFANAGNSAAATGMP 292

Query: 299 AFDPALLASMFXXXXXXXXXXXXEDTRPPEERYEHQLRQLNDMGFFDFDRNVAALRRSGG 358
           AFDPALLASMF            EDTRPPEERYE QLRQLNDMGFFDFDRNVAALRRSGG
Sbjct: 293 AFDPALLASMFQPQQAAAQAPQPEDTRPPEERYEQQLRQLNDMGFFDFDRNVAALRRSGG 352

Query: 359 SVQGALDSLLNGDV 372
           SVQGALDSLLNGDV
Sbjct: 353 SVQGALDSLLNGDV 366

>NCAS0C00430 Chr3 complement(67718..68827) [1110 bp, 369 aa] {ON}
           Anc_8.837 YMR276W
          Length = 369

 Score =  399 bits (1024), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 218/389 (56%), Positives = 253/389 (65%), Gaps = 37/389 (9%)

Query: 1   MSLNIHIKSGQDKWEVSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESY 60
           MS++IH+KSGQ+ W+VS+ P ST+ Q KE I+K + VP  NQRLI+SGKILKDDQTVE Y
Sbjct: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60

Query: 61  HIQDGHSVHLVKS---------QPKPQPXXXXXXXXXXXXXXXXXXXXXPNMSSGQSAGF 111
            I DG S+H+VKS          P PQ                      PNM++G++ GF
Sbjct: 61  KILDGLSIHMVKSGGGSANKNKSPPPQ-------------ANTTATPVAPNMAAGETGGF 107

Query: 112 NPLADLTSARYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNP 171
           NPL+DLTSARYAGYLN+PSAD FGPDGG LNN   NQDE+LRM++NP+FQSQMNEMLSNP
Sbjct: 108 NPLSDLTSARYAGYLNLPSADTFGPDGG-LNNSGPNQDEMLRMLDNPVFQSQMNEMLSNP 166

Query: 172 QMLDFMIQSNPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMM----DPNXXXX 227
           QMLDF+IQ+NPQLQAMGPQARQ+LQ+PMFRQMLTNPDMIRQSMQ AR M    DPN    
Sbjct: 167 QMLDFIIQANPQLQAMGPQARQILQNPMFRQMLTNPDMIRQSMQMARAMNGGVDPNGNGQ 226

Query: 228 XXXXXXXXXXXXXXXXPEEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLLNPALNPFA 287
                            +                                L NPA+NPFA
Sbjct: 227 ANTSSDFPAPGGDD---DNTVSENTPSTTNTASTNPSSTATTNAANPFASLFNPAMNPFA 283

Query: 288 SA---GNATGTGM-PAFDPALLASMFXXXXXXXXXXXXEDTRPPEERYEHQLRQLNDMGF 343
           +     NA G+G  PAFDP+  ASMF            EDTRPPEERYEHQLRQLNDMGF
Sbjct: 284 AGMANTNAAGSGNPPAFDPSFFASMF---QPPAAQQQQEDTRPPEERYEHQLRQLNDMGF 340

Query: 344 FDFDRNVAALRRSGGSVQGALDSLLNGDV 372
           FDFDRNVAALRRSGG+V+ AL++LLNGDV
Sbjct: 341 FDFDRNVAALRRSGGNVESALNALLNGDV 369

>KAFR0B03900 Chr2 (810391..811530) [1140 bp, 379 aa] {ON} Anc_8.837
           YMR276W
          Length = 379

 Score =  394 bits (1013), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 216/382 (56%), Positives = 244/382 (63%), Gaps = 13/382 (3%)

Query: 1   MSLNIHIKSGQDKWEVSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESY 60
           MS+ IHIKSGQ+KW+V+     +++  KE ISK + +P  NQRLIYSGKILKDDQTVESY
Sbjct: 1   MSITIHIKSGQNKWDVNTNLSDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESY 60

Query: 61  HIQDGHSVHLVKSQ---PKPQPXXXXXXXXXXXXXXXXXXXXXPNMSSGQSAGFNPLADL 117
            I++GHS+HLVKS     +                         N++SGQ+ GFNPL DL
Sbjct: 61  KIEEGHSIHLVKSGGNVARNSAATNTTPTATSNENTNSAPSVPSNIASGQTGGFNPLNDL 120

Query: 118 TSARYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDFM 177
           TSARYAGYLNMPSADMFGPDGG   N   +QD++LRM++NP+FQSQMNEMLSNPQM+DFM
Sbjct: 121 TSARYAGYLNMPSADMFGPDGGL--NSGPSQDDMLRMLDNPVFQSQMNEMLSNPQMIDFM 178

Query: 178 IQSNPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMM----DPNXXXXXXXXXX 233
           IQSNPQLQAMGPQARQMLQSPMFRQML NPDMIRQSMQFARMM    DP           
Sbjct: 179 IQSNPQLQAMGPQARQMLQSPMFRQMLINPDMIRQSMQFARMMNGGNDPAATGNDPSAFP 238

Query: 234 XXXXXXXXXXPEEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLLNPALNPF---ASAG 290
                      +                                L NPA NPF   +S  
Sbjct: 239 APGEASASTNEQNTNASGESTTAGGATNNTNSTSAPAAANPFDALFNPAANPFGAMSSNT 298

Query: 291 NATGTGMPAFDPALLASMFXXXXXXXXXXXXEDTRPPEERYEHQLRQLNDMGFFDFDRNV 350
           N +    PAFDPALLASM             +D RPPEERYE QLRQLNDMGFFDFDRNV
Sbjct: 299 NGSQPQQPAFDPALLASML-GMPQSQQTPAQQDNRPPEERYEAQLRQLNDMGFFDFDRNV 357

Query: 351 AALRRSGGSVQGALDSLLNGDV 372
           AALRRSGGSVQGALD+LLNGDV
Sbjct: 358 AALRRSGGSVQGALDALLNGDV 379

>CAGL0M02937g Chr13 (331097..332218) [1122 bp, 373 aa] {ON} highly
           similar to uniprot|P48510 Saccharomyces cerevisiae
           YMR276w DSK2
          Length = 373

 Score =  394 bits (1011), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 216/380 (56%), Positives = 244/380 (64%), Gaps = 15/380 (3%)

Query: 1   MSLNIHIKSGQDKWEVSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESY 60
           MS+ IHIKSGQ+KW+VS+ P  T+   KE I+K + +P  NQRLIYSGKILKDDQTVESY
Sbjct: 1   MSITIHIKSGQNKWDVSIDPSQTILNLKEEIAKVSEIPSGNQRLIYSGKILKDDQTVESY 60

Query: 61  HIQDGHSVHLVKSQPKPQPXXXXXXXXXXXXXXXXXXXXXPNMSSGQSAGFNPLADLTSA 120
           +I+D H++H+VKS                            N++SGQ+ GFNPLADLT A
Sbjct: 61  NIKDDHAIHMVKS--GGNASTSNAPTNANESSNSSTTAVPSNIASGQTGGFNPLADLTGA 118

Query: 121 RYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDFMIQS 180
           RYAGY N+PSADMFGPDGG   N++ +QDE+LRMMENPIFQSQMNEMLSNP+MLDFMIQS
Sbjct: 119 RYAGYANLPSADMFGPDGGI--NNAPDQDEMLRMMENPIFQSQMNEMLSNPEMLDFMIQS 176

Query: 181 NPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMMDPNXXX-XXXXXXXXXXXXX 239
           NPQLQAMGPQARQMLQSP FRQMLTNP MIRQSMQFARMM+                   
Sbjct: 177 NPQLQAMGPQARQMLQSPFFRQMLTNPAMIRQSMQFARMMNGQGGMPGADATDASAFPAP 236

Query: 240 XXXXPEEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLLNPALNPFAS-AGN------A 292
                E                                L++PA NPFA+  GN       
Sbjct: 237 GGDDTETTTGSTENTSTNNRTNSNANANPNAAANPFAALMDPASNPFAAMMGNMNNQQGG 296

Query: 293 TGTGMPAFDPALLASMFXXXXXXXXXXXXEDTRPPEERYEHQLRQLNDMGFFDFDRNVAA 352
            G   PAFDP LLAS+             ED RPPEERYE QLRQLNDMGFFDFDRNVAA
Sbjct: 297 AGVQQPAFDPTLLASLL---GGQLPAPAQEDNRPPEERYEQQLRQLNDMGFFDFDRNVAA 353

Query: 353 LRRSGGSVQGALDSLLNGDV 372
           LRRSGGSVQGALD+LLNGDV
Sbjct: 354 LRRSGGSVQGALDALLNGDV 373

>TDEL0B00600 Chr2 complement(115615..116724) [1110 bp, 369 aa] {ON}
           Anc_8.837 YMR276W
          Length = 369

 Score =  381 bits (978), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 205/380 (53%), Positives = 239/380 (62%), Gaps = 19/380 (5%)

Query: 1   MSLNIHIKSGQDKWEVSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESY 60
           MS+ + +K GQ KWEVSV PE TV++FK+ I+K + +P ANQRLIYSGKILKDDQ VESY
Sbjct: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60

Query: 61  HIQDGHSVHLVKSQPKP--QPXXXXXXXXXXXXXXXXXXXXXPNMSSGQSAGFNPLADLT 118
            IQDGH++HLVKS                              N++SGQ+ GFNPL+DLT
Sbjct: 61  KIQDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPGSATVPSNIASGQTGGFNPLSDLT 120

Query: 119 SARYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDFMI 178
           SARYAG+ N+PSADMFGPDGG  N    NQD++L M+ENPIFQSQMNEMLSNPQM+DFMI
Sbjct: 121 SARYAGFTNLPSADMFGPDGGLTNMP--NQDDMLGMLENPIFQSQMNEMLSNPQMVDFMI 178

Query: 179 QSNPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMMDPNXXXXXXXXXXXXXXX 238
           QSNPQLQAMGPQARQ+LQSP FRQMLTNP M+RQSMQF+ MM+P+               
Sbjct: 179 QSNPQLQAMGPQARQLLQSPFFRQMLTNPQMLRQSMQFSSMMNPSGGNDAAAASFPAPG- 237

Query: 239 XXXXXPEEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLLNPALNPFASAGNATGTGMP 298
                 +                                + NP  NP AS     G G  
Sbjct: 238 ------DSTTEASSTEANTDANANTNANANTNAANPFAAMFNPGSNPLASMFGNQGVGAA 291

Query: 299 ------AFDPALLASMFXXXXXXXXXXXXEDTRPPEERYEHQLRQLNDMGFFDFDRNVAA 352
                  FDP++LAS+             +D RPPEERYE QLRQLNDMGFFDF++NVAA
Sbjct: 292 DNQQNQPFDPSMLASLL--GGGAAQQRAEQDNRPPEERYEQQLRQLNDMGFFDFEKNVAA 349

Query: 353 LRRSGGSVQGALDSLLNGDV 372
           LRRSGGSVQGALDSLLNGDV
Sbjct: 350 LRRSGGSVQGALDSLLNGDV 369

>SAKL0D01540g Chr4 complement(124423..125520) [1098 bp, 365 aa] {ON}
           similar to uniprot|P48510 Saccharomyces cerevisiae
           YMR276W DSK2 Nuclear-enriched ubiquitin-like
           polyubiquitin- binding protein required for spindle pole
           body (SPB) duplication and for transit through the G2/M
           phase of the cell cycle involved in proteolysis
           interacts with the proteasome
          Length = 365

 Score =  376 bits (966), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 210/377 (55%), Positives = 238/377 (63%), Gaps = 17/377 (4%)

Query: 1   MSLNIHIKSGQDKWEVSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESY 60
           MS+ +HIKSGQ+KW+VS+ P +TV + KEAISK + +P ANQRLIYSGKILKDDQTVESY
Sbjct: 1   MSITLHIKSGQNKWDVSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESY 60

Query: 61  HIQDGHSVHLVKSQPKPQPXXXXXXXXXXXXXXXXXXXXXP-NMSSGQSAGFNPLADLTS 119
            I D H+VHLV+S   P+P                     P N+SSGQ+ GFNPLADLT 
Sbjct: 61  KIADDHAVHLVRSG-GPKPAASKSESTSATDTGAAAAAAVPSNISSGQTGGFNPLADLTG 119

Query: 120 ARYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDFMIQ 179
           ARYAGY N+PSADMFGPDGG  N  + N DE+L M++NPI QSQMNEMLSNPQM+DFMIQ
Sbjct: 120 ARYAGYANLPSADMFGPDGGLTN--APNSDEILNMLDNPIVQSQMNEMLSNPQMVDFMIQ 177

Query: 180 SNPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMMDPNXXXXXXXXXXXXXXXX 239
            NPQLQAMGP+AR++LQS  FRQM+TNPDMIRQSMQFARM                    
Sbjct: 178 QNPQLQAMGPRARELLQSDYFRQMMTNPDMIRQSMQFARMFGMEGAEGAGGAFPAPGTAT 237

Query: 240 XXXXPEEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLLNPALNPFASA---GNATGTG 296
                E                                L N   NPFAS    G A    
Sbjct: 238 QTASTE----GGPAGTTASPSTTGNGSANSEAANPFASLFNGQANPFASMFPNGRA---- 289

Query: 297 MPAFDPALLASMFXXXXXX-XXXXXXEDTRPPEERYEHQLRQLNDMGFFDFDRNVAALRR 355
            P FDP+LL+S               +D RPPEERYE QLRQLNDMGFFDFDRNVAALRR
Sbjct: 290 -PQFDPSLLSSFLGGNTAAPGQQQQPQDNRPPEERYEQQLRQLNDMGFFDFDRNVAALRR 348

Query: 356 SGGSVQGALDSLLNGDV 372
           SGGSVQGALD+LLNGDV
Sbjct: 349 SGGSVQGALDALLNGDV 365

>TPHA0I00220 Chr9 (39858..40991) [1134 bp, 377 aa] {ON} Anc_8.837
           YMR276W
          Length = 377

 Score =  370 bits (950), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 206/385 (53%), Positives = 239/385 (62%), Gaps = 21/385 (5%)

Query: 1   MSLNIHIKSGQDKWEVSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESY 60
           MS+++ IKSGQ+KW+V+V P +T+ +FKE ISKA+ +P  NQRLIYSGKILKD +TVESY
Sbjct: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60

Query: 61  HIQDGHSVHLVKS---QPKPQPXXXXXXXXXXXXXXXXXXXXXPNMSSGQSAGFNPLADL 117
            IQDGHS+HLVKS                               N++SGQ+ GFNPLADL
Sbjct: 61  KIQDGHSIHLVKSGDASANAAKSSTAAAATANAAAGSAESAVPTNITSGQTNGFNPLADL 120

Query: 118 TSARYAGY-LNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDF 176
           TSARYAGY L MPSADMFGPDGG  N    NQD++L M+ENP+FQSQMNEMLSNPQM+++
Sbjct: 121 TSARYAGYNLPMPSADMFGPDGGMTNMP--NQDDMLSMLENPVFQSQMNEMLSNPQMVEY 178

Query: 177 MIQSNPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMMDPNXXXXXXXXXXXXX 236
           MI SNPQLQA+GPQAR+M QSP FRQMLTNPDMIRQSM+ ARMM                
Sbjct: 179 MINSNPQLQALGPQAREMFQSPFFRQMLTNPDMIRQSMEMARMMGGEGVGIGGGLNGDSS 238

Query: 237 XXXXXXXPEEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLLNPALNPFASAGNATGTG 296
                    E                               L NP +NPFA  GN    G
Sbjct: 239 FPAPGETSTE--SATAEDNAAARNPAATNPAAANPANPFAALFNPGMNPFAGLGNPAAAG 296

Query: 297 ---------MPAFDPALLASMFXXXXXXXXXXXXEDTRPPEERYEHQLRQLNDMGFFDFD 347
                     P F+P++LASM             EDTRPPE RYE QLRQLNDMGFF+FD
Sbjct: 297 STGAPGTPQYPGFNPSMLASML----QQPRQPAQEDTRPPEVRYESQLRQLNDMGFFEFD 352

Query: 348 RNVAALRRSGGSVQGALDSLLNGDV 372
           RN+AALRRSGGSVQGALD+LLN DV
Sbjct: 353 RNIAALRRSGGSVQGALDALLNNDV 377

>Kpol_1068.11 s1068 complement(21199..22344) [1146 bp, 381 aa] {ON}
           complement(21199..22344) [1146 nt, 382 aa]
          Length = 381

 Score =  367 bits (943), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 213/390 (54%), Positives = 242/390 (62%), Gaps = 27/390 (6%)

Query: 1   MSLNIHIKSGQDKWEVSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESY 60
           M + IHIKSGQ+KWEV+V   +TV Q KE I+K + +PV NQRLIYSGKILKDDQ +E Y
Sbjct: 1   MGIKIHIKSGQNKWEVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60

Query: 61  HIQDGHSVHLVKSQPKPQPXXXXXXXXXXXXXXXXXXXXXP---NMSSGQSAGFNPLADL 117
            IQD HS+HLVKS    +                      P   N+++GQS GFNPL+DL
Sbjct: 61  KIQDEHSIHLVKSGGASKTNTSASAAAASTSTATNSDSNAPLPSNIAAGQSGGFNPLSDL 120

Query: 118 TSARYAGY-LNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDF 176
           TSARYAGY LN+PSADMFGPDGG   N   NQD++LRM+ENP+FQSQMNEMLSNPQM+DF
Sbjct: 121 TSARYAGYGLNLPSADMFGPDGGM--NSMPNQDDMLRMLENPVFQSQMNEMLSNPQMIDF 178

Query: 177 MIQSNPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMMDPNXXXXXXXXXXXXX 236
           MIQSNPQLQAMGP+ARQM QSP FRQMLTNP+MIRQSMQ A MM  N             
Sbjct: 179 MIQSNPQLQAMGPEARQMFQSPFFRQMLTNPEMIRQSMQMANMMGGNGQFGANAAASSFP 238

Query: 237 XXXXXXXPEEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLLNPALNPF---------- 286
                    +                               L NPA+NPF          
Sbjct: 239 APGET----DTTAAAETNTETTSTPAATGAAAAGQQNPFASLFNPAMNPFAAMMNNNAAA 294

Query: 287 ----ASAGNATGTGMPAFDPALLASMFXXXXXXXXXXXXEDTRPPEERYEHQLRQLNDMG 342
                + G A  TG PAFDP+L ASMF            +D RPPEERYE QLRQLNDMG
Sbjct: 295 AAGAGATGAAGATGTPAFDPSLFASMF---QPPQQQQQEQDNRPPEERYESQLRQLNDMG 351

Query: 343 FFDFDRNVAALRRSGGSVQGALDSLLNGDV 372
           FFDFDRNVAALRRSGGSVQGALD+LL+ DV
Sbjct: 352 FFDFDRNVAALRRSGGSVQGALDALLSNDV 381

>Kwal_27.10275 s27 complement(273277..274416) [1140 bp, 379 aa] {ON}
           YMR276W (DSK2) - ubiquitin-like protein [contig 37] FULL
          Length = 379

 Score =  360 bits (925), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 199/383 (51%), Positives = 241/383 (62%), Gaps = 15/383 (3%)

Query: 1   MSLNIHIKSGQDKWEVSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESY 60
           MS+ +H+KSGQ KW+VSV  +STV+QFK AI++ + +   NQRLIYSGKILKDDQT+ESY
Sbjct: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60

Query: 61  HIQDGHSVHLVKSQPKPQPXX----XXXXXXXXXXXXXXXXXXXPNMSSGQSAGFNPLAD 116
            I DGH+VHLVKS  K                             ++SSGQ+ GFNPL+D
Sbjct: 61  KILDGHAVHLVKSGTKSGSGAIGAPGSGSTAPTNTASSGAAAAPASLSSGQAGGFNPLSD 120

Query: 117 LTSARYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDF 176
           LTSARYAGYLN+PSAD FGPDGG  +  + N D++LRM+ENP+ QSQMNEMLSNPQM+DF
Sbjct: 121 LTSARYAGYLNLPSADSFGPDGGMTS--APNSDDMLRMLENPVMQSQMNEMLSNPQMIDF 178

Query: 177 MIQSNPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMM----DPNXXXXXXXXX 232
           +IQ +PQLQ+MGPQARQMLQSP FRQM+TNP+MIRQSMQF+ ++    DP+         
Sbjct: 179 LIQQSPQLQSMGPQARQMLQSPFFRQMMTNPEMIRQSMQFSGVLGGAGDPSAAGANAFPA 238

Query: 233 XXXXXXXXXXXPEEXXXXXXXXXXXXXXX---XXXXXXXXXXXXXXXXLLNPALNPFASA 289
                      P                                      NP L+     
Sbjct: 239 PGTADSDASAQPASTNTSTADAAQSATNANPFASLLAGQAAAPGGASAPANPFLSMLGQQ 298

Query: 290 GNATGTGMPAFDPALLASMFXXXXXXXXXXXXEDTRPPEERYEHQLRQLNDMGFFDFDRN 349
               G G+PAFDPA+L+++             +DTRPPEERYE QLRQLNDMGFF+FDRN
Sbjct: 299 APGAG-GLPAFDPAMLSALL-GGAGNNASQQPQDTRPPEERYEQQLRQLNDMGFFEFDRN 356

Query: 350 VAALRRSGGSVQGALDSLLNGDV 372
           VAALRRSGGSVQGALD+LLNGDV
Sbjct: 357 VAALRRSGGSVQGALDALLNGDV 379

>ZYRO0G14124g Chr7 (1125418..1126527) [1110 bp, 369 aa] {ON} similar
           to uniprot|P48510 Saccharomyces cerevisiae YMR276W DSK2
           Nuclear-enriched ubiquitin-like polyubiquitin- binding
           protein required for spindle pole body (SPB) duplication
           and for transit through the G2/M phase of the cell cycle
           involved in proteolysis interacts with the proteasome
          Length = 369

 Score =  295 bits (756), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 151/235 (64%), Positives = 175/235 (74%), Gaps = 16/235 (6%)

Query: 2   SLNIHIKSGQDKWEVSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYH 61
           ++ + IKSGQ+KWEV+V PESTVS FKE ISK + +P ++QRLIYSGKILKDDQT++ Y+
Sbjct: 3   TITVQIKSGQNKWEVTVDPESTVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYN 62

Query: 62  IQDGHSVHLVKSQPKPQPXXXXXXXXXXXXXXXXXXXXXP--------------NMSSGQ 107
           +QDGHSVHLVKS   P                       P              N+S+GQ
Sbjct: 63  LQDGHSVHLVKSSKAPGNASGGSSSTAAATAGSGASAVPPSGNASTTPTTGAPSNLSAGQ 122

Query: 108 SAGFNPLADLTSARYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEM 167
           S GFNPLADLTSARYAG+ ++PSADMFGPDGGA N    NQ++LL M++NPIFQSQMNEM
Sbjct: 123 SGGFNPLADLTSARYAGFTSLPSADMFGPDGGATNMP--NQEDLLNMLDNPIFQSQMNEM 180

Query: 168 LSNPQMLDFMIQSNPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMMDP 222
           LSNPQM+DFMIQSNPQLQAMGPQARQM QSP FRQMLTNP MIRQSMQFARMM+P
Sbjct: 181 LSNPQMVDFMIQSNPQLQAMGPQARQMFQSPFFRQMLTNPQMIRQSMQFARMMNP 235

 Score =  106 bits (264), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 56/72 (77%), Gaps = 3/72 (4%)

Query: 301 DPALLASMFXXXXXXXXXXXXEDTRPPEERYEHQLRQLNDMGFFDFDRNVAALRRSGGSV 360
           DP LLASM             +D RPPEERYE QLRQLN+MGFFDFDRNVAALRRSGGSV
Sbjct: 301 DPQLLASMLGAPSQQQQP---QDNRPPEERYETQLRQLNEMGFFDFDRNVAALRRSGGSV 357

Query: 361 QGALDSLLNGDV 372
           QGALDSLLNGDV
Sbjct: 358 QGALDSLLNGDV 369

>NDAI0K00440 Chr11 complement(99224..100438) [1215 bp, 404 aa] {ON}
           Anc_8.837 YMR276W
          Length = 404

 Score =  278 bits (710), Expect = 5e-90,   Method: Compositional matrix adjust.
 Identities = 140/220 (63%), Positives = 165/220 (75%), Gaps = 6/220 (2%)

Query: 2   SLNIHIKSGQDKWEVSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYH 61
           +++IHIKSGQ+ W+VS+   ++++  K+ I+K + +P  NQRLIYSGKILKDDQ V+ Y+
Sbjct: 3   TISIHIKSGQNNWQVSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYN 62

Query: 62  IQDGHSVHLVKSQPKPQPXXXXXXXXXXXXXXXXXXXXXPNMSSGQSAGFNPLADLTSAR 121
           IQDGHSVHLV+S  K                         N+S+GQ+ GFNPLADLTSAR
Sbjct: 63  IQDGHSVHLVRSGKK----STPTPATTNTTTNASNNTVPSNISAGQTGGFNPLADLTSAR 118

Query: 122 YAGY-LNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDFMIQS 180
           YAGY LN+PSAD FGPDGG +N    N DE L M++NPI QSQMNEMLSNPQM+DFMIQS
Sbjct: 119 YAGYNLNLPSADAFGPDGG-MNQSGTNPDEFLSMLDNPIVQSQMNEMLSNPQMIDFMIQS 177

Query: 181 NPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMM 220
           NPQLQAMGPQARQM QSPMFRQMLTNPDMIRQSMQ A MM
Sbjct: 178 NPQLQAMGPQARQMFQSPMFRQMLTNPDMIRQSMQLANMM 217

 Score =  113 bits (283), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 64/81 (79%), Gaps = 1/81 (1%)

Query: 292 ATGTGMPAFDPALLASMFXXXXXXXXXXXXEDTRPPEERYEHQLRQLNDMGFFDFDRNVA 351
           ATGT +P FDP++ AS+F            +DTRPPEERYE QLRQLNDMGFFDFDRN+A
Sbjct: 325 ATGT-LPPFDPSMFASLFGGAGAPSTTPQQQDTRPPEERYETQLRQLNDMGFFDFDRNIA 383

Query: 352 ALRRSGGSVQGALDSLLNGDV 372
           ALRR+GGSV+ A+++LLNGDV
Sbjct: 384 ALRRTGGSVEAAVNALLNGDV 404

>TBLA0D03230 Chr4 complement(796939..798066) [1128 bp, 375 aa] {ON}
           Anc_8.837 YMR276W
          Length = 375

 Score =  276 bits (705), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 131/221 (59%), Positives = 166/221 (75%), Gaps = 2/221 (0%)

Query: 1   MSLNIHIKSGQDKWEVSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESY 60
           M++++HIKSGQ+ W+V +   ST+  FK+ I+  + +P  NQRLIYSGKILKDDQT+ESY
Sbjct: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60

Query: 61  HIQDGHSVHLVKSQPKPQPXXXXXXXXXXXXXXXXXXXXXPNMSSGQSAGFNPLADLTSA 120
            IQDGHS+H+VKS                             MS+G+ +GFNPL+DLTSA
Sbjct: 61  KIQDGHSIHMVKSGAHATASSTTNSMTTTNTTAPQNNNGSSGMSTGRGSGFNPLSDLTSA 120

Query: 121 RYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDFMIQS 180
           RYAGY N+PSADMFGPDGG+    S +QD++L M+ENP+FQSQMNEMLSNP+++DF+I S
Sbjct: 121 RYAGYTNLPSADMFGPDGGSFA--SQSQDDMLHMLENPVFQSQMNEMLSNPEIVDFLINS 178

Query: 181 NPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMMD 221
           NPQLQ++GPQAR M QSPMFRQMLTNPDMIRQSM+ A+MM+
Sbjct: 179 NPQLQSLGPQARTMFQSPMFRQMLTNPDMIRQSMRMAQMMN 219

 Score = 95.9 bits (237), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 53/92 (57%), Positives = 64/92 (69%), Gaps = 2/92 (2%)

Query: 278 LLNPALNPFASAGNATGTGMPAFDPALLASMFXXXXXXXXXXXXEDTRPPEERYEHQLRQ 337
           L +P++NP+A+ G   G     F+PA  A               ED RPPEERYEHQLRQ
Sbjct: 284 LFDPSMNPYAALGGGNGNANNMFNPAAFAQA--LQAAAPHTQEPEDNRPPEERYEHQLRQ 341

Query: 338 LNDMGFFDFDRNVAALRRSGGSVQGALDSLLN 369
           LNDMGFFDFD+NVAALRRSGGSVQGA+++LL+
Sbjct: 342 LNDMGFFDFDKNVAALRRSGGSVQGAVNALLS 373

>KLTH0C03938g Chr3 complement(344354..345484) [1131 bp, 376 aa] {ON}
           some similarities with uniprot|P48510 Saccharomyces
           cerevisiae YMR276W DSK2 Nuclear-enriched ubiquitin-like
           polyubiquitin-binding protein required for spindle pole
           body (SPB) duplication and for transit through the G2/M
           phase of the cell cycle involved in proteolysis
           interacts with the proteasome
          Length = 376

 Score =  275 bits (704), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 136/230 (59%), Positives = 167/230 (72%), Gaps = 12/230 (5%)

Query: 1   MSLNIHIKSGQDKWEVSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESY 60
           MS+ +HIKSGQ+KW+V++ P ST++QFK AI+  + +   NQRLIYSGKILKDDQTVESY
Sbjct: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60

Query: 61  HIQDGHSVHLVKSQPKPQPXXXXXXXXXXXXXXXXXXXXXP----------NMSSGQSAG 110
            I D HSVHLVKS    +                      P          N+S+GQ  G
Sbjct: 61  KILDDHSVHLVKSGGSKKATSPGATAAASGDATATGATSTPAAQPQQSAPANLSTGQGNG 120

Query: 111 FNPLADLTSARYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSN 170
           FNPL+DLTSARYAG+LN+PSAD FGPDGG  +  + N D++LRM+ENP+ QSQMNEMLSN
Sbjct: 121 FNPLSDLTSARYAGFLNLPSADSFGPDGGMTS--APNSDDVLRMLENPVMQSQMNEMLSN 178

Query: 171 PQMLDFMIQSNPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMM 220
           PQM+DF+IQ +PQLQ+MGPQAR +LQSP FRQM+TNPDMIRQSMQF+ M+
Sbjct: 179 PQMIDFLIQQSPQLQSMGPQARTLLQSPFFRQMMTNPDMIRQSMQFSSML 228

 Score =  115 bits (289), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 68/91 (74%), Gaps = 5/91 (5%)

Query: 284 NPFAS--AGNATGTGMPAFDPALLASMFXXXXXXXXXXXXEDTRPPEERYEHQLRQLNDM 341
           NPF S   G + GT  PA DP +L+S+             +DTRPPEERYEHQLRQLNDM
Sbjct: 289 NPFLSMLGGGSAGT-PPALDPMVLSSILGGAGAANQQP--QDTRPPEERYEHQLRQLNDM 345

Query: 342 GFFDFDRNVAALRRSGGSVQGALDSLLNGDV 372
           GFF+FDRNVAALRRSGGSVQGALD+LLNGDV
Sbjct: 346 GFFEFDRNVAALRRSGGSVQGALDALLNGDV 376

>KLLA0D01859g Chr4 (161628..162743) [1116 bp, 371 aa] {ON} similar
           to uniprot|P48510 Saccharomyces cerevisiae YMR276W DSK2
           Nuclear-enriched ubiquitin-like polyubiquitin- binding
           protein required for spindle pole body (SPB) duplication
           and for transit through the G2/M phase of the cell cycle
           involved in proteolysis interacts with the proteasome
          Length = 371

 Score =  268 bits (686), Expect = 8e-87,   Method: Compositional matrix adjust.
 Identities = 130/218 (59%), Positives = 158/218 (72%)

Query: 3   LNIHIKSGQDKWEVSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHI 62
           +++H+KSGQ+ W V +   +T+  FKE IS  +GVP  NQRLIYSGKILKD +TVESY I
Sbjct: 4   ISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYKI 63

Query: 63  QDGHSVHLVKSQPKPQPXXXXXXXXXXXXXXXXXXXXXPNMSSGQSAGFNPLADLTSARY 122
           QDGHSVH+VKS                            N+S+GQ+ GFNPLADLT ARY
Sbjct: 64  QDGHSVHMVKSGGASAATTGSTTTGSAASPAATNSAAPSNISAGQTGGFNPLADLTGARY 123

Query: 123 AGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDFMIQSNP 182
           AG  N+PSADMFGPDGG  +++  N + +L+M+ENPIFQSQMNEMLSNPQM+DF+IQ NP
Sbjct: 124 AGLANLPSADMFGPDGGLNSSNGANPESMLQMLENPIFQSQMNEMLSNPQMVDFLIQQNP 183

Query: 183 QLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMM 220
           QLQA+GP+AR MLQSP FRQM+T+P MIRQSMQ A  M
Sbjct: 184 QLQALGPRARDMLQSPFFRQMMTDPQMIRQSMQMANSM 221

 Score =  114 bits (286), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 64/91 (70%), Gaps = 2/91 (2%)

Query: 282 ALNPFASAGNATGTGMPAFDPALLASMFXXXXXXXXXXXXEDTRPPEERYEHQLRQLNDM 341
           A NPFA  G   G   P F+  LLASMF             D RPPEERYE QLRQLNDM
Sbjct: 283 AANPFA--GLFPGGQQPQFNQELLASMFGGNSNATGAAPAVDNRPPEERYESQLRQLNDM 340

Query: 342 GFFDFDRNVAALRRSGGSVQGALDSLLNGDV 372
           GFFDFDRNVAALRR+GGSVQGALD+LLNGDV
Sbjct: 341 GFFDFDRNVAALRRAGGSVQGALDALLNGDV 371

>ABL129W Chr2 (153723..154760) [1038 bp, 345 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR276W (DSK2)
          Length = 345

 Score =  261 bits (666), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 126/212 (59%), Positives = 154/212 (72%), Gaps = 2/212 (0%)

Query: 1   MSLNIHIKSGQDKWEVSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESY 60
           M++ I +KSGQ++WEVSV    +V + K+ I+K + +P  NQRLIYSGKILKDDQTVESY
Sbjct: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60

Query: 61  HIQDGHSVHLVKSQPKPQPXXXXXXXXXXXXXXXXXXXXXPNMSSGQSAGFNPLADLTSA 120
            I DGH++HLVKS                            ++S+GQS GFNPLADLT A
Sbjct: 61  KIADGHAIHLVKSGGAKAAPAASAAGGESTGAAAGAGAVPSSISAGQSGGFNPLADLTGA 120

Query: 121 RYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDFMIQS 180
           RYAGY N+PS DMFGPDGG   N +  Q+E++ M+ENPIFQSQMNEML+NPQM+DF+IQ 
Sbjct: 121 RYAGYTNLPSTDMFGPDGGL--NSAVGQEEIIGMLENPIFQSQMNEMLNNPQMIDFLIQQ 178

Query: 181 NPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQ 212
           +P LQAMGP AR+MLQSP FRQMLTNPD+IRQ
Sbjct: 179 HPHLQAMGPAAREMLQSPFFRQMLTNPDIIRQ 210

 Score =  116 bits (290), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 59/91 (64%), Positives = 65/91 (71%), Gaps = 3/91 (3%)

Query: 282 ALNPFASAGNATGTGMPAFDPALLASMFXXXXXXXXXXXXEDTRPPEERYEHQLRQLNDM 341
           A NP  +A    G  MP  DPA+L+S+F             D RPPEERYE QLRQLNDM
Sbjct: 258 AANPLGAAPADRGLAMPPLDPAMLSSLFGAGAASPAP---ADNRPPEERYEQQLRQLNDM 314

Query: 342 GFFDFDRNVAALRRSGGSVQGALDSLLNGDV 372
           GFFDFDRNVAALRR+GGSVQGALD+LLNGDV
Sbjct: 315 GFFDFDRNVAALRRAGGSVQGALDALLNGDV 345

>KNAG0J00290 Chr10 complement(44234..45337) [1104 bp, 367 aa] {ON}
           Anc_8.837 YMR276W
          Length = 367

 Score =  253 bits (645), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 139/230 (60%), Positives = 162/230 (70%), Gaps = 10/230 (4%)

Query: 1   MSLNIHIKSGQDKWEVSVAPE---STVSQFKEAISKANGVPVANQRLIYSGKILKDDQTV 57
           M + + +K GQ++W+V+VA E   +TV+QFKE ++   GVPV NQRLIYSGKILKD QT+
Sbjct: 1   MGITVGVKQGQNRWDVAVASEPGETTVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTL 60

Query: 58  ESYHIQDGHSVHLVKSQPKPQPXXXXXXXXXXXXXXXXXXXXXPNMSS--GQSAGFNPLA 115
           E Y I DGH+VHLVKS                              S   GQ  GFNPLA
Sbjct: 61  EEYKITDGHTVHLVKSGGAKSAGSSSSSSEATTAAGTAGTAPAAGASMAAGQQPGFNPLA 120

Query: 116 DLTSARYAGY-LNMPSADMFGPDGGALNNDSNNQ----DELLRMMENPIFQSQMNEMLSN 170
           DLTSARYAGY L MPSADMFGPDGG  +          +E+L M+ENPIFQSQMNEM SN
Sbjct: 121 DLTSARYAGYNLPMPSADMFGPDGGLTSGGGPGGPQSQEEILSMLENPIFQSQMNEMFSN 180

Query: 171 PQMLDFMIQSNPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMM 220
           PQM+DF+IQSNPQLQAMGPQAR+MLQSPMFRQMLTNPDM+RQSMQF++MM
Sbjct: 181 PQMVDFLIQSNPQLQAMGPQAREMLQSPMFRQMLTNPDMVRQSMQFSQMM 230

 Score =  105 bits (261), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 55/92 (59%), Positives = 59/92 (64%), Gaps = 8/92 (8%)

Query: 281 PALNPFASAGNATGTGMPAFDPALLASMFXXXXXXXXXXXXEDTRPPEERYEHQLRQLND 340
           PA  PF SA        P FD A                  +DTRPPEERYE QLRQLND
Sbjct: 284 PAAQPFQSA--------PGFDAAAFMQAMSRNGATAPAAAPQDTRPPEERYEQQLRQLND 335

Query: 341 MGFFDFDRNVAALRRSGGSVQGALDSLLNGDV 372
           MGF DFDRNVAALRR+GGS+QGALD+LLNGDV
Sbjct: 336 MGFSDFDRNVAALRRAGGSLQGALDALLNGDV 367

>Ecym_4608 Chr4 (1185310..1186530) [1221 bp, 406 aa] {ON} similar to
           Ashbya gossypii ABL129W
          Length = 406

 Score =  254 bits (648), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 123/227 (54%), Positives = 157/227 (69%), Gaps = 13/227 (5%)

Query: 1   MSLNIHIKSGQDKWEVSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESY 60
           MS+++H+KSGQ+KW+VS  P S++   K+ I++ + +P  NQRLIYSGKILKDDQTVESY
Sbjct: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60

Query: 61  HIQDGHSVHLVK-----------SQPKPQPXXXXXXXXXXXXXXXXXXXXXPNMSSGQSA 109
            I DGHS+HLV+           +                            N+++GQ  
Sbjct: 61  KIADGHSIHLVRSGGGKVSGSSGATGGASGSVEAVGSGGRNSTAGSGSTVPNNITAGQMG 120

Query: 110 GFNPLADLTSARYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLS 169
           GFNPLADLT ARYAGY N+PS DMFGPDGG   N +  Q+E+L M++NPIFQSQ+NEML+
Sbjct: 121 GFNPLADLTGARYAGYANLPSTDMFGPDGGL--NSAIGQEEILGMLDNPIFQSQVNEMLA 178

Query: 170 NPQMLDFMIQSNPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQF 216
           NPQM+DF+IQ +P LQAMGP AR+MLQSP FRQM+TNPD+IRQ  +F
Sbjct: 179 NPQMIDFLIQQHPHLQAMGPAAREMLQSPFFRQMMTNPDVIRQVSRF 225

 Score =  106 bits (264), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 65/98 (66%), Gaps = 5/98 (5%)

Query: 280 NPALNPFASAGN-----ATGTGMPAFDPALLASMFXXXXXXXXXXXXEDTRPPEERYEHQ 334
           N   NP A+ G      + G  +P  DPA+L+++             ED RPPEERY+ Q
Sbjct: 309 NSTTNPAAAFGADSQQPSRGFSLPPLDPAMLSALLSGGFTATGRQQTEDNRPPEERYQQQ 368

Query: 335 LRQLNDMGFFDFDRNVAALRRSGGSVQGALDSLLNGDV 372
           L QLN+MGF DFDRNVAALRRSGGSVQGAL++LLNGDV
Sbjct: 369 LEQLNEMGFVDFDRNVAALRRSGGSVQGALNALLNGDV 406

>TBLA0B03240 Chr2 (756434..757288) [855 bp, 284 aa] {ON} Anc_8.837
           YMR276W
          Length = 284

 Score = 65.9 bits (159), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 55/219 (25%), Positives = 103/219 (47%), Gaps = 14/219 (6%)

Query: 3   LNIHIKSGQDKWEVSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHI 62
           ++++IK  ++K+ +    +  +S     I     +P  NQRLIYSG+IL  ++T++ Y+ 
Sbjct: 2   ISVNIKFKEEKFTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNF 61

Query: 63  QDGHS-VHLVKSQPKPQPXXXXXXXXXXXXXXXXXXXXXPNMSSGQSAGFNPLADLTSAR 121
           +DGH  + ++  + K                          ++S    G   +  +T+  
Sbjct: 62  KDGHCIIVIIHKEEKNNLHPPPNNTTNLNPNNSVYPASNTPINSPTPFGEGNIITITTT- 120

Query: 122 YAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQ-MLDFMIQS 180
                   S D +G     + +D   + ELL+++++P    Q NEML N Q +L F+IQ+
Sbjct: 121 --------SPDPYGVRSNEV-HDPEVERELLQVLDHP-RSFQENEMLLNNQNLLRFLIQT 170

Query: 181 NPQLQAMGPQ-ARQMLQSPMFRQMLTNPDMIRQSMQFAR 218
           NP L+ M    ARQ+L+ P  ++   + + + Q +   R
Sbjct: 171 NPHLRHMDINGARQVLRDPRLQRAFMDVNFLNQQISLRR 209

>SAKL0H15818g Chr8 (1379077..1379225,1379297..1379381) [234 bp, 77
          aa] {ON} similar to uniprot|Q03919 Saccharomyces
          cerevisiae YDR139C RUB1 Ubiquitin-like protein with
          similarity to mammalian NEDD8
          Length = 77

 Score = 49.7 bits (117), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 25/71 (35%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1  MSLNIHIKSGQDKWEVSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESY 60
          M L +   +G++   +S+     V + KE + +  G+P + QRLI+ GK ++DDQTV+S 
Sbjct: 1  MELKVKTLTGKE-IPISLESHEKVYRIKELLEEKEGIPPSQQRLIFQGKQIEDDQTVDSA 59

Query: 61 HIQDGHSVHLV 71
          ++  G  +HLV
Sbjct: 60 NLSSGMQLHLV 70

>Kpol_1036.62 s1036 complement(173662..173746,173844..173992) [234
          bp, 77 aa] {ON}
          complement(173662..173746,173844..173992) [234 nt, 78
          aa]
          Length = 77

 Score = 48.9 bits (115), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 24/59 (40%), Positives = 37/59 (62%), Gaps = 2/59 (3%)

Query: 15 EVSVAPEST--VSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          E+SV  + +  V   KE + +  G+P + QRLI+ GK + D+QTV+S  + DG  +HLV
Sbjct: 12 EISVEIQGSDKVYHIKELLEEKEGIPPSQQRLIFQGKQIDDEQTVDSAKLTDGMQLHLV 70

>CAGL0B01589g Chr2 (145132..145280,145404..145488) [234 bp, 77 aa]
          {ON} highly similar to uniprot|Q03919 Saccharomyces
          cerevisiae YDR139c RUB1
          Length = 77

 Score = 48.5 bits (114), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 33/56 (58%)

Query: 16 VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          V V+ E  V   KE + +  G+P + QRLI+ GK + +D T+ +  + DG  +HLV
Sbjct: 15 VEVSGEDKVYHIKELLEEKEGIPASQQRLIFHGKQINNDDTISTAKLSDGMQLHLV 70

>KLLA0F17974g Chr6 (1644903..1645051,1645153..1645237) [234 bp, 77
          aa] {ON} similar to uniprot|Q03919 Saccharomyces
          cerevisiae YDR139C RUB1 Ubiquitin-like protein with
          similarity to mammalian NEDD8
          Length = 77

 Score = 48.5 bits (114), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSLNIHIKSGQDKWEVSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESY 60
          M L +   +G++   V V    TV   KE + +  G+P + Q+LI+ GK + D+ T+ S 
Sbjct: 1  MQLKVKTLTGKE-ISVDVQSSETVYHIKELLEEKEGIPPSQQKLIFQGKQIDDNATIGSA 59

Query: 61 HIQDGHSVHLV 71
           +QDG  +HLV
Sbjct: 60 DLQDGSLLHLV 70

>KLTH0G12540g Chr7 (1065801..1065949,1066013..1066097) [234 bp, 77
          aa] {ON} similar to uniprot|Q03919 Saccharomyces
          cerevisiae YDR139C RUB1 Ubiquitin-like protein with
          similarity to mammalian NEDD8
          Length = 77

 Score = 48.1 bits (113), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 25/71 (35%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MSLNIHIKSGQDKWEVSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESY 60
          M L +   +G++   V V P+  V + KE + +  G+P   QRLI+ GK + DD++V S 
Sbjct: 1  MKLTVKTLTGKE-IPVVVDPDDKVYRIKEYLEEKEGIPPTQQRLIFQGKQIDDDKSVSSA 59

Query: 61 HIQDGHSVHLV 71
          ++  G  +HLV
Sbjct: 60 NLSSGMQLHLV 70

>TPHA0C00890 Chr3 (187882..188030,188103..188187) [234 bp, 77 aa]
          {ON} Anc_8.311 YDR139C
          Length = 77

 Score = 46.6 bits (109), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 34/56 (60%)

Query: 16 VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V     V   K+ + +  G+P + QRLI+ GK + D+QTVES ++ DG  +HLV
Sbjct: 15 IEVQGSDKVFHIKDLLEEKEGIPPSQQRLIFQGKQIDDEQTVESANLIDGMQLHLV 70

>ZYRO0D05962g Chr4 (506710..506858,506936..507020) [234 bp, 77 aa]
          {ON} similar to uniprot|Q03919 Saccharomyces cerevisiae
          YDR139C RUB1 Ubiquitin-like protein with similarity to
          mammalian NEDD8
          Length = 77

 Score = 46.2 bits (108), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 33/56 (58%)

Query: 16 VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          V +  E  + + KE + +  G+P + QRLI+ GK + D QTV S  + DG  +HLV
Sbjct: 15 VELNGEDPIYRIKELLEEKEGIPPSQQRLIFQGKQIDDQQTVSSAKLVDGMQLHLV 70

>NDAI0J01070 Chr10 (247102..247250,247366..247450) [234 bp, 77 aa]
          {ON} Anc_8.311 YDR139C
          Length = 77

 Score = 46.2 bits (108), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 35/56 (62%)

Query: 16 VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          V ++    V + KE + +  G+P + QRLI+ GK + D+Q+V S ++ DG  +HLV
Sbjct: 15 VEISGNEPVYRIKELLEEKEGIPPSQQRLIFQGKQIDDEQSVSSANLVDGMQLHLV 70

>NCAS0B03520 Chr2 complement(621285..621369,621473..621621) [234
          bp, 77 aa] {ON}
          Length = 77

 Score = 45.8 bits (107), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 34/56 (60%)

Query: 16 VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          V +     V + KE + +  G+P + QRLI+ GK + D+QTV S ++ DG  +HLV
Sbjct: 15 VDIQGTDPVYRIKEMLEEKEGIPPSQQRLIFQGKQIDDEQTVSSANLIDGMQLHLV 70

>TDEL0G01750 Chr7 (343412..343645) [234 bp, 77 aa] {ON} Anc_4.16
          YLL039C
          Length = 77

 Score = 45.8 bits (107), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16 VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>NDAI0H00270 Chr8 complement(45883..46116) [234 bp, 77 aa] {ON}
          Anc_4.16
          Length = 77

 Score = 45.1 bits (105), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16 VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>TDEL0F04380 Chr6 complement(823866..823950,824011..824159) [234
          bp, 77 aa] {ON} Anc_8.311 YDR139C
          Length = 77

 Score = 45.1 bits (105), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 19/56 (33%), Positives = 35/56 (62%)

Query: 16 VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          V +  ++ + + K+ + +  G+P + QRLI+ GK + D QT+E+  + DG  +HLV
Sbjct: 15 VELKSDAPIYRIKQLLEEKEGIPPSQQRLIFQGKQIDDRQTLEAAKLVDGMVLHLV 70

>AFR358W Chr6 (1087725..1088966) [1242 bp, 413 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YEL037C (RAD23)
          Length = 413

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 49/79 (62%), Gaps = 1/79 (1%)

Query: 1  MSLNIHIKS-GQDKWEVSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVES 59
          M++ IH K   +++  + ++P +T+++ K+ +++A     +  ++I+SGK+L+D  T+E 
Sbjct: 1  MNITIHFKDFKKERLPLQLSPSATIAEAKQMLARAKQCDESQLKMIFSGKVLQDGNTLEG 60

Query: 60 YHIQDGHSVHLVKSQPKPQ 78
            ++DG  V  + S+ K +
Sbjct: 61 CKLKDGDQVIFMISKKKAE 79

>Suva_10.32 Chr10 complement(68200..68385) [186 bp, 62 aa] {ON}
          YLL039C (REAL)
          Length = 62

 Score = 43.5 bits (101), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16 VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 1  LEVEYSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 56

>NDAI0F00300 Chr6 (66116..66679) [564 bp, 187 aa] {ON} Anc_5.701
          Length = 187

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 43/77 (55%), Gaps = 6/77 (7%)

Query: 1   MSLNIHIKSGQDKW----EVSVAPES--TVSQFKEAISKANGVPVANQRLIYSGKILKDD 54
           + L+IHIK    K      +++  ES  T+   K  I    G+P   QRLI++GK L+D 
Sbjct: 53  LLLHIHIKYSFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDG 112

Query: 55  QTVESYHIQDGHSVHLV 71
           +T+  Y+IQ   ++HLV
Sbjct: 113 RTLSDYNIQKESTLHLV 129

>Kwal_YGOB_Anc_5.701 s55 (88799..88806,89169..89547) [387 bp, 128
          aa] {ON} ANNOTATED BY YGOB -
          Length = 128

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16 VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>YDR139C Chr4 complement(733618..733702,733776..733924) [234 bp,
          77 aa] {ON}  RUB1Ubiquitin-like protein with similarity
          to mammalian NEDD8; conjugation (neddylation)
          substrates include the cullins Cdc53p, Rtt101p, and
          Cul3p; activated by Ula1p and Uba3p (E1 enzyme pair);
          conjugation mediated by Ubc12p (E2 enzyme)
          Length = 77

 Score = 43.5 bits (101), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 22/59 (37%), Positives = 34/59 (57%), Gaps = 2/59 (3%)

Query: 15 EVSVAPEST--VSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          E+SV  + +  V   KE + +  G+P + QRLI+ GK + D  TV   H+ +G  +HLV
Sbjct: 12 EISVELKESDLVYHIKELLEEKEGIPPSQQRLIFQGKQIDDKLTVTDAHLVEGMQLHLV 70

>KLTH0E01078g Chr5 (105372..105379,105743..106121) [387 bp, 128
          aa] {ON} highly similar to uniprot|P61864 Saccharomyces
          cerevisiae YKR094c RPL40B and highly similar to
          uniprot|P61864 Saccharomyces cerevisiae YIL148w RPL40A
          Length = 128

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16 VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Smik_9.21 Chr9 (46848..47219) [372 bp, 124 aa] {ON} YKR094C
          (REAL)
          Length = 124

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16 VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 11 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 66

>ZYRO0G06622g Chr7 (527968..527975,528043..528421) [387 bp, 128
          aa] {ON} highly similar to uniprot|P14796 Saccharomyces
          cerevisiae YKR094C RPL40B
          Length = 128

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16 VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KAFR0D02230 Chr4 (449707..449714,450088..450466) [387 bp, 128 aa]
          {ON} Anc_5.701 YIL148W
          Length = 128

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16 VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KAFR0H00220 Chr8 (32171..32178,32513..32891) [387 bp, 128 aa]
          {ON} 
          Length = 128

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16 VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Suva_11.330 Chr11 complement(602690..603068,603446..603453) [387
          bp, 128 aa] {ON} YKR094C (REAL)
          Length = 128

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16 VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Skud_11.333 Chr11 complement(599496..599874,600245..600252) [387
          bp, 128 aa] {ON} YKR094C (REAL)
          Length = 128

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16 VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>YIL148W Chr9 (68708..68715,69150..69528) [387 bp, 128 aa] {ON}
          RPL40AFusion protein, identical to Rpl40Bp, that is
          cleaved to yield ubiquitin and a ribosomal protein of
          the large (60S) ribosomal subunit with similarity to
          rat L40; ubiquitin may facilitate assembly of the
          ribosomal protein into ribosomes
          Length = 128

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16 VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>YKR094C Chr11 complement(617996..618374,618743..618750) [387 bp,
          128 aa] {ON}  RPL40BFusion protein, identical to
          Rpl40Ap, that is cleaved to yield ubiquitin and a
          ribosomal protein of the large (60S) ribosomal subunit
          with similarity to rat L40; ubiquitin may facilitate
          assembly of the ribosomal protein into ribosomes
          Length = 128

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16 VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Skud_9.20 Chr9 (46249..46623) [375 bp, 125 aa] {ON} YKR094C
          (REAL)
          Length = 125

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16 VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 12 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 67

>Smik_11.357 Chr11 complement(608082..608456) [375 bp, 125 aa]
          {ON} YKR094C (REAL)
          Length = 125

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16 VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 12 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 67

>SAKL0E14894g Chr5 complement(1235488..1235866,1236205..1236212)
          [387 bp, 128 aa] {ON} highly similar to uniprot|P61864
          Saccharomyces cerevisiae YLR167W RPS31 and highly
          similar to uniprot|P04838 Saccharomyces cerevisiae
          YIL148W and highly similar to uniprot|P04838
          Saccharomyces cerevisiae YKR094C and highly similar to
          uniprot|P04838 Saccharomyces cerevisiae YLL039C Fusion
          proteins that are cleaved to yield a ribosomal protein
          of the small (40S) subunit and ubiquitin
          Length = 128

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16 VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KLLA0A00616g Chr1 (59180..59187,59727..60105) [387 bp, 128 aa]
          {ON} highly similar to uniprot|P04838 Saccharomyces
          cerevisiae YKR094C RPL40B Fusion protein, identical to
          Rpl40Ap, that is cleaved to yield ubiquitin and a
          ribosomal protein of the large (60S) ribosomal subunit
          with similarity to rat L40; ubiquitin may facilitate
          assembly of the ribosomal protein into ribosomes
          Length = 128

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16 VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>TPHA0E00240 Chr5 (33468..33475,34104..34482) [387 bp, 128 aa]
          {ON} Anc_5.701 YIL148W
          Length = 128

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16 VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>TPHA0D04600 Chr4 complement(1005511..1005889,1006076..1006083)
          [387 bp, 128 aa] {ON} Anc_5.701 YIL148W
          Length = 128

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16 VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>TBLA0E02110 Chr5 complement(516651..517029,517297..517304) [387
          bp, 128 aa] {ON} Anc_5.701 YIL148W
          Length = 128

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16 VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>CAGL0G02475g Chr7 complement(220990..221368,222103..222110) [387
          bp, 128 aa] {ON} highly similar to uniprot|P04838
          Saccharomyces cerevisiae YKR094c UBI2 ubiquitin and
          highly similar to uniprot|P04838 Saccharomyces
          cerevisiae YIL148w UBI1 ubiquitin
          Length = 128

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16 VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Kpol_1043.69 s1043 complement(145335..145721) [387 bp, 128 aa]
          {ON} complement(145335..145721) [387 nt, 129 aa]
          Length = 128

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16 VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>NDAI0E05030 Chr5 complement(1148916..1149294,1149627..1149634)
          [387 bp, 128 aa] {ON} Anc_5.701
          Length = 128

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16 VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>NCAS0A03210 Chr1 (633779..633786,634077..634455) [387 bp, 128 aa]
          {ON} Anc_5.701
          Length = 128

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16 VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>NCAS0G00240 Chr7 (39394..39401,39701..40079) [387 bp, 128 aa]
          {ON} Anc_5.701
          Length = 128

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16 VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KAFR0E00530 Chr5 complement(113019..114158) [1140 bp, 379 aa]
          {ON} Anc_1.480 YEL037C
          Length = 379

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 42/78 (53%), Gaps = 1/78 (1%)

Query: 3  LNIHIKS-GQDKWEVSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYH 61
          +NI  K   ++K  V +   ST+   K  ++      +   +LI+SGK+LKDDQTV S  
Sbjct: 1  MNIIFKDFKKEKIPVELESSSTILDAKNKLASIKSCDIDQIKLIFSGKVLKDDQTVSSCG 60

Query: 62 IQDGHSVHLVKSQPKPQP 79
          ++D   V ++ S+ K  P
Sbjct: 61 LKDNDQVIMMISKKKATP 78

>TDEL0B02200 Chr2 (395520..395527,395598..395976) [387 bp, 128 aa]
          {ON} 
          Length = 128

 Score = 44.3 bits (103), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16 VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Ecym_4019 Chr4 (48709..48716,49112..49490) [387 bp, 128 aa] {ON}
          similar to Ashbya gossypii AFR285C 1-intron
          Length = 128

 Score = 44.3 bits (103), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16 VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>AFR285C Chr6 complement(950588..950966,951128..951135) [387 bp,
          128 aa] {ON} Syntenic homolog of Saccharomyces
          cerevisiae YKR094C (RPL40B) and YIL148W (RPL40A);
          1-intron
          Length = 128

 Score = 44.3 bits (103), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16 VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KNAG0L02120 Chr12 complement(379968..380346,380662..380669) [387
          bp, 128 aa] {ON} 
          Length = 128

 Score = 44.3 bits (103), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16 VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Suva_9.40 Chr9 (63806..64240) [435 bp, 144 aa] {ON} YIL148W
          (REAL)
          Length = 144

 Score = 44.7 bits (104), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16 VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 31 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 86

>Ecym_8408 Chr8 (845058..845519) [462 bp, 153 aa] {ON} similar to
          Ashbya gossypii ACL062C
          Length = 153

 Score = 44.7 bits (104), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16 VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 44.7 bits (104), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16  VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

>KNAG0J02880 Chr10 (550889..551350) [462 bp, 153 aa] {ON} Anc_4.16
          YLL039C
          Length = 153

 Score = 44.3 bits (103), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16 VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 44.3 bits (103), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16  VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

>TPHA0K02250 Chr11 (482029..482490) [462 bp, 153 aa] {ON} Anc_4.16
          YLL039C
          Length = 153

 Score = 44.3 bits (103), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16 VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 44.3 bits (103), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16  VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

>Suva_10.34 Chr10 complement(69167..69622) [456 bp, 151 aa] {ON}
          YALI0E18986g (REAL)
          Length = 151

 Score = 44.3 bits (103), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16 VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 44.3 bits (103), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16  VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

>KNAG0C06580 Chr3 complement(1275504..1275945,1276297..1276304)
          [450 bp, 149 aa] {ON} 
          Length = 149

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16 VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KLLA0E22133g Chr5 complement(1974635..1975786) [1152 bp, 383 aa]
          {ON} similar to uniprot|P32628 Saccharomyces cerevisiae
          YEL037C RAD23
          Length = 383

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 42/68 (61%)

Query: 11 QDKWEVSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHL 70
          ++K  + +A ++T+S  KE I++      +  +LIY+GKIL+D +TV   ++++G  V  
Sbjct: 10 KEKLPIELADDATISHAKELIAEQKQCDASQIKLIYAGKILQDPKTVSGCNLKEGDQVIF 69

Query: 71 VKSQPKPQ 78
          + S+ K +
Sbjct: 70 MISKTKKK 77

>TBLA0G00670 Chr7 (142636..143325) [690 bp, 229 aa] {ON} Anc_4.16
          YLL039C
          Length = 229

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16 VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16  VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16  VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 167 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

>NDAI0D04930 Chr4 (1172741..1173430) [690 bp, 229 aa] {ON} 
          Length = 229

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16 VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16  VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16  VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 167 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

>KAFR0I01470 Chr9 (306964..307653) [690 bp, 229 aa] {ON} Anc_5.701
          YIL148W
          Length = 229

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16 VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16  VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16  VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 167 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

>Ecym_4181 Chr4 complement(379972..380430) [459 bp, 152 aa] {ON}
          similar to Ashbya gossypii AGL128W
          Length = 152

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16 VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Kwal_55.20607 s55 complement(488683..489378) [696 bp, 231 aa]
          {ON} YLL039C (UBI4) - 1:1 [contig 144] FULL
          Length = 231

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16 VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16  VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16  VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 167 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

>ZYRO0C04026g Chr3 (318229..318687) [459 bp, 152 aa] {ON} similar
          to uniprot|P05759 Saccharomyces cerevisiae YLR167W
          RPS31 Fusion protein that is cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin ubiquitin may facilitate assembly of the
          ribosomal protein into ribosomes interacts genetically
          with translation factor eIF2B
          Length = 152

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16 VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Suva_10.33 Chr10 complement(68388..69152) [765 bp, 254 aa] {ON}
          YLL039C (REAL)
          Length = 254

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16 VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16  VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16  VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 167 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

>SAKL0H13926g Chr8 complement(1189515..1189979) [465 bp, 154 aa]
          {ON} similar to uniprot|P61864 Saccharomyces cerevisiae
          YLR167W RPS31 and similar to uniprot|P04838
          Saccharomyces cerevisiae YIL148W and similar to
          uniprot|P04838 Saccharomyces cerevisiae YKR094C and
          similar to uniprot|P04838 Saccharomyces cerevisiae
          YLL039C Fusion proteins that are cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin
          Length = 154

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16 VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KLTH0F08734g Chr6 complement(754886..755338) [453 bp, 150 aa]
          {ON} similar to uniprot|P61864 Saccharomyces cerevisiae
          YLR167W RPS31 Fusion protein that is cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin
          Length = 150

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16 VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>AGL128W Chr7 (470174..470632) [459 bp, 152 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YLR167W (RPS31)
          Length = 152

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16 VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>TPHA0C02390 Chr3 complement(536137..536589) [453 bp, 150 aa] {ON}
          Anc_8.386 YLR167W
          Length = 150

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16 VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KLTH0E05852g Chr5 complement(528861..530090) [1230 bp, 409 aa] {ON}
           highly similar to uniprot|P04838 Saccharomyces
           cerevisiae YLL039c UBI4 ubiquitin
          Length = 409

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16  VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 119 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 174

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16  VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 195 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 250

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16  VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 271 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 326

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16  VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 347 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 402

>Kwal_23.3311 s23 complement(238458..238910) [453 bp, 150 aa] {ON}
          YLR167W (RPS31) - Ribosomal protein S31 (S37) (YS24)
          [contig 251] FULL
          Length = 150

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16 VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>SAKL0H25784g Chr8 (2259314..2260231) [918 bp, 305 aa] {ON} highly
          similar to uniprot|P04838 Saccharomyces cerevisiae
          YLL039c UBI4 ubiquitin
          Length = 305

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16 VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16  VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16  VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 167 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16  VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 243 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298

>KLLA0D18304g Chr4 (1545371..1545823) [453 bp, 150 aa] {ON}
          similar to uniprot|P04838 Saccharomyces cerevisiae
          YLR167W RPS31 Fusion protein that is cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin; ubiquitin may facilitate assembly of the
          ribosomal protein into ribosomes; interacts genetically
          with translation factor eIF2B
          Length = 150

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16 VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KLLA0E00749g Chr5 complement(74948..76093) [1146 bp, 381 aa] {ON}
          highly similar to uniprot|P04838 Saccharomyces
          cerevisiae YLL039c UBI4 ubiquitin
          Length = 381

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16 VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16  VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16  VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 167 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16  VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 243 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16  VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 319 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 374

>Suva_10.30 Chr10
          complement(67747..67841,68061..68288,68558..69013,
          69256..69622) [1146 bp, 381 aa] {ON} YLL039C (REAL)
          Length = 381

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16 VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16  VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16  VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 167 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16  VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 243 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 31/56 (55%)

Query: 16  VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    G+P   QRLI++ K L+D +T+  Y+IQ   ++HLV
Sbjct: 319 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAEKQLEDGRTLSDYNIQKESTLHLV 374

>ACL062C Chr3 complement(255353..256501) [1149 bp, 382 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YLL039C
          (UBI4)
          Length = 382

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16 VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16  VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16  VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 167 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16  VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 243 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16  VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 319 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 374

>Skud_12.29 Chr12 complement(55051..55829,56058..56424) [1146 bp,
          381 aa] {ON} YLL039C (REAL)
          Length = 381

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16 VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16  VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16  VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 167 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16  VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 243 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16  VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 319 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 374

>YLL039C Chr12 complement(64062..65207) [1146 bp, 381 aa] {ON}
          UBI4Ubiquitin, becomes conjugated to proteins, marking
          them for selective degradation via the ubiquitin-26S
          proteasome system; essential for the cellular stress
          response; encoded as a polyubiquitin precursor
          comprised of 5 head-to-tail repeats
          Length = 381

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16 VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16  VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16  VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 167 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16  VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 243 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16  VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 319 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 374

>KAFR0H02000 Chr8 complement(369778..370236) [459 bp, 152 aa] {ON}
          Anc_8.386 YLR167W
          Length = 152

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16 VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>YLR167W Chr12 (498947..499405) [459 bp, 152 aa] {ON}  RPS31Fusion
          protein that is cleaved to yield a ribosomal protein of
          the small (40S) subunit and ubiquitin; ubiquitin may
          facilitate assembly of the ribosomal protein into
          ribosomes; interacts genetically with translation
          factor eIF2B
          Length = 152

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16 VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>ZYRO0G07854g Chr7 complement(634289..635671) [1383 bp, 460 aa]
          {ON} highly similar to uniprot|P04838 Saccharomyces
          cerevisiae YLL039c UBI4 ubiquitin
          Length = 460

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16 VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16  VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16  VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 167 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16  VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 243 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16  VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 319 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 374

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16  VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 395 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 450

>NCAS0C05850 Chr3 (1203331..1204497) [1167 bp, 388 aa] {ON} 
          Length = 388

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16 VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16  VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16  VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 167 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16  VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 243 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16  VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 319 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 374

>KLTH0C03410g Chr3 complement(295299..296474) [1176 bp, 391 aa]
          {ON} similar to uniprot|P32628 Saccharomyces cerevisiae
          YEL037C RAD23
          Length = 391

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 31/47 (65%)

Query: 22 STVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSV 68
          ST+S+ K+ +++      +  +LIYSGKIL+DD+T+  Y + DG  V
Sbjct: 22 STISEAKQRLAENKDCDESQIKLIYSGKILQDDRTIADYKLNDGDQV 68

>NCAS0C02940 Chr3 complement(552015..552473) [459 bp, 152 aa] {ON}
          Anc_8.386
          Length = 152

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16 VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>NDAI0G02280 Chr7 complement(511522..511980) [459 bp, 152 aa] {ON}
          Anc_8.386
          Length = 152

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16 VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Kpol_1070.6 s1070 complement(16980..18581) [1602 bp, 533 aa] {ON}
          complement(16980..18581) [1602 nt, 534 aa]
          Length = 533

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16 VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16  VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16  VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 167 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16  VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 243 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16  VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 319 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 374

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16  VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 395 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 450

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16  VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 471 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 526

>Smik_12.18 Chr12
          complement(49088..49552,49091..49552,49091..49546)
          [1383 bp, 460 aa] {ON} YLL039C (REAL)
          Length = 460

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16 VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16  VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16  VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 169 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 224

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16  VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 245 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 300

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16  VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 323 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 378

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16  VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 399 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 454

>TDEL0F05100 Chr6 (959574..960026) [453 bp, 150 aa] {ON} Anc_8.386
          YLR167W
          Length = 150

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16 VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Kpol_1030.5 s1030 complement(10263..10721) [459 bp, 152 aa] {ON}
          complement(10263..10721) [459 nt, 153 aa]
          Length = 152

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16 VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Kpol_1024.16 s1024 complement(58683..59141) [459 bp, 152 aa] {ON}
          complement(58683..59141) [459 nt, 153 aa]
          Length = 152

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16 VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>NDAI0G00330 Chr7 complement(54805..56088) [1284 bp, 427 aa] {ON}
          Anc_1.480 YEL037C
          Length = 427

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 39/66 (59%)

Query: 11 QDKWEVSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHL 70
          ++K  + + P +T+   K  +++A     +  ++IYSGK+L+D QTVE   +++G  +  
Sbjct: 11 KEKIPLDLEPSNTILDVKSQLAQAKACEESQIKIIYSGKVLQDGQTVEECQLKEGDQIIF 70

Query: 71 VKSQPK 76
          + S+ K
Sbjct: 71 MISKKK 76

>CAGL0D05082g Chr4 (488733..490334) [1602 bp, 533 aa] {ON} similar
          to uniprot|P04838 Saccharomyces cerevisiae YLL039c UBI4
          ubiquitin
          Length = 533

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16 VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16  VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16  VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 167 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16  VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 243 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16  VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 319 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 374

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16  VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 395 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 450

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16  VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 471 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 526

>CAGL0G08173g Chr7 (776549..777007) [459 bp, 152 aa] {ON} highly
          similar to uniprot|P61864 Saccharomyces cerevisiae
          YLR167w UBI3 Fusion protein that is cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin
          Length = 152

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16 VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KNAG0A02730 Chr1 complement(296966..297418) [453 bp, 150 aa] {ON}
          Anc_8.386 YLR167W
          Length = 150

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16 VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Kwal_27.10152 s27 complement(216695..217840) [1146 bp, 381 aa]
          {ON} YEL037C (RAD23) - ubiquitin-like protein [contig
          41] FULL
          Length = 381

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 32/47 (68%)

Query: 22 STVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSV 68
          STV++ K+ +++      +  +LIYSGKIL+DD+T+  Y ++DG  V
Sbjct: 22 STVNEAKQKLAENKECDDSQIKLIYSGKILQDDRTIGDYKLKDGDQV 68

>Suva_10.266 Chr10 (471118..471576) [459 bp, 152 aa] {ON} YLR167W
          (REAL)
          Length = 152

 Score = 42.0 bits (97), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16 VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Skud_12.234 Chr12 (445677..446135) [459 bp, 152 aa] {ON} YLR167W
          (REAL)
          Length = 152

 Score = 42.0 bits (97), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16 VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Smik_12.229 Chr12 (446071..446529) [459 bp, 152 aa] {ON} YLR167W
          (REAL)
          Length = 152

 Score = 42.0 bits (97), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16 VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>TBLA0H03180 Chr8 (775282..775740) [459 bp, 152 aa] {ON} Anc_8.386
          YLR167W
          Length = 152

 Score = 41.6 bits (96), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 31/54 (57%)

Query: 18 VAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 17 VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Suva_5.32 Chr5 complement(56798..58027) [1230 bp, 409 aa] {ON}
          YEL037C (REAL)
          Length = 409

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 40/66 (60%)

Query: 11 QDKWEVSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHL 70
          ++K  + + P +T+ + K  +++++    +  +LIYSGK+L+D +TV    ++DG  V  
Sbjct: 11 KEKVPLDLEPSNTIFEAKTKLAQSSSCEESQIKLIYSGKVLQDSKTVSECGLKDGDQVVF 70

Query: 71 VKSQPK 76
          + SQ K
Sbjct: 71 MISQKK 76

>Ecym_3572 Chr3 complement(1083184..1084515) [1332 bp, 443 aa]
          {ON} similar to Ashbya gossypii AFR358W
          Length = 443

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 47/77 (61%), Gaps = 1/77 (1%)

Query: 1  MSLNIHIKS-GQDKWEVSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVES 59
          M + I+ K   ++K  + ++P +T+++ K+ ++K      +  ++I+SGK+L+D  T+++
Sbjct: 1  MHITINFKDFKKEKLPLQLSPTATIAEAKQLLAKEKQCDESQLKMIFSGKVLQDGHTLDA 60

Query: 60 YHIQDGHSVHLVKSQPK 76
            ++DG  V  + S+ K
Sbjct: 61 CKLKDGDQVIFMISKKK 77

>CAGL0L01309g Chr12 complement(148931..150109) [1179 bp, 392 aa]
          {ON} similar to uniprot|P32628 Saccharomyces cerevisiae
          YEL037c RAD23 nucleotide excision repair protein
          Length = 392

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 39/66 (59%)

Query: 11 QDKWEVSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHL 70
          ++K+ + +    ++   KEA+S+      +  +LI+SGK+LKD  +VES + +DG+ V  
Sbjct: 11 KEKYPLDLESSQSIVAVKEALSEKLSCDPSQIKLIFSGKVLKDGDSVESCNFKDGNEVIF 70

Query: 71 VKSQPK 76
          + S  K
Sbjct: 71 MVSAKK 76

>Skud_5.53 Chr5 complement(79502..80695) [1194 bp, 397 aa] {ON}
          YEL037C (REAL)
          Length = 397

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 39/66 (59%)

Query: 11 QDKWEVSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHL 70
          ++K  + + P +T+ + K  ++++     +  +LIYSGK+L+D +TV    ++DG  V  
Sbjct: 11 KEKVPLDLEPSNTIFEAKTKLAQSTSCEESQIKLIYSGKVLQDSKTVSECGLKDGDQVVF 70

Query: 71 VKSQPK 76
          + SQ K
Sbjct: 71 MISQKK 76

>KAFR0I02780 Chr9 (560687..561331) [645 bp, 214 aa] {ON} Anc_1.480
          YEL037C
          Length = 214

 Score = 42.4 bits (98), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 42/80 (52%), Gaps = 3/80 (3%)

Query: 1  MSLNIHIKSGQDKWEVSVAPESTVSQFKEAISKANGVPVANQR--LIYSGKILKDDQTVE 58
          M L I     + K++++     TV   K  I K++ +        LIYSGK+L+DD T+ 
Sbjct: 1  MKLYIKDPRTRSKFQLNGTVNDTVRDLKHHIVKSHKLVCHTDEISLIYSGKLLQDDATLN 60

Query: 59 SYHIQD-GHSVHLVKSQPKP 77
          S H++D    V L++ +P P
Sbjct: 61 SLHLKDNAQIVMLIRRRPSP 80

>Smik_5.56 Chr5 complement(83505..84698) [1194 bp, 397 aa] {ON}
          YEL037C (REAL)
          Length = 397

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 39/66 (59%)

Query: 11 QDKWEVSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHL 70
          ++K  + + P +T+ + K  ++++     +  +LIYSGK+L+D +TV    ++DG  V  
Sbjct: 11 KEKVPLDLEPSNTIFEVKSKLAQSISCEESQIKLIYSGKVLQDSKTVSECGLKDGDQVVF 70

Query: 71 VKSQPK 76
          + SQ K
Sbjct: 71 MVSQKK 76

>YEL037C Chr5 complement(81407..82603) [1197 bp, 398 aa] {ON}
          RAD23Protein with ubiquitin-like N terminus, subunit of
          Nuclear Excision Repair Factor 2 (NEF2) with Rad4p that
          binds damaged DNA; enhances protein deglycosylation
          activity of Png1p; also involved, with Rad4p, in
          ubiquitylated protein turnover
          Length = 398

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 39/66 (59%)

Query: 11 QDKWEVSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHL 70
          ++K  + + P +T+ + K  ++++     +  +LIYSGK+L+D +TV    ++DG  V  
Sbjct: 11 KEKVPLDLEPSNTILETKTKLAQSISCEESQIKLIYSGKVLQDSKTVSECGLKDGDQVVF 70

Query: 71 VKSQPK 76
          + SQ K
Sbjct: 71 MVSQKK 76

>SAKL0D11814g Chr4 (981832..983034) [1203 bp, 400 aa] {ON} similar
          to uniprot|P32628 Saccharomyces cerevisiae YEL037C
          RAD23
          Length = 400

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 38/66 (57%)

Query: 11 QDKWEVSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHL 70
          ++K  + + P STV Q K+ ++          +LI+SGK+L+D +T+E   ++DG  V  
Sbjct: 11 KEKLPLELDPTSTVLQAKQQLASTKSCDEDQIKLIFSGKVLQDGKTLEECKLKDGDQVIF 70

Query: 71 VKSQPK 76
          + S+ +
Sbjct: 71 MISKKR 76

>KAFR0C03000 Chr3 (597127..598320) [1194 bp, 397 aa] {ON} Anc_8.142
           YGL181W
          Length = 397

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 28/40 (70%)

Query: 328 EERYEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSL 367
           E  Y  Q+RQL +MGF D ++N+ AL++S G++  A+D L
Sbjct: 187 ESDYRRQVRQLKEMGFSDSEKNLKALKKSNGNMNRAIDVL 226

>SAKL0H24772g Chr8 complement(2155837..2157081) [1245 bp, 414 aa]
           {ON} weakly similar to uniprot|P40956 Saccharomyces
           cerevisiae YGL181W GTS1 Contains a zinc-finger in the N-
           terminus and a long Gln-rich region in the C-terminus
           regulates ultradian rhythm cell size cell cycle lifespan
           sporulation heat tolerance and multidrug transport
          Length = 414

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 20/43 (46%), Positives = 27/43 (62%), Gaps = 1/43 (2%)

Query: 330 RYEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSLLNGDV 372
           R+ HQLR L ++G+ D D NV AL  + G +  ALD +L  DV
Sbjct: 184 RHSHQLRNLKELGYLDTDSNVEALVLARGDINLALD-ILEADV 225

>AGL185W Chr7 (350325..350477) [153 bp, 50 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YDR139C (RUB1)
          Length = 50

 Score = 35.8 bits (81), Expect = 0.008,   Method: Composition-based stats.
 Identities = 18/49 (36%), Positives = 30/49 (61%), Gaps = 1/49 (2%)

Query: 1  MSLNIHIKSGQDKWEVSVAPESTVSQFKEAISKANGVPVANQRLIYSGK 49
          M L +   +G++  ++ VAPE  V + KE + +  G+P + QRLI+ GK
Sbjct: 1  MLLKVKTLTGKE-IQIDVAPEDKVYRIKELLEEQEGIPPSQQRLIFQGK 48

>NDAI0B01850 Chr2 complement(440321..441532) [1212 bp, 403 aa] {ON} 
          Length = 403

 Score = 39.3 bits (90), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 27/44 (61%), Gaps = 2/44 (4%)

Query: 330 RYEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSLL--NGD 371
           +Y  +LR+L +MGF D D N  AL  + G + GA+D L   NGD
Sbjct: 166 KYSRELRRLQNMGFRDIDINTEALVLARGDLNGAIDILTQDNGD 209

>TBLA0D02210 Chr4 (555236..556927) [1692 bp, 563 aa] {ON} Anc_8.142
           YGL181W
          Length = 563

 Score = 39.3 bits (90), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 24/38 (63%)

Query: 330 RYEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSL 367
           +Y  QL++LNDMGF + D N  AL  S G +  ALD L
Sbjct: 219 KYSRQLKELNDMGFTNTDNNAEALSISRGDINRALDLL 256

>NCAS0B04590 Chr2 complement(835478..836821) [1344 bp, 447 aa] {ON}
           Anc_8.142 YGL181W
          Length = 447

 Score = 38.9 bits (89), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 24/42 (57%)

Query: 330 RYEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSLLNGD 371
           +Y  QLR L DMGF D D NV AL    G++   ++ L + +
Sbjct: 155 KYSRQLRSLKDMGFNDVDNNVEALNICNGNINKTINILTSNE 196

>ZYRO0D08140g Chr4 (705216..705437) [222 bp, 73 aa] {ON} similar
          to uniprot|Q6Q546 Saccharomyces cerevisiae YNR032C-A
          HUB1
          Length = 73

 Score = 35.4 bits (80), Expect = 0.019,   Method: Composition-based stats.
 Identities = 19/58 (32%), Positives = 28/58 (48%)

Query: 13 KWEVSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHL 70
          K  V    E  V  FK+ +S   G P +  +L+  G ILKD  +++ Y I D   + L
Sbjct: 13 KIRVKCLEEDLVGDFKKILSVQIGTPASKIQLVKGGSILKDHISLDDYEIHDNTFLEL 70

>CAGL0L06028g Chr12 complement(677581..679098) [1518 bp, 505 aa]
           {ON} weakly similar to uniprot|P40956 Saccharomyces
           cerevisiae YGL181w GTS1
          Length = 505

 Score = 38.5 bits (88), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 25/38 (65%)

Query: 330 RYEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSL 367
           +Y  +LRQL ++GF +  +N+ A+  S G V GALD L
Sbjct: 211 KYGRELRQLRELGFTNEQKNIDAITYSHGDVNGALDYL 248

>KLLA0C08470g Chr3 (742530..742754) [225 bp, 74 aa] {ON} highly
          similar to uniprot|Q6Q546 Saccharomyces cerevisiae
          YNR032C-A HUB1 Ubiquitin-like protein modifier
          Length = 74

 Score = 35.0 bits (79), Expect = 0.030,   Method: Composition-based stats.
 Identities = 20/59 (33%), Positives = 31/59 (52%), Gaps = 1/59 (1%)

Query: 13 KWEVSVAPESTVSQFKEAISKANGVPVANQRLIYSG-KILKDDQTVESYHIQDGHSVHL 70
          K  V    E TV  FK+ +S   G   A++ ++  G  +LKD  T+E Y + DG ++ L
Sbjct: 13 KVNVKCLSEDTVGDFKKVLSVQLGTASASKIVLQKGGSVLKDHITLEDYEVHDGTNLEL 71

>TBLA0B02160 Chr2 complement(496901..498115) [1215 bp, 404 aa]
          {ON} Anc_1.480 YEL037C
          Length = 404

 Score = 38.1 bits (87), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 40/71 (56%), Gaps = 2/71 (2%)

Query: 11 QDKWEVSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDG-HSVH 69
          ++K  + +  +ST+   K  I+      +   +LIYSGKILK+D T+ +  ++D  H + 
Sbjct: 11 KEKIPLELDADSTIESAKGQIASEKNCDIDQIKLIYSGKILKNDATILNSGLKDNDHIIF 70

Query: 70 LV-KSQPKPQP 79
          ++ K + K +P
Sbjct: 71 MISKKKKKTEP 81

>Ecym_4244 Chr4 complement(507884..508036) [153 bp, 50 aa] {ON}
          similar to Ashbya gossypii AGL185W
          Length = 50

 Score = 33.9 bits (76), Expect = 0.049,   Method: Composition-based stats.
 Identities = 15/34 (44%), Positives = 20/34 (58%)

Query: 16 VSVAPESTVSQFKEAISKANGVPVANQRLIYSGK 49
          + V PE  V   KE + +  G+P A QRLI+ GK
Sbjct: 15 IDVEPEDRVYSIKELLEEKEGIPPAQQRLIFQGK 48

>TPHA0O00440 Chr15 (78697..79806) [1110 bp, 369 aa] {ON} Anc_1.480
          YEL037C
          Length = 369

 Score = 37.0 bits (84), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 35/64 (54%)

Query: 13 KWEVSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLVK 72
          K  + +   STV   K+ +++      +  +LIYSGK+L+D  ++E   ++DG  V  + 
Sbjct: 13 KISLDLPASSTVLHAKKQLAEQKECDDSQIKLIYSGKVLQDSNSIEGCGLKDGDQVIFMI 72

Query: 73 SQPK 76
          S+ K
Sbjct: 73 SKKK 76

>NCAS0G04120 Chr7 (768760..769938) [1179 bp, 392 aa] {ON}
          Anc_1.480 YEL037C
          Length = 392

 Score = 36.6 bits (83), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 38/67 (56%), Gaps = 1/67 (1%)

Query: 3  LNIHIKS-GQDKWEVSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYH 61
          +NI  K   ++K  +++   +TV   K  +++      +  +LIYSGK+L+D +T+E   
Sbjct: 2  INITFKDFKKEKIPLALESTNTVLDAKTQLAQNKSCEESQIKLIYSGKVLQDAKTLEDCG 61

Query: 62 IQDGHSV 68
          ++DG  V
Sbjct: 62 LKDGDQV 68

>YGL181W Chr7 (157906..159096) [1191 bp, 396 aa] {ON}  GTS1Protein
           involved in Arf3p regulation and in transcription
           regulation; localizes to the nucleus and to endocytic
           patches; contains an N-terminal Zn-finger and ArfGAP
           homology domain, a C-terminal glutamine-rich region, and
           a UBA (ubiquitin associated) domain; gts1 mutations
           affect budding, cell size, heat tolerance, sporulation,
           life span, ultradian rhythms, endocytosis; expression
           oscillates in a pattern similar to metabolic
           oscillations
          Length = 396

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 25/38 (65%)

Query: 330 RYEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSL 367
           RY  QL +L DMGF D ++N+ AL  + G++  A+D L
Sbjct: 194 RYSRQLAELKDMGFGDTNKNLDALSSAHGNINRAIDYL 231

>ZYRO0F05192g Chr6 (434982..436136) [1155 bp, 384 aa] {ON} similar
          to uniprot|P32628 Saccharomyces cerevisiae YEL037C
          RAD23
          Length = 384

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 38/72 (52%), Gaps = 1/72 (1%)

Query: 3  LNIHIKS-GQDKWEVSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYH 61
          +NI  K   ++K  + + P S+V   K  ++       +  +LIYSGK+L+D + ++   
Sbjct: 2  INIIFKDFKKEKISLELDPSSSVKDAKVRLATEKSCEESQIKLIYSGKVLQDAKNLQESG 61

Query: 62 IQDGHSVHLVKS 73
          ++DG  V  + S
Sbjct: 62 LKDGDQVIFMIS 73

>Smik_7.91 Chr7 (152642..153637,153905..154108) [1200 bp, 399 aa]
           {ON} YGL181W (REAL)
          Length = 399

 Score = 35.8 bits (81), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 25/38 (65%)

Query: 330 RYEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSL 367
           RY  QL +L DMGF D ++N+ AL  + G++  A+D L
Sbjct: 196 RYSRQLLELRDMGFSDANKNLDALSSAHGNINRAIDYL 233

>TDEL0B04690 Chr2 (832571..833899) [1329 bp, 442 aa] {ON} Anc_8.142
           YGL181W
          Length = 442

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 22/38 (57%)

Query: 330 RYEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSL 367
           RY  +LR L +MG+ D D N  AL  + G +  A+D L
Sbjct: 193 RYSRELRTLKEMGYDDIDHNAEALSHAHGDLNRAIDIL 230

>Kwal_56.23883 s56 complement(755602..755760) [159 bp, 52 aa] {ON}
          YDR139C (RUB1) - ubiquitin-like protein [contig 171]
          FULL
          Length = 52

 Score = 31.6 bits (70), Expect = 0.28,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 26/49 (53%), Gaps = 1/49 (2%)

Query: 1  MSLNIHIKSGQDKWEVSVAPESTVSQFKEAISKANGVPVANQRLIYSGK 49
          M L +   +G++   V V P   V + KE + +  G+P   Q+LI+ GK
Sbjct: 1  MKLTVKTLTGKE-IAVVVDPSDKVYRIKEYLEEKEGIPPTQQKLIFQGK 48

>TBLA0H01310 Chr8 (293921..294136) [216 bp, 71 aa] {ON} Anc_8.311
          YDR139C
          Length = 71

 Score = 32.3 bits (72), Expect = 0.28,   Method: Composition-based stats.
 Identities = 13/34 (38%), Positives = 19/34 (55%)

Query: 16 VSVAPESTVSQFKEAISKANGVPVANQRLIYSGK 49
          + V PE  V   KE + +  G+P +  RLI+ GK
Sbjct: 15 IEVLPEDKVFHIKELLEQKEGIPPSQLRLIFQGK 48

>Kpol_370.6 s370 (10094..11308) [1215 bp, 404 aa] {ON}
          (10094..11308) [1215 nt, 405 aa]
          Length = 404

 Score = 34.7 bits (78), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 30/54 (55%)

Query: 23 TVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLVKSQPK 76
          TV   K+ I+       +  +LIYSGK+L++D T+    ++DG  V  + S+ K
Sbjct: 23 TVLDAKKQIAVKKDCEDSQIKLIYSGKVLQNDSTIGDCGLKDGDQVIFMISKKK 76

>Suva_7.81 Chr7 (153418..154434,154933..155121) [1206 bp, 401 aa]
           {ON} YGL181W (REAL)
          Length = 401

 Score = 34.3 bits (77), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 25/38 (65%)

Query: 330 RYEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSL 367
           RY  QL +L DMGF D ++N+ AL  + G++  A+D L
Sbjct: 194 RYSRQLAELRDMGFNDKNKNLDALSSAHGNLSRAIDYL 231

>SAKL0A01210g Chr1 (118298..118519) [222 bp, 73 aa] {ON} similar
          to uniprot|Q6Q546 Saccharomyces cerevisiae YNR032C-A
          HUB1
          Length = 73

 Score = 31.2 bits (69), Expect = 0.58,   Method: Composition-based stats.
 Identities = 18/58 (31%), Positives = 27/58 (46%)

Query: 13 KWEVSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHL 70
          K  V    E TV  FK+ +S   G       L   G +LKD  T++ Y + +G ++ L
Sbjct: 13 KIRVKCMSEDTVGDFKKVLSLQLGTQHTKIILQKGGSVLKDHITLDDYEVHNGTNLEL 70

>NCAS0A05390 Chr1 complement(1067778..1067999) [222 bp, 73 aa]
          {ON} Anc_6.343 YNR032C-A
          Length = 73

 Score = 30.8 bits (68), Expect = 0.87,   Method: Composition-based stats.
 Identities = 19/58 (32%), Positives = 27/58 (46%)

Query: 13 KWEVSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHL 70
          K +V    E +V  FK+ +S   G       L   G +LKD  T+E Y I D  ++ L
Sbjct: 13 KIKVKCLGEDSVGDFKKVLSIQLGTQPNKIVLQKGGNVLKDHITLEDYEIHDNTNLEL 70

>Ecym_2501 Chr2 complement(982410..982631) [222 bp, 73 aa] {ON}
          similar to Ashbya gossypii AER266C
          Length = 73

 Score = 30.8 bits (68), Expect = 0.90,   Method: Composition-based stats.
 Identities = 19/58 (32%), Positives = 26/58 (44%)

Query: 13 KWEVSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHL 70
          K  +   P  T+  FK+ +S   G       L   G  LKD  T+E Y I DG ++ L
Sbjct: 13 KVTIKCLPTDTIGDFKKVLSIQLGSSHNKLVLQKGGSSLKDLITLEDYEIHDGTNLEL 70

>TBLA0F04140 Chr6 complement(1022911..1023132) [222 bp, 73 aa]
          {ON} Anc_6.343 YNR032C-A
          Length = 73

 Score = 30.8 bits (68), Expect = 0.96,   Method: Composition-based stats.
 Identities = 15/55 (27%), Positives = 28/55 (50%)

Query: 16 VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHL 70
          V   PE TV  FK+ ++    + V+   +     +L+D  T++ Y I +G ++ L
Sbjct: 16 VKCLPEDTVHDFKQVLAAQLKMDVSKISVSRGKNVLRDHITLDDYEIHNGTNLEL 70

>Skud_4.398 Chr4
          complement(705294..705386,705390..705431,
          705435..705581) [282 bp, 94 aa] {ON} YDR139C (REAL)
          Length = 94

 Score = 31.2 bits (69), Expect = 1.1,   Method: Composition-based stats.
 Identities = 23/82 (28%), Positives = 36/82 (43%), Gaps = 25/82 (30%)

Query: 15 EVSVAPEST--VSQFKEAISKANGVPVANQRLIYSGK----------------------I 50
          E+SV  + +  V   KE + +  G+P + QRLI+ GK                      +
Sbjct: 6  EISVELKESDLVYHIKELLEEKEGIPPSQQRLIFQGKQMYVKLAWLITFQACLYLRFYRL 65

Query: 51 LKDDQ-TVESYHIQDGHSVHLV 71
            DD+ TV   H+ +G  +HLV
Sbjct: 66 RSDDKLTVTDAHLVEGMQLHLV 87

>Kpol_325.4 s325 complement(7253..7477) [225 bp, 74 aa] {ON}
          complement(7253..7477) [225 nt, 75 aa]
          Length = 74

 Score = 29.6 bits (65), Expect = 2.3,   Method: Composition-based stats.
 Identities = 19/59 (32%), Positives = 28/59 (47%), Gaps = 1/59 (1%)

Query: 16 VSVAPESTVSQFKEAISKANGVPVANQRLIYSGK-ILKDDQTVESYHIQDGHSVHLVKS 73
          V    E TV  FK+ +S   G     + ++  G  +LKD  T+E Y I +G  + L  S
Sbjct: 16 VKCLEEDTVEDFKKMVSLQMGGSSYKKLVLQKGNSVLKDHITLEDYEIHNGTHLELYYS 74

>Smik_14.362 Chr14 complement(645208..645426) [219 bp, 73 aa] {ON}
          YNR032C-A (REAL)
          Length = 73

 Score = 29.3 bits (64), Expect = 3.0,   Method: Composition-based stats.
 Identities = 18/58 (31%), Positives = 26/58 (44%)

Query: 13 KWEVSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHL 70
          K  V    E TV  FK+ +S   G       L   G +LKD  ++E Y + D  ++ L
Sbjct: 13 KVRVKCLGEDTVGDFKKVLSLQIGTQPNKIVLQKGGSVLKDHISLEDYEVHDQTNLEL 70

>CAGL0M10912g Chr13 complement(1083434..1083655) [222 bp, 73 aa]
          {ON} highly similar to uniprot|Q6Q546 Saccharomyces
          cerevisiae YNR032ca HUB1
          Length = 73

 Score = 29.3 bits (64), Expect = 3.3,   Method: Composition-based stats.
 Identities = 18/61 (29%), Positives = 28/61 (45%)

Query: 13 KWEVSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLVK 72
          K  V    + TV  FK+ +S   G+  +   L   G +LKD  T+  Y + D  ++ L  
Sbjct: 13 KIRVKCLEDDTVGDFKKVLSVQLGMQPSKIVLQKGGSVLKDHITLYDYEVHDNTNLELYY 72

Query: 73 S 73
          S
Sbjct: 73 S 73

>TDEL0C02590 Chr3 complement(448900..450006) [1107 bp, 368 aa]
          {ON} Anc_1.480 YEL037C
          Length = 368

 Score = 31.6 bits (70), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 20/26 (76%)

Query: 43 RLIYSGKILKDDQTVESYHIQDGHSV 68
          +LIYSGK+L+D ++++   ++DG  V
Sbjct: 43 KLIYSGKVLQDSKSLQESGLKDGDQV 68

>Skud_14.364 Chr14 complement(655336..655554) [219 bp, 73 aa] {ON}
          YNR032C-A (REAL)
          Length = 73

 Score = 29.3 bits (64), Expect = 3.4,   Method: Composition-based stats.
 Identities = 18/58 (31%), Positives = 26/58 (44%)

Query: 13 KWEVSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHL 70
          K  V    E TV  FK+ +S   G       L   G +LKD  ++E Y + D  ++ L
Sbjct: 13 KVRVKCLGEDTVGDFKKVLSLQIGTQPNKIVLQKGGSVLKDHISLEDYEVHDETNLEL 70

>TBLA0A07140 Chr1 (1774301..1774591) [291 bp, 96 aa] {ON} Anc_1.51
          YDR510W
          Length = 96

 Score = 29.6 bits (65), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 16/72 (22%), Positives = 33/72 (45%)

Query: 3  LNIHIKSGQDKWEVSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHI 62
          +N+ +  G  +    +   + + +  EA +K  G  V + R +Y G  ++ DQT E   +
Sbjct: 19 INLKVSDGSSEIFFKIKRTTPLRRLMEAFAKRQGKDVDSLRFLYDGVRIQPDQTPEDLDM 78

Query: 63 QDGHSVHLVKSQ 74
          +D   +   + Q
Sbjct: 79 EDNDIIEAHREQ 90

>KLTH0A06820g Chr1 complement(569895..570116) [222 bp, 73 aa] {ON}
          similar to uniprot|Q6Q546 Saccharomyces cerevisiae
          YNR032C-A HUB1
          Length = 73

 Score = 29.3 bits (64), Expect = 3.5,   Method: Composition-based stats.
 Identities = 16/52 (30%), Positives = 24/52 (46%)

Query: 13 KWEVSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQD 64
          K  V    E TV  FK+ ++   G+      L   G +LKD  T++ Y + D
Sbjct: 13 KIRVKCEGEDTVGDFKKVLALQLGISWTKIVLQKGGAVLKDHITLDDYEVHD 64

>KNAG0D00370 Chr4 (51604..51825) [222 bp, 73 aa] {ON} Anc_6.343
          YNR032C-A
          Length = 73

 Score = 28.9 bits (63), Expect = 4.3,   Method: Composition-based stats.
 Identities = 17/58 (29%), Positives = 27/58 (46%)

Query: 13 KWEVSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHL 70
          K  V    E +V  FK+ ++   GV      L   G +LKD  T+  Y + +G ++ L
Sbjct: 13 KLRVKCLEEDSVGDFKKVVAVQLGVMPGKIVLQKGGVVLKDHITLMDYEVHEGTNLEL 70

>Suva_14.387 Chr14 complement(668510..668728) [219 bp, 73 aa] {ON}
          YNR032C-A (REAL)
          Length = 73

 Score = 28.9 bits (63), Expect = 4.3,   Method: Composition-based stats.
 Identities = 16/50 (32%), Positives = 24/50 (48%)

Query: 21 ESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHL 70
          E TV  FK+ +S   G       L   G +LKD  ++E Y + D  ++ L
Sbjct: 21 EDTVGDFKKVLSLQIGTQPNKIVLQKGGSVLKDHISLEDYEVHDETNLEL 70

>Skud_7.90 Chr7 (163529..164719) [1191 bp, 396 aa] {ON} YGL181W
           (REAL)
          Length = 396

 Score = 31.2 bits (69), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 24/38 (63%)

Query: 330 RYEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSL 367
           RY  QL +L DMG+ D  +N+ AL  + G++  ++D L
Sbjct: 194 RYSRQLIELRDMGYNDTAKNLDALSFAHGNINRSIDYL 231

>Kpol_2002.45 s2002 (93655..93969) [315 bp, 104 aa] {ON}
          (93655..93969) [315 nt, 105 aa]
          Length = 104

 Score = 29.6 bits (65), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 16/72 (22%), Positives = 33/72 (45%)

Query: 3  LNIHIKSGQDKWEVSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHI 62
          +N+ +  G  +    +   + + +  EA +K  G  V + R +Y G  L+ DQT +   +
Sbjct: 26 INLKVSDGSSEIFFKIKRTTPLKRLMEAFAKRQGKDVDSLRFLYDGVRLQSDQTPDDLDM 85

Query: 63 QDGHSVHLVKSQ 74
          +D   +   + Q
Sbjct: 86 EDNDIIEAHREQ 97

>CAGL0K05731g Chr11 complement(561289..561615) [327 bp, 108 aa] {ON}
           highly similar to uniprot|Q12306 Saccharomyces
           cerevisiae YDR510w SMT3 ubiquitin-like protein
          Length = 108

 Score = 29.6 bits (65), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 15/72 (20%), Positives = 33/72 (45%)

Query: 3   LNIHIKSGQDKWEVSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHI 62
           +N+ +  G  +    +   + + +  EA +K  G  + + R +Y G  ++ DQT E   +
Sbjct: 32  INLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGLRIQADQTPEDLDM 91

Query: 63  QDGHSVHLVKSQ 74
           +D   +   + Q
Sbjct: 92  EDNDLIEAHREQ 103

>KLTH0F01650g Chr6 (126388..126672) [285 bp, 94 aa] {ON} highly
          similar to uniprot|Q12306 Saccharomyces cerevisiae
          YDR510W
          Length = 94

 Score = 29.3 bits (64), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 15/72 (20%), Positives = 33/72 (45%)

Query: 3  LNIHIKSGQDKWEVSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHI 62
          +N+ +  G  +    +   + + +  EA +K  G  + + R +Y G  ++ DQT E   +
Sbjct: 18 INLKVSDGSSEIFFKIKRTTPLRRLMEAFAKRQGKEMDSLRFLYDGVRIQADQTPEDLDM 77

Query: 63 QDGHSVHLVKSQ 74
          +D   +   + Q
Sbjct: 78 EDNDIIEAHREQ 89

>TPHA0E03650 Chr5 complement(773947..774264) [318 bp, 105 aa] {ON}
           Anc_1.51 YDR510W
          Length = 105

 Score = 29.3 bits (64), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 16/72 (22%), Positives = 33/72 (45%)

Query: 3   LNIHIKSGQDKWEVSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHI 62
           +N+ +  G  +    +   + + +  EA +K  G  + + R +Y G  L+ DQT E   +
Sbjct: 29  INLKVSDGSSEIFFKIKRTTPLKRLMEAFAKRQGKEMDSLRFLYDGIRLQADQTPEDLDM 88

Query: 63  QDGHSVHLVKSQ 74
           +D   +   + Q
Sbjct: 89  EDNDIIEAHREQ 100

>TPHA0H00400 Chr8 (77122..78522) [1401 bp, 466 aa] {ON} Anc_8.142
           YGL181W
          Length = 466

 Score = 30.4 bits (67), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 20/38 (52%)

Query: 330 RYEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSL 367
           +Y   ++ L  MG+ D D N  AL  + G +  A+D L
Sbjct: 227 KYSRHIKNLEQMGYTDIDNNAEALSIAHGDINQAIDIL 264

>Kpol_541.50 s541 complement(162130..163665) [1536 bp, 511 aa] {ON}
           complement(162130..163665) [1536 nt, 512 aa]
          Length = 511

 Score = 30.4 bits (67), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 21/38 (55%)

Query: 330 RYEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSL 367
           RY  +L +L +MGF D D N  A+  + G +  A+  L
Sbjct: 233 RYSRELNRLREMGFNDIDNNAEAMSLANGDISRAITIL 270

>Suva_2.689 Chr2 (1222165..1222470) [306 bp, 101 aa] {ON} YDR510W
          (REAL)
          Length = 101

 Score = 28.5 bits (62), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 15/72 (20%), Positives = 33/72 (45%)

Query: 3  LNIHIKSGQDKWEVSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHI 62
          +N+ +  G  +    +   + + +  EA +K  G  + + R +Y G  ++ DQT E   +
Sbjct: 24 INLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDM 83

Query: 63 QDGHSVHLVKSQ 74
          +D   +   + Q
Sbjct: 84 EDNDIIEAHREQ 95

>Skud_4.785 Chr4 (1389558..1389863) [306 bp, 101 aa] {ON} YDR510W
          (REAL)
          Length = 101

 Score = 28.5 bits (62), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 15/72 (20%), Positives = 33/72 (45%)

Query: 3  LNIHIKSGQDKWEVSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHI 62
          +N+ +  G  +    +   + + +  EA +K  G  + + R +Y G  ++ DQT E   +
Sbjct: 24 INLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDM 83

Query: 63 QDGHSVHLVKSQ 74
          +D   +   + Q
Sbjct: 84 EDNDIIEAHREQ 95

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.130    0.375 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 30,386,259
Number of extensions: 1091559
Number of successful extensions: 3665
Number of sequences better than 10.0: 197
Number of HSP's gapped: 3713
Number of HSP's successfully gapped: 286
Length of query: 372
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 261
Effective length of database: 40,753,473
Effective search space: 10636656453
Effective search space used: 10636656453
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)