Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_13.4868.831ON92391640980.0
YMR273C (ZDS1)8.831ON91592929170.0
Skud_13.4458.831ON89893426410.0
Suva_13.4618.831ON93167419300.0
TDEL0B006608.831ON9596756957e-77
KAFR0A027708.831ON8846466408e-70
YML109W (ZDS2)8.831ON9425565819e-62
KLTH0C04048g8.831ON9356285746e-61
Kpol_541.108.831ON10567035653e-59
Kwal_27.103188.831ON9256405614e-59
CAGL0F03421g8.831ON8176165451e-57
KNAG0G033708.831ON10762135307e-55
NCAS0B011108.831ON993995083e-52
NDAI0E003508.831ON11631235051e-51
ZYRO0G13992g8.831ON12111034924e-50
Kpol_1069.28.831ON10011054801e-48
KLLA0D01683g8.831ON944964728e-48
KAFR0B038608.831ON8431004645e-47
SAKL0D01716g8.831ON942964656e-47
AAL185W8.831ON10182264631e-46
TPHA0I002008.831ON10491064532e-45
Smik_13.258.831ON9491044442e-44
Suva_13.358.831ON982994433e-44
Skud_13.328.831ON9481044362e-43
Ecym_27108.831ON8961014353e-43
TBLA0B032008.831ON10861044311e-42
CAGL0J06688g8.831ON8281024244e-42
TPHA0C047208.831ON10721224212e-41
TBLA0D031908.831ON1682943902e-37
Skud_14.8singletonON74791923e-17
Kwal_47.17362singletonOFF10952840.030
TBLA0B082503.92ON134740890.073
Kpol_1032.634.78ON82285890.073
TBLA0C008402.638ON42440850.18
Suva_13.1515.538ON103874850.20
Skud_13.1415.538ON105767810.67
YBL069W (AST1)7.393ON42932790.85
TPHA0C020308.442ON88745800.86
CAGL0G03267g7.393ON42557771.6
Kwal_26.77882.479ON126753771.9
Smik_2.477.393ON42938762.0
YML010W (SPT5)5.538ON106374762.7
Smik_13.1415.538ON106167752.8
CAGL0D04818g3.468ON38230725.9
Kwal_27.108327.393ON42832718.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_13.486
         (923 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_13.486 Chr13 complement(794245..797016) [2772 bp, 923 aa] {...  1583   0.0  
YMR273C Chr13 complement(811233..813980) [2748 bp, 915 aa] {ON} ...  1128   0.0  
Skud_13.445 Chr13 complement(784651..787347) [2697 bp, 898 aa] {...  1021   0.0  
Suva_13.461 Chr13 complement(793859..796654) [2796 bp, 931 aa] {...   748   0.0  
TDEL0B00660 Chr2 (124552..127431) [2880 bp, 959 aa] {ON} Anc_8.8...   272   7e-77
KAFR0A02770 Chr1 complement(575572..578226) [2655 bp, 884 aa] {O...   251   8e-70
YML109W Chr13 (51640..54468) [2829 bp, 942 aa] {ON}  ZDS2Protein...   228   9e-62
KLTH0C04048g Chr3 (352955..355762) [2808 bp, 935 aa] {ON} simila...   225   6e-61
Kpol_541.10 s541 complement(26683..29853) [3171 bp, 1056 aa] {ON...   222   3e-59
Kwal_27.10318 s27 (284806..287583) [2778 bp, 925 aa] {ON} YMR273...   220   4e-59
CAGL0F03421g Chr6 complement(336157..338610) [2454 bp, 817 aa] {...   214   1e-57
KNAG0G03370 Chr7 complement(724041..727271) [3231 bp, 1076 aa] {...   208   7e-55
NCAS0B01110 Chr2 complement(182537..185518) [2982 bp, 993 aa] {O...   200   3e-52
NDAI0E00350 Chr5 (54073..57564) [3492 bp, 1163 aa] {ON} Anc_8.83...   199   1e-51
ZYRO0G13992g Chr7 complement(1112324..1115959) [3636 bp, 1211 aa...   194   4e-50
Kpol_1069.2 s1069 (1560..4565) [3006 bp, 1001 aa] {ON} (1560..45...   189   1e-48
KLLA0D01683g Chr4 complement(148855..151689) [2835 bp, 944 aa] {...   186   8e-48
KAFR0B03860 Chr2 complement(798642..801173) [2532 bp, 843 aa] {O...   183   5e-47
SAKL0D01716g Chr4 (135836..138664) [2829 bp, 942 aa] {ON} simila...   183   6e-47
AAL185W Chr1 (9537..12593) [3057 bp, 1018 aa] {ON} Syntenic homo...   182   1e-46
TPHA0I00200 Chr9 complement(34713..37862) [3150 bp, 1049 aa] {ON...   179   2e-45
Smik_13.25 Chr13 (47889..50738) [2850 bp, 949 aa] {ON} YML109W (...   175   2e-44
Suva_13.35 Chr13 (51377..54325) [2949 bp, 982 aa] {ON} YML109W (...   175   3e-44
Skud_13.32 Chr13 (51228..54074) [2847 bp, 948 aa] {ON} YML109W (...   172   2e-43
Ecym_2710 Chr2 (1373818..1376508) [2691 bp, 896 aa] {ON} similar...   172   3e-43
TBLA0B03200 Chr2 complement(743165..746425) [3261 bp, 1086 aa] {...   170   1e-42
CAGL0J06688g Chr10 complement(640041..642527) [2487 bp, 828 aa] ...   167   4e-42
TPHA0C04720 Chr3 complement(1017585..1020803) [3219 bp, 1072 aa]...   166   2e-41
TBLA0D03190 Chr4 complement(776722..781770) [5049 bp, 1682 aa] {...   154   2e-37
Skud_14.8 Chr14 (9768..9905,9909..9914,9918..9926,9930..9998) [2...    79   3e-17
Kwal_47.17362 s47 complement(370637..370966) [330 bp, 109 aa] {O...    37   0.030
TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]...    39   0.073
Kpol_1032.63 s1032 complement(145306..147774) [2469 bp, 822 aa] ...    39   0.073
TBLA0C00840 Chr3 complement(172404..173678) [1275 bp, 424 aa] {O...    37   0.18 
Suva_13.151 Chr13 (238296..241412) [3117 bp, 1038 aa] {ON} YML01...    37   0.20 
Skud_13.141 Chr13 (233891..237064) [3174 bp, 1057 aa] {ON} YML01...    36   0.67 
YBL069W Chr2 (90741..92030) [1290 bp, 429 aa] {ON}  AST1Lipid ra...    35   0.85 
TPHA0C02030 Chr3 complement(455550..458213) [2664 bp, 887 aa] {O...    35   0.86 
CAGL0G03267g Chr7 complement(308963..310240) [1278 bp, 425 aa] {...    34   1.6  
Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101...    34   1.9  
Smik_2.47 Chr2 (84723..86012) [1290 bp, 429 aa] {ON} YBL069W (REAL)    34   2.0  
YML010W Chr13 (247677..250868) [3192 bp, 1063 aa] {ON}  SPT5Comp...    34   2.7  
Smik_13.141 Chr13 (236419..239604) [3186 bp, 1061 aa] {ON} YML01...    33   2.8  
CAGL0D04818g Chr4 complement(469863..471011) [1149 bp, 382 aa] {...    32   5.9  
Kwal_27.10832 s27 (518369..519655) [1287 bp, 428 aa] {ON} YER101...    32   8.6  

>Smik_13.486 Chr13 complement(794245..797016) [2772 bp, 923 aa] {ON}
           YMR273C (REAL)
          Length = 923

 Score = 1583 bits (4098), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 790/916 (86%), Positives = 790/916 (86%)

Query: 1   MSNRNNEGTLRTTSNSKVTASQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLVD 60
           MSNRNNEGTLRTTSNSKVTASQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLVD
Sbjct: 1   MSNRNNEGTLRTTSNSKVTASQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLVD 60

Query: 61  PELDIKFGGESNGRRSWSGTAYNSASTPGGTTRMNNTRYSDPTPLENLHERGDLKLESSD 120
           PELDIKFGGESNGRRSWSGTAYNSASTPGGTTRMNNTRYSDPTPLENLHERGDLKLESSD
Sbjct: 61  PELDIKFGGESNGRRSWSGTAYNSASTPGGTTRMNNTRYSDPTPLENLHERGDLKLESSD 120

Query: 121 KGRQSNYAGSKKGVHSTSRXXXXXXXXXXXXWVPANQHPNVKPDNYLELVQDTLQNIQLX 180
           KGRQSNYAGSKKGVHSTSR            WVPANQHPNVKPDNYLELVQDTLQNIQL 
Sbjct: 121 KGRQSNYAGSKKGVHSTSRKLNANALKKNLLWVPANQHPNVKPDNYLELVQDTLQNIQLN 180

Query: 181 XXXXXXXXXXXXXXXXXXKVYDNKENDTENLNRAMSRHGTASLIRRPSTLRRSYTEFDDS 240
                             KVYDNKENDTENLNRAMSRHGTASLIRRPSTLRRSYTEFDDS
Sbjct: 181 GSEDNNDDQNNGNKNSGSKVYDNKENDTENLNRAMSRHGTASLIRRPSTLRRSYTEFDDS 240

Query: 241 EDDNGDSKTVNKVEERTSRIKERPVSLRDITEELTKISNSAGLTDNDAITLARTLSMAGS 300
           EDDNGDSKTVNKVEERTSRIKERPVSLRDITEELTKISNSAGLTDNDAITLARTLSMAGS
Sbjct: 241 EDDNGDSKTVNKVEERTSRIKERPVSLRDITEELTKISNSAGLTDNDAITLARTLSMAGS 300

Query: 301 YSDKKDEAEPSNQEGHHIEEDSNAMTSQAEPSDDGEYASNMPINNNMTWPERSSLRRSRF 360
           YSDKKDEAEPSNQEGHHIEEDSNAMTSQAEPSDDGEYASNMPINNNMTWPERSSLRRSRF
Sbjct: 301 YSDKKDEAEPSNQEGHHIEEDSNAMTSQAEPSDDGEYASNMPINNNMTWPERSSLRRSRF 360

Query: 361 NTYRIRXXXXXXXXXXXXXXXXXXXXXHHLPLANNTSKTAIDPHKSPFRQQAEEPESMSS 420
           NTYRIR                     HHLPLANNTSKTAIDPHKSPFRQQAEEPESMSS
Sbjct: 361 NTYRIRQQEQEKEVEEDKEKIKDYETEHHLPLANNTSKTAIDPHKSPFRQQAEEPESMSS 420

Query: 421 PGSIGDFQDIYDHYRQSSGEWEQEMGIEKEAEVVATKFEIDSLEQDLELREEPVGVIKSS 480
           PGSIGDFQDIYDHYRQSSGEWEQEMGIEKEAEVVATKFEIDSLEQDLELREEPVGVIKSS
Sbjct: 421 PGSIGDFQDIYDHYRQSSGEWEQEMGIEKEAEVVATKFEIDSLEQDLELREEPVGVIKSS 480

Query: 481 STEENKETKRHRRRNGWTWLNNKMNRDDDNEGNQRDDENEENMDSQRMERENSKRHHISL 540
           STEENKETKRHRRRNGWTWLNNKMNRDDDNEGNQRDDENEENMDSQRMERENSKRHHISL
Sbjct: 481 STEENKETKRHRRRNGWTWLNNKMNRDDDNEGNQRDDENEENMDSQRMERENSKRHHISL 540

Query: 541 FNGSEKAEQSNKEEANSASAPTTTSQTRQKIEKTFANLFRRKPHHKHEAXXXXXXXXXXX 600
           FNGSEKAEQSNKEEANSASAPTTTSQTRQKIEKTFANLFRRKPHHKHEA           
Sbjct: 541 FNGSEKAEQSNKEEANSASAPTTTSQTRQKIEKTFANLFRRKPHHKHEASSSPSSSPSSS 600

Query: 601 XXXIPLMPNNDAVHAPEXXXXXXXXXXXXEPVEPIVLXXXXXXXXXXXXXXGSREISVKI 660
              IPLMPNNDAVHAPE            EPVEPIVL              GSREISVKI
Sbjct: 601 PSSIPLMPNNDAVHAPEKKVKKIGTKNGKEPVEPIVLRNRRRPQRNHHSRRGSREISVKI 660

Query: 661 TKDXXXXXXXXXXXXXXXXXXXXXXXEIXXXXXXXXXXXDSDNLPKLQPAVSVSSTKSNS 720
           TKD                       EI           DSDNLPKLQPAVSVSSTKSNS
Sbjct: 661 TKDSQPQSQLQSQQQLQQQIQLQLKSEINEMEMKKNEENDSDNLPKLQPAVSVSSTKSNS 720

Query: 721 RDTGEEEIKKRNEKRSNTIELSNEQHRKYVQKEKTHEQKAPCRSPSQAPSQAPGQSPSQA 780
           RDTGEEEIKKRNEKRSNTIELSNEQHRKYVQKEKTHEQKAPCRSPSQAPSQAPGQSPSQA
Sbjct: 721 RDTGEEEIKKRNEKRSNTIELSNEQHRKYVQKEKTHEQKAPCRSPSQAPSQAPGQSPSQA 780

Query: 781 PIETSIETPIETPSETPSEAPAKTQAAPPLRHTSVLPPRKLTFADVKKPDKPNAPVQFTD 840
           PIETSIETPIETPSETPSEAPAKTQAAPPLRHTSVLPPRKLTFADVKKPDKPNAPVQFTD
Sbjct: 781 PIETSIETPIETPSETPSEAPAKTQAAPPLRHTSVLPPRKLTFADVKKPDKPNAPVQFTD 840

Query: 841 SAFGFPLPLLTVSTVIMFDHRLPINVERAIYRLSHLKLSNSKRGLREQVLLSNFMYAYLN 900
           SAFGFPLPLLTVSTVIMFDHRLPINVERAIYRLSHLKLSNSKRGLREQVLLSNFMYAYLN
Sbjct: 841 SAFGFPLPLLTVSTVIMFDHRLPINVERAIYRLSHLKLSNSKRGLREQVLLSNFMYAYLN 900

Query: 901 LVNHTLYMEQVAHDKE 916
           LVNHTLYMEQVAHDKE
Sbjct: 901 LVNHTLYMEQVAHDKE 916

>YMR273C Chr13 complement(811233..813980) [2748 bp, 915 aa] {ON}
           ZDS1Protein with a role in regulating Swe1p-dependent
           polarized growth; involved in maintaining Cdc55p in the
           cytoplasm where it promotes mitotic entry; involved in
           mitotic exit through Cdc14p regulation; interacts with
           silencing proteins at the telomere; has a role in Bcy1p
           localization; implicated in mRNA nuclear export
          Length = 915

 Score = 1128 bits (2917), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 616/929 (66%), Positives = 682/929 (73%), Gaps = 36/929 (3%)

Query: 1   MSNRNNEGTLRTTSNSKVTASQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLVD 60
           MSNR+NE  LRTTS+ K  ASQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLL+D
Sbjct: 1   MSNRDNESMLRTTSSDKAIASQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLID 60

Query: 61  PELDIKFGGESNGRRSWSGTAYNSASTPGGTTRMNNTRYSDPTPLENLHERGDLKLESSD 120
           PELDIKFGGES+GRRSWSGT  +SAS P  TT +NNTRYSDPTPLENLH RG+  +ESS+
Sbjct: 61  PELDIKFGGESSGRRSWSGTTSSSASMPSDTTTVNNTRYSDPTPLENLHGRGNSGIESSN 120

Query: 121 KGRQSNYAGSKKGVHSTSRXXXXXXXXXXXXWVPANQHPNVKPDNYLELVQDTLQNIQLX 180
           K +Q NY G KKGVHS SR            WVPANQHPNVKPDN+LELVQDTLQNIQL 
Sbjct: 121 KTKQGNYLGIKKGVHSPSRKLNANVLKKNLLWVPANQHPNVKPDNFLELVQDTLQNIQLS 180

Query: 181 XXXXXXXXXXXXX-------XXXXXKVYDNKENDTENLNRAMSRHGTASLIRRPSTLRRS 233
                                    + Y+NKEN+T NLNR +SRHG ASLIRRPSTLRRS
Sbjct: 181 DNGEDNDGNSNENNDIEDNGEDKESQSYENKENNTINLNRGLSRHGNASLIRRPSTLRRS 240

Query: 234 YTEFDDSEDDNGD----SKTVNKVEERTSRIKERPVSLRDITEELTKISNSAGLTDNDAI 289
           YTEFDD+EDD+      S+TVNKVEER S+IKERPVSLRDITEELTKISNSAGLTDNDAI
Sbjct: 241 YTEFDDNEDDDNKGDSASETVNKVEERISKIKERPVSLRDITEELTKISNSAGLTDNDAI 300

Query: 290 TLARTLSMAGSYSDKKDEAEPSNQEGHHIEEDSNAMTSQAEPSDDGEYASNMPINNNMTW 349
           TLARTLSMAGSYSDKKD+ +P   EGH+ E D    TSQA   DDGE+ASNMPINN MTW
Sbjct: 301 TLARTLSMAGSYSDKKDQPQP---EGHYDEGDIGFSTSQANTLDDGEFASNMPINNTMTW 357

Query: 350 PERSSLRRSRFNTYRIRXXXXXXXXXXXXXXXXXXXXXHHLPLANNTSKTAIDPHKSPFR 409
           PERSSLRRSRFNTYRIR                       L L  NT K  IDPHKSPFR
Sbjct: 358 PERSSLRRSRFNTYRIRSQEQEKEVEQSVDEMKNDDE-ERLKLTKNTIKVEIDPHKSPFR 416

Query: 410 QQAEEPESMSSPGSIGDFQDIYDHYRQSSGEWEQEMGIEKEAEVVATKFEIDSLEQDLEL 469
           QQ E+ E+MSSPGSIGDFQDIY+HYRQSSGEWEQEMGIEKEAE V  K   D++EQDLEL
Sbjct: 417 QQDEDSENMSSPGSIGDFQDIYNHYRQSSGEWEQEMGIEKEAEEVPVKVRNDTVEQDLEL 476

Query: 470 REEPVGVIKSSSTEENKETKRHRRRNGWTWLNNKMNRDDDNEGNQRDDENEENMDSQRME 529
           RE    ++K S+T++NKETKRHRRRNGWTWLNNKM+R+DDNE NQ DDENEEN+DSQRME
Sbjct: 477 REGTTDMVKPSATDDNKETKRHRRRNGWTWLNNKMSREDDNEENQGDDENEENVDSQRME 536

Query: 530 RENSKRHHISLFNGSEKAEQSNKEEANSASAPTTTSQTRQKIEKTFANLFRRKPHHKHEA 589
            +NSK+H+ISLFNG EK E SNKEE N++S  T TSQTRQKIEKTFANLFRRKPHHKH+A
Sbjct: 537 LDNSKKHYISLFNGGEKTEVSNKEEMNNSSTSTATSQTRQKIEKTFANLFRRKPHHKHDA 596

Query: 590 XXXXXXXXXXXXXXIPLMPNNDAVHAPEXXXXXXXXXXXXEPVEPIVLXXXXXXXXXXXX 649
                            +PNNDAVH               EPVEPIVL            
Sbjct: 597 SSSPSSSPSSSPS----IPNNDAVHVRVRKSKKLGNKSGREPVEPIVLRNRPRPHRHHHS 652

Query: 650 XXGSREISVKITKDXXXXXXXXXXXXXXXXXXXXXXXEIXXXXXXXXXXXDSDNLPKLQP 709
             GS++ISVK  KD                       E            DS++LP+LQP
Sbjct: 653 RHGSQKISVKTLKDSQPQQQIPLQPQLEGAIEIEKKEE-----------SDSESLPQLQP 701

Query: 710 AVSVSSTKSNSRDTGEEEIKKRNEKRSNTIELSNEQHRKYVQKEKTHEQKAPCRSPSQAP 769
           AVSVSSTKSNSRD  EEE KK+N+KRSNT E+SN+QH K+VQKE T EQKA  ++P+Q  
Sbjct: 702 AVSVSSTKSNSRDREEEEAKKKNKKRSNTTEISNQQHSKHVQKENTDEQKAQLQAPAQEQ 761

Query: 770 SQAPGQSPSQAPIETSIETPIETPSETPSEAPAKTQ--AAPPLRHTSVLPPRKLTFADVK 827
            Q      + AP++ S   P++T +  P EA A+TQ  AAPPL+HTS+LPPRKLTFADVK
Sbjct: 762 VQTSVPVQASAPVQNS--APVQTSA--PVEASAQTQAPAAPPLKHTSILPPRKLTFADVK 817

Query: 828 KPDKPNAPVQFTDSAFGFPLPLLTVSTVIMFDHRLPINVERAIYRLSHLKLSNSKRGLRE 887
           KPDKPN+PVQFTDSAFGFPLPLLTVSTVIMFDHRLPINVERAIYRLSHLKLSNSKRGLRE
Sbjct: 818 KPDKPNSPVQFTDSAFGFPLPLLTVSTVIMFDHRLPINVERAIYRLSHLKLSNSKRGLRE 877

Query: 888 QVLLSNFMYAYLNLVNHTLYMEQVAHDKE 916
           QVLLSNFMYAYLNLVNHTLYMEQVAHDKE
Sbjct: 878 QVLLSNFMYAYLNLVNHTLYMEQVAHDKE 906

>Skud_13.445 Chr13 complement(784651..787347) [2697 bp, 898 aa] {ON}
           YMR273C (REAL)
          Length = 898

 Score = 1021 bits (2641), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 573/934 (61%), Positives = 643/934 (68%), Gaps = 55/934 (5%)

Query: 1   MSNRNNEGTLRTTSNSKVTASQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLVD 60
           MSN  N+  LR TSN+++ A QRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLL+D
Sbjct: 1   MSNTINDSMLRATSNNRMAACQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLID 60

Query: 61  PELDIKFGGESNGRRSWSGTAYNSASTPGGTTRMNNTRYSDPTPLENLHERGDLKLESSD 120
           PELDIKF GESNGRRSWSGT     S P GTT MNNTRYSDPTPLENLHER    +E+  
Sbjct: 61  PELDIKFCGESNGRRSWSGTTSKPTSAPNGTTGMNNTRYSDPTPLENLHERRSSGIETCA 120

Query: 121 KGRQSNYAGSKKGVHSTSRXXXXXXXXXXXXWVPANQHPNVKPDNYLELVQDTLQNIQL- 179
           K +Q +  G K+GVHS SR            WVPANQHPNVKPDNYLELVQDTLQNI+L 
Sbjct: 121 KNKQGSSTGHKRGVHSPSRKLTANALKKNLLWVPANQHPNVKPDNYLELVQDTLQNIRLG 180

Query: 180 --XXXXXXXXXXXXXXXXXXXKVYDNKEN-DTENLNRAMSRHGTASLIRRPSTLRRSYTE 236
                                + + NKEN +T +LNR M RHG ASLIRRPSTLRRSYTE
Sbjct: 181 DNDDNDDENDKNENNRVTEETESHGNKENMNTVDLNRGMLRHGNASLIRRPSTLRRSYTE 240

Query: 237 FDDSEDDNGD----SKTVNKVEERTSRIKERPVSLRDITEELTKISNSAGLTDNDAITLA 292
           FDD EDDNG     SKTVN+VEERTSRIKERPVSLRDITEELTKISNSAGLT+ND ITLA
Sbjct: 241 FDDIEDDNGQRNEASKTVNRVEERTSRIKERPVSLRDITEELTKISNSAGLTNNDTITLA 300

Query: 293 RTLSMAGSYSDKKDEAEPSNQEGHHIEEDSNAMTSQAEPSDDGEYASNMPINNNMTWPER 352
           RTLSMAGSYSD  +EA P + +  +  E     +SQ + SDDGEYASNMP NN+MT PER
Sbjct: 301 RTLSMAGSYSDGGNEAGPKDLKDDYEGESIGVASSQRKASDDGEYASNMPTNNDMTGPER 360

Query: 353 SSLRRSRFNTYRIRXXXXXXXXXXXXXXXXXXXXXHHLPLANNTSKTAIDPHKSPFRQQA 412
           SSL+RSRFNTYRIR                       L L + T KT I+  KSPF Q+ 
Sbjct: 361 SSLKRSRFNTYRIRSQEQEKEEEQNVEETKNEEAG-RLHLTDKTLKTEIESPKSPFGQED 419

Query: 413 EEPESMSSPGSIGDFQDIYDHYRQSSGEWEQEMGIEKEAEVVATKFEIDSLEQDLELREE 472
           +E E  SSPGS+GDFQDIYDHYRQ SG+WEQE GIEKE E  A     D++EQ LEL EE
Sbjct: 420 DESEYASSPGSVGDFQDIYDHYRQFSGDWEQEEGIEKEEEPTAAMLPDDTVEQQLELGEE 479

Query: 473 PVGVIKSSSTEENKETKRHRRRNGWTWLNNKMNRDDDNEGNQRDDENEENMDSQRMEREN 532
             G+ K  ST+++KETKRHRRRNGWTWLN+KMN+++DNE NQ DDENEE+++SQ+MEREN
Sbjct: 480 SAGMNK--STDDSKETKRHRRRNGWTWLNSKMNKENDNEENQGDDENEESVESQKMEREN 537

Query: 533 SKRHHISLFNGSEKAEQSNKEEANSASAPTTTSQTRQKIEKTFANLFRRKPHHKHEAXXX 592
           SK+HHISLFNG EK E S+K+E NSA+ PTTTSQTRQKIEKTFANLFRRKPHHKHE    
Sbjct: 538 SKKHHISLFNGGEKNEPSSKDEVNSANVPTTTSQTRQKIEKTFANLFRRKPHHKHEESLS 597

Query: 593 XXXXXXXXXXXIPLMPNNDAVHAPEXXXXXXXXXXXXEPVEPIVLXXXXXXXXXXXXXXG 652
                       P +PNNDAV  PE            EP+EPIVL              G
Sbjct: 598 PSTS--------PPVPNNDAVRVPERKLKNLDEKNEREPIEPIVLHSRARRHRHRHNRHG 649

Query: 653 SREISVKITKDXXXXXXXXXXXXXXXXXXXXX---XXEIXXXXXXXXXXXDSDNLPKLQP 709
           SREISV+   D                          E+           DS+ L +LQP
Sbjct: 650 SREISVEAFNDKQSHSQLQPQPQQKPLQLQLQLQVEGEVSGIEVGKEVESDSEGLLQLQP 709

Query: 710 AVSVSSTKSNSRDTGEEEIKKRN-EKRSNTIELSNEQHRKYVQKEKTHEQKAPCRSPSQA 768
           AV+VSSTKSN RDT E E +K+N +KR +TI+L NE+  K VQKEK HE+KA      Q 
Sbjct: 710 AVNVSSTKSNRRDTEEAETRKQNKKKRGDTIDLPNERLTKDVQKEKAHERKA------QV 763

Query: 769 PSQAPGQSPSQAPIETSIETPIETPSETPSEAPAKTQAAPPLRHTSVLPPRKLTFADVKK 828
            ++AP Q   QAP+                        APPLRHTSVLPPRKLTFADVKK
Sbjct: 764 QTEAPVQ--VQAPV------------------------APPLRHTSVLPPRKLTFADVKK 797

Query: 829 PDKPNAPVQFTDSAFGFPLPLLTVSTVIMFDHRLPINVERAIYRLSHLKLSNSKRGLREQ 888
           P+KPNAPVQF+DSAFGFPLPLLTVSTVIMFDHRLPINVERAIYRLSHLKLSNSKRGLREQ
Sbjct: 798 PEKPNAPVQFSDSAFGFPLPLLTVSTVIMFDHRLPINVERAIYRLSHLKLSNSKRGLREQ 857

Query: 889 VLLSNFMYAYLNLVNHTLYMEQVAHDKEQQNQQQ 922
           VLLSNFMYAYLNLVNHTLYMEQ A DKEQQ  ++
Sbjct: 858 VLLSNFMYAYLNLVNHTLYMEQAAQDKEQQQHRE 891

>Suva_13.461 Chr13 complement(793859..796654) [2796 bp, 931 aa] {ON}
           YMR273C (REAL)
          Length = 931

 Score =  748 bits (1930), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/674 (60%), Positives = 469/674 (69%), Gaps = 26/674 (3%)

Query: 1   MSNRNNEGTLRTTSNSKVTASQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLVD 60
           MSN  NE  LRTTSN++  ASQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLL+D
Sbjct: 1   MSNTINESMLRTTSNNRAAASQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLID 60

Query: 61  PELDIKFGGESNGRRSWSGTAYNSASTPGGTTRMNNTRYSDPTPLENLHERGDLKLESSD 120
           PELDIKFGGESNGRRSWSG   +S S P  T  MNNTRYSDPTPLE LH +   + ES +
Sbjct: 61  PELDIKFGGESNGRRSWSGATSSSTSAPNVTRSMNNTRYSDPTPLEKLHVQSSTETESYE 120

Query: 121 KGRQSNYAGSKKGVHSTSRXXXXXXXXXXXXWVPANQHPNVKPDNYLELVQDTLQNIQLX 180
           + RQ NY G KK VHS SR            WVPANQHPNVKPDNYLELVQDTLQNI+L 
Sbjct: 121 RCRQGNYTGHKKVVHSPSRKLNANALKNNLLWVPANQHPNVKPDNYLELVQDTLQNIRLG 180

Query: 181 XXXXXXXXXXXXXXXXXXKV--YDNKEN-DTENLNRAMSRHGTASLIRRPSTLRRSYTEF 237
                             +   Y NKEN +  N+NR M RHG ASLIRRPSTLRRSYTEF
Sbjct: 181 DNDDDNDNNDNEGDEAHGETESYGNKENLNVVNVNRGMPRHGNASLIRRPSTLRRSYTEF 240

Query: 238 DDSEDDNG----DSKTVNKVEERTSRIKERPVSLRDITEELTKISNSAGLTDNDAITLAR 293
           DDSE D G    DS TVNK +ERTSRI+ERP+SLRDITEELTKISNSAGLTD+DAITLAR
Sbjct: 241 DDSEGDIGQGDDDSMTVNKAKERTSRIRERPISLRDITEELTKISNSAGLTDDDAITLAR 300

Query: 294 TLSMAGSYSDKKDEAEPSNQEGHHIEEDSNAMTSQAEPSDDGEYASNMPINNNMTWPERS 353
           TL+MAGSYSDK D     +    + EE++    SQ E  DD EYASNMPINN+ T PERS
Sbjct: 301 TLNMAGSYSDKGDGPRSEDSRVGYEEENAKVTGSQTETPDDVEYASNMPINNDSTGPERS 360

Query: 354 SLRRSRFNTYRIRXXXXXXXXXXXXXXXXXXXXXHHLPLANNTSKTAIDPHKSPFRQQAE 413
           SL+RSRFNTYRIR                       L LA NT +  I+  KSPFRQ+ +
Sbjct: 361 SLKRSRFNTYRIRSHTEEQEEEQVLEETKKEDVSR-LHLAENTIEIGINSPKSPFRQEDD 419

Query: 414 EPESMSSPGSIGDFQDIYDHYRQSSGEWEQEMGIEKEAEVVATKFEIDSLEQDLELREEP 473
           E + +SSPGSIGDFQDIYDHY QSSG+WE+EMGIEK   +   K E +++EQ+LE +EE 
Sbjct: 420 ESDPVSSPGSIGDFQDIYDHYTQSSGDWEKEMGIEKSKALEGGKVEDNAVEQELEPQEES 479

Query: 474 VGVIKSSSTEENKETKRHRRRNGWTWLNNKMNRDDDNEGNQRDDENEENMDSQRMERENS 533
            G + S +T+++KETKRHRRRNGWTWLNNKMN+++DN  NQ DDE +E+++SQRMER+NS
Sbjct: 480 TGTVVSGTTDDSKETKRHRRRNGWTWLNNKMNKEEDNGENQGDDEGDEDVESQRMERDNS 539

Query: 534 KRHHISLFNGSEKAEQSNKEEANSASAPTTTSQTRQKIEKTFANLFRRKPHHKHEAXXXX 593
           K+HHIS+FNG+EK E S+KEEAN+A+A T+TSQTRQKIEKTFANLFRRKPHHKHEA    
Sbjct: 540 KKHHISIFNGAEKTEASSKEEANNANASTSTSQTRQKIEKTFANLFRRKPHHKHEAS--- 596

Query: 594 XXXXXXXXXXIPL----MPNNDAVHAPEXXXXXXXXXXXXEPVEPIVLXXXXXXXXXXXX 649
                      PL     P+ND  H PE            EP EPIVL            
Sbjct: 597 -----------PLPSSPAPDNDTAHGPETKLKKLSSKGGREPTEPIVLHNRPHHHRHHQG 645

Query: 650 XXGSREISVKITKD 663
             GSRE+S+K T D
Sbjct: 646 RRGSREVSMKGTSD 659

 Score =  261 bits (667), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 141/218 (64%), Positives = 155/218 (71%), Gaps = 36/218 (16%)

Query: 700 DSDNLPKLQPAVSVSSTKSNSRDTGEEEIKKRN-EKRSNTIELSNEQHRKYVQKEKTHEQ 758
           D+++LPKLQPA+SVSSTKSN RD  E + KK+N EKRSNT      +H K+VQKE  HEQ
Sbjct: 739 DTESLPKLQPAISVSSTKSNPRDCEEVDAKKKNKEKRSNT-----GKHAKHVQKEMDHEQ 793

Query: 759 KAPCRSPSQAPSQAPGQSPSQAPIETSIETPIETPSETPSEAPAKTQAAPPLRHTSVLPP 818
           +                               +  +   + A      AP LRHTSVLPP
Sbjct: 794 RG------------------------------QAAAAPVAPADPAAPPAPALRHTSVLPP 823

Query: 819 RKLTFADVKKPDKPNAPVQFTDSAFGFPLPLLTVSTVIMFDHRLPINVERAIYRLSHLKL 878
           RKLTFADVKK +KPNAPVQFTDSAFGFPLPLLTVSTV+MFDHRLPINVERAIYRLSHLKL
Sbjct: 824 RKLTFADVKKSEKPNAPVQFTDSAFGFPLPLLTVSTVVMFDHRLPINVERAIYRLSHLKL 883

Query: 879 SNSKRGLREQVLLSNFMYAYLNLVNHTLYMEQVAHDKE 916
           SNSKR LREQVLLSNFMYAYLNLVNHTLYMEQ  HDKE
Sbjct: 884 SNSKRELREQVLLSNFMYAYLNLVNHTLYMEQAGHDKE 921

>TDEL0B00660 Chr2 (124552..127431) [2880 bp, 959 aa] {ON} Anc_8.831
           YMR273C
          Length = 959

 Score =  272 bits (695), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 233/675 (34%), Positives = 333/675 (49%), Gaps = 129/675 (19%)

Query: 18  VTASQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLVDPELDIKFG--------- 68
           +T SQR+KRKSEVLIAAQS+DNE+++VK+LKR+SIGS+DLL+DPEL+ +           
Sbjct: 24  MTESQREKRKSEVLIAAQSIDNEVQNVKSLKRISIGSIDLLMDPELEYRVNVNSPNTRKS 83

Query: 69  --------------------GESNGRRSWSGTAYNSASTPGG----TTRMN--------N 96
                               GE  G  S S  A +S  T G     TT  +        N
Sbjct: 84  WSSNSSSSEEEHDVAPCYDKGEDEGEASVSDGADDSFDTTGADYLQTTNHSSANHQSTPN 143

Query: 97  TRYSDP--------TPLENLHERGDLKLESSDKGRQSNYAGSKKGVHSTSRXXXXXXXXX 148
            + + P        T + +L  RG + + +      S+  GS+ G +S+S          
Sbjct: 144 VKPTSPQISVKRTLTGVGSLR-RGGVNIPTRKLSSASD-NGSEDGSNSSS-------ITK 194

Query: 149 XXXWVPANQHPNVKPDNYLELVQDTLQNIQLXXXXXXXXXXXXXXXXXXXKVYDNKENDT 208
              WVPA QHP+VKP+N+LELVQDTL NIQL                   K YD    D 
Sbjct: 195 QLLWVPAAQHPSVKPENFLELVQDTLHNIQLDEKKETTDNDNDESNKENAKAYDRLPID- 253

Query: 209 ENLNRAMSRHGTASLIRRPSTLRRSYTEF---DDSEDDNGDSKTVNK----------VEE 255
             + R        SL+RRPS LR+SYTEF   D++E   G S  V K          +  
Sbjct: 254 --ITRKRD-----SLVRRPSRLRKSYTEFEEYDETESLEG-SVAVGKESRNSFERSSIAP 305

Query: 256 RTSRIKERPVSLRDITEELTKISNSAGLTDNDAITLARTLSMAGSY--SDKKDEAEPSNQ 313
            +S    R VSL+DITEEL KISN+AGLT +DAITLARTLSMAGS+  S+  ++ + S +
Sbjct: 306 CSSGRSSRTVSLKDITEELNKISNNAGLTSSDAITLARTLSMAGSFASSEVNEDYDTSKR 365

Query: 314 EGHHIEEDSNAMTSQAEPSDDGEYASNMPINNNMTWPERSSLRRSRFNTYRIRXXXXXXX 373
            G H+  D++ + ++    DD E+ASNM + + +  P RSSLRRS+FNTYR+R       
Sbjct: 366 NGIHL--DADDVQNEYNKEDDNEFASNMLMKHGVVIPARSSLRRSKFNTYRVRSSGSTSS 423

Query: 374 XXXXXXXXXXXXXXHHLPLANNTSKTAI---DPHKSPFRQQAEEPESMSSPGSIGDFQDI 430
                             L N T++++    D + SP  +       MSSP SI DFQDI
Sbjct: 424 LDDEHHESETKRKLSS-GLENVTAESSASQQDIYHSPSIKG--NGSIMSSPSSINDFQDI 480

Query: 431 YDHYRQSSGEWEQEM--GIEKEAEVVATKFEIDSLEQ--DLELREEPVGVIKSSSTEENK 486
           YDHYRQ S +WE+E+  G E +      + + ++ ++    +L +   G  KSS   ++ 
Sbjct: 481 YDHYRQPSVDWEKELKKGTESDDSNKGNQLDFETSKEIASSKLSDLSQGNAKSSIEAQDM 540

Query: 487 ET-------KRHRRRNGWTWLNNKMNRDDDNEGNQRD-----------------DENEEN 522
           E        +   +R+GW+WLN   +++ + E N +D                 DE+ E 
Sbjct: 541 EQASSTVVREMKGKRSGWSWLNGMGSKETNTEKNVKDTARQEVPLHREPSDSHIDEDFEK 600

Query: 523 MD---SQRMEREN-SKRHHISLFNGSEKAEQSNKEEANSASAP-------TTTSQTRQKI 571
                +  ++R N SK  H+ +F  +E +++ +  E  + S          +++ TRQ  
Sbjct: 601 TSTPVTTEIQRSNHSKNRHLPIFPANESSKRKDTTEEPAVSTKMGRSSSSDSSNLTRQMF 660

Query: 572 EKTFANLFRRKPHHK 586
           EK  ANLFRRK   K
Sbjct: 661 EKKIANLFRRKGKKK 675

 Score =  196 bits (497), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 107/218 (49%), Positives = 138/218 (63%), Gaps = 39/218 (17%)

Query: 701 SDNLPKLQPAVSVSSTKSN----SRDTGEEEIKKRNEKRSNTIELSNEQHRKYVQKEKTH 756
           +++LP LQPAVSV+STKS     +     E +K+ +   S  + +               
Sbjct: 748 AEDLPALQPAVSVTSTKSAHVPLASSVVIESVKELDGDDSQDVSM--------------- 792

Query: 757 EQKAPCRSPSQAPSQAPGQSPSQAPIETSIETPIETPSETPSEAPAKTQAAPPLRHTSVL 816
           +Q A      Q       ++ S     + ++T ++ P++ PS  P              +
Sbjct: 793 DQNA------QTSIDISTETLSMKEQTSEVQTDVKQPADGPSHQP--------------V 832

Query: 817 PPRKLTFADVKKPDKPNAPVQFTDSAFGFPLPLLTVSTVIMFDHRLPINVERAIYRLSHL 876
           PPRKLTF DVK+ ++ NAP++FTDSAFGFPLP+LTVSTVIMFDHRLPINVERAIYRLSHL
Sbjct: 833 PPRKLTFDDVKRSEQSNAPMKFTDSAFGFPLPMLTVSTVIMFDHRLPINVERAIYRLSHL 892

Query: 877 KLSNSKRGLREQVLLSNFMYAYLNLVNHTLYMEQVAHD 914
           KLS+ KR LR+QV+LSNFMYAYLNLVNHTLYMEQVA +
Sbjct: 893 KLSDPKRELRQQVVLSNFMYAYLNLVNHTLYMEQVAQE 930

>KAFR0A02770 Chr1 complement(575572..578226) [2655 bp, 884 aa] {ON}
           Anc_8.831 YMR273C
          Length = 884

 Score =  251 bits (640), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 223/646 (34%), Positives = 310/646 (47%), Gaps = 149/646 (23%)

Query: 21  SQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLVDPELDIKFG-----GESNGRR 75
           S R+KRKSEVLIAA+S+DNE+R+VKNLKRLSIGSMDLL+DPEL+ K        + N R+
Sbjct: 27  SLRNKRKSEVLIAARSIDNEVRNVKNLKRLSIGSMDLLIDPELEYKVSHVNTNDDLNKRK 86

Query: 76  SWSGTAYNSASTPGGT---TRMNNTRYSDP------------------------TPLENL 108
           SW+  +     T   T   ++   T   DP                        T  E L
Sbjct: 87  SWTPDSTTFTGTKVNTRPKSKSFGTHIHDPPLVRINNNSDSSSSDEEEDDSIDITRTEYL 146

Query: 109 HERGDLK----------LESSDKGRQSNYAGSKKGVHSTSRXXXXXXXXXXXXWVPANQH 158
           H++  L+          L   +  RQS    S+K   S  R            WVPA++H
Sbjct: 147 HDQTTLQSQRKLPKHRNLSGINSSRQS----SRKL--SNDRTDNEDKLKNNLLWVPASKH 200

Query: 159 PNVKPDNYLELVQDTLQNIQLXXXXXXXXXXXXXXXXXXXKVYDNKENDTENLNRAMSRH 218
           PNVKP NY+ELVQDTLQ+I +                      D+K ND +N+N+    H
Sbjct: 201 PNVKPQNYIELVQDTLQHIHID---------------------DSKSNDNDNINKENDAH 239

Query: 219 GT--ASLIRRPSTLRRSYTEF------DDSEDDNGDSKTVNKVEERTSRIKERPVSLRDI 270
            +   SL+RRPS LR+SYTE+      DD   +N + +    +    S  K R VSL+DI
Sbjct: 240 SSKNGSLVRRPSRLRKSYTEYEEENYQDDYNRNNSNDEENPNIGNFRSSNKGRSVSLKDI 299

Query: 271 TEELTKISNSAGLTDNDAITLARTLSMAGSYSDKKDEAEPSNQEGHHIEEDSNAMTSQAE 330
           TEELTKISN AGLTD+DAITLARTLSM GS+S+  D+ E      +  ++D+N    +  
Sbjct: 300 TEELTKISNKAGLTDSDAITLARTLSMTGSFSNGTDDMEL--LSNYSDQQDNNFNNDEHY 357

Query: 331 PSDDGEYASNMPINNNMTWPERSSLRRSRFNTYRIRXXXXXXXXXXXXXXXXXXXXXHHL 390
             +D E+ASNM + N +T P+RSSLRRS+FNTYR+R                     H  
Sbjct: 358 NKNDDEFASNMLMKNGLTIPQRSSLRRSKFNTYRVR-------------SSSAPSNIHSK 404

Query: 391 PLANNT-----------SKTAIDPHKSPFRQQAEEPESMS-SPGSIGDFQDIYDHYRQSS 438
           P+ +N            SKT+I   KSP  +     E ++ SPGSI    D+YDHY  SS
Sbjct: 405 PINSNIKEPKTFKYPYNSKTSI--KKSPVNRSNNYTEPVTESPGSIS---DLYDHYAYSS 459

Query: 439 GEWEQEMGIEKEAEVVATKFEIDSLEQDLELREEPVGVIKSSSTE----ENKET-KRHRR 493
              ++E       +  +    IDS E           ++K S +E    EN +       
Sbjct: 460 --VDEETSNATNLQETSNDGSIDSNES-----SNDSVLVKPSHSESMIHENFDALASDTV 512

Query: 494 RNGWTWLNNK----MNRDDDNEGNQRDD----ENEENMDSQRMERENSKRHHISLFNGSE 545
            +GW+ +NN+    + R+++N G   D+     N+E+    +    +SK  H  LF    
Sbjct: 513 TDGWSNVNNENAHFLQRNNNN-GRLNDELVSKGNQESTHYNKTRSNHSKNRHKPLF---- 567

Query: 546 KAEQSNKEEANSASAPTT-----TSQTRQKIEKTFANLFRRKPHHK 586
                      S + P T      S+ +Q +E+    LF+RK H +
Sbjct: 568 ----------TSTNTPMTAKTKNVSKKKQTLEEKIVKLFKRKAHRR 603

 Score =  182 bits (462), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 107/215 (49%), Positives = 127/215 (59%), Gaps = 38/215 (17%)

Query: 704 LPKLQPAVSVSSTKSNSRDTGEEEIKKRNEKRSN------TIELSNEQHRKYVQKEKTHE 757
           LP LQPAVSV STK  S  +        +   S+      T+EL  ++ +    +    E
Sbjct: 661 LPSLQPAVSVVSTKKESNASAPPSSASSSSLSSSSSTVIQTVELEGDESQDVSYEALKGE 720

Query: 758 QKAPCRSPSQAPSQAPGQSPSQAPIETSIETPIETPSETPSEAPAKTQAAPPLRHTSVLP 817
                R+P  + S                    ET +E   E  +   + P         
Sbjct: 721 D---FRNPELSSS--------------------ETTAEQEKELKSAISSLP--------- 748

Query: 818 PRKLTFADVKKPDKPNAPVQFTDSAFGFPLPLLTVSTVIMFDHRLPINVERAIYRLSHLK 877
           PRKLTF DVK+P+KPNAP+ F+DSAFGFPLP+LT STVIMFDHRL INVERAIYRLSHLK
Sbjct: 749 PRKLTFDDVKRPEKPNAPIHFSDSAFGFPLPMLTTSTVIMFDHRLGINVERAIYRLSHLK 808

Query: 878 LSNSKRGLREQVLLSNFMYAYLNLVNHTLYMEQVA 912
           LS+ KR LR+QVLLSNFMYAYLNLVNHTLYMEQ A
Sbjct: 809 LSDPKRELRQQVLLSNFMYAYLNLVNHTLYMEQAA 843

>YML109W Chr13 (51640..54468) [2829 bp, 942 aa] {ON}  ZDS2Protein
           with a role in regulating Swe1p-dependent polarized
           growth; involved in maintenance of Cdc55p in the
           cytoplasm where it promotes mitotic entry; interacts
           with silencing proteins at the telomere; implicated in
           the mitotic exit network through regulation of Cdc14p
           localization; paralog of Zds1p
          Length = 942

 Score =  228 bits (581), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 189/556 (33%), Positives = 264/556 (47%), Gaps = 141/556 (25%)

Query: 24  DKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLVDPELDIKFGG-------------- 69
           +KRKS+VLIAA+SLD EI++VKNLKRLSIGSMDL++DPEL+ K                 
Sbjct: 46  EKRKSDVLIAAKSLDTEIQNVKNLKRLSIGSMDLVIDPELEFKVNSRNSYSSDSSKESLQ 105

Query: 70  ----ESNGRRS----WSGTAYNSASTPGGTTRMNNTRYSDPTPLENLHERGDLKLE---- 117
               E N  RS      G+  N A   G  T ++++   D T  E LH+   L+ E    
Sbjct: 106 ESLHEENIIRSEQKEEQGSEDNDAYEEGDATNVDDS--IDITQTEYLHDEETLEKEKIIR 163

Query: 118 ---------SSDKGRQSNYAGSKKGVHST------SRXXXXXXXXXXXXWVPANQHPNVK 162
                    +    R    +G K   H                      WVPA+QHPNVK
Sbjct: 164 NASSSTSSSARVTSRNRRLSGVKTLAHDVVLDVENDHDSKMVDLTQNLLWVPADQHPNVK 223

Query: 163 PDNYLELVQDTLQNIQLXXXXXXXXXXXXXXXXXXXKVYDNKENDTENLNRAM--SRHGT 220
           P+NYLEL+QDTLQNIQ+                      D  EN  E  N  +  +R  T
Sbjct: 224 PENYLELIQDTLQNIQISTNQ------------------DIDENKLELGNNHVISNRKRT 265

Query: 221 ASLIRRPSTLRRSYTEFDD-----SEDDNGDSKTVNKVEERTSRIKE-RPVSLRDITEEL 274
            S++RRPS L+ SYT+FDD      +   G+ +   ++   +S IK  R VSL++ITEEL
Sbjct: 266 GSVVRRPSRLKTSYTKFDDEPPLADKPQEGEIQVDKRIS--SSDIKTIRSVSLKEITEEL 323

Query: 275 TKISNSAGLTDNDAITLARTLSMAGSYSDKKDEAEPSNQEGHHIEEDSNAMTSQAEPSDD 334
           TKISN+AGLTD+DA+TLAR+LSM+GS+++     E  +  G+H E             +D
Sbjct: 324 TKISNNAGLTDSDAVTLARSLSMSGSFTN-----ESLHLNGNHTE-------------ND 365

Query: 335 GEYASNMPINNNMTWPERSSLRRSRFNTYRIRXXXXXXXXXXXXXXXXXXXXXHHLPLAN 394
            E+ASNM     +T PERSSLRRS+FNTY+IR                       LP A 
Sbjct: 366 NEFASNMFNETGLTIPERSSLRRSKFNTYKIRLEGSS------------------LPQAV 407

Query: 395 NTSKTAIDPHKSPFRQQAEEPESMSSP----GSIGDFQDIYDHYRQSSGEWEQE------ 444
             + + ++   +  R+ A  P S +       S+ DF +I+DHYR++S +W  E      
Sbjct: 408 KLN-SLMNIQTNDNRRSASSPASYTQVPQEQASLNDFHEIFDHYRRTSTDWSTENEKYVD 466

Query: 445 -------------MGIEKEAEVVATKFEIDSLEQDLELREEPVGVIKSS------STEEN 485
                          I +E+ +++T    DS    + ++    G + S       S+ E 
Sbjct: 467 STNYYSDEEDLTHASISQESSLLST----DSSNNSVLIKPHNTGSMISEKLDQHVSSSEK 522

Query: 486 KETKRHRRRNGWTWLN 501
             T      +GW+WLN
Sbjct: 523 SNTNNSEANHGWSWLN 538

 Score =  181 bits (460), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 90/106 (84%)

Query: 807 APPLRHTSVLPPRKLTFADVKKPDKPNAPVQFTDSAFGFPLPLLTVSTVIMFDHRLPINV 866
           +P     S LPPRKLTF DV KPD  NAP++FTDSAFGFPLP++T STVIMFDHRL INV
Sbjct: 808 SPTAPQISTLPPRKLTFEDVVKPDYSNAPIKFTDSAFGFPLPMITNSTVIMFDHRLGINV 867

Query: 867 ERAIYRLSHLKLSNSKRGLREQVLLSNFMYAYLNLVNHTLYMEQVA 912
           ERAIYRLSHLKLS+  R LR+QVLLSNFMY+YLNLVNHTLYMEQV 
Sbjct: 868 ERAIYRLSHLKLSDPGRELRQQVLLSNFMYSYLNLVNHTLYMEQVG 913

>KLTH0C04048g Chr3 (352955..355762) [2808 bp, 935 aa] {ON} similar
           to uniprot|P54786 Saccharomyces cerevisiae YML109W ZDS2
           Protein that interacts with silencing proteins at the
           telomere involved in transcriptional silencing paralog
           of Zds1p
          Length = 935

 Score =  225 bits (574), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 202/628 (32%), Positives = 299/628 (47%), Gaps = 111/628 (17%)

Query: 24  DKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLVDPELDIKFGGESNGRRSWSGTA-- 81
           +KRKSEVLIAAQSLD+E++ VKNLKR+SIGSMD+L+DPE++ +     +     + T+  
Sbjct: 34  EKRKSEVLIAAQSLDSELQHVKNLKRISIGSMDMLIDPEMEFRVSPSPSQPAPTTDTSHD 93

Query: 82  ---YNSASTPGGTTRMNNTRYS-DPTPLENLHERGDLKLES-------SDKGRQSNYAGS 130
              YNS S       ++    S D T  E L E      ES       +D G+++     
Sbjct: 94  QQLYNSHSDHDSDDDLSYVNDSIDITSTEYLQESEGTGFESLGSSSNDADCGKRTLSGVR 153

Query: 131 KKGVHSTSRXXXXXXXXXXXX------WVPANQHPNVKPDNYLELVQDTLQNIQLXXXXX 184
           + G+   +R                  WVPANQHPN+KP+NYLELVQDTL  +++     
Sbjct: 154 RGGLSGKTRMNNNLSAKDEESVTHNLLWVPANQHPNIKPENYLELVQDTLHTLKI----- 208

Query: 185 XXXXXXXXXXXXXXKVYDNKENDTENLNRA-MSRHGTASLIRRPSTLRRSYTEFDD---- 239
                         K+       + NL  +   R G  SL+RRPS LR+S+TE +D    
Sbjct: 209 EPDNEGSVEGGNDEKIVHAPAAASANLPPSNQLRSGLNSLVRRPSGLRKSFTELEDLLLQ 268

Query: 240 ------SEDDNGDSKTVNKVEERTSRIKERPVSLRDITEELTKISNSAGLTDNDAITLAR 293
                   D+N +  + +K+     RI  R  SL+DITEELT+ISN AG TD DA++LAR
Sbjct: 269 EAQDTSGGDENAELPSADKMPSVRPRIGSRSSSLKDITEELTRISNRAGFTDGDAVSLAR 328

Query: 294 TLSMAGSYSDKKDEAEPSNQEGHHIEEDSNAMTSQAEPSDDGEYASNMPINNNMTWPERS 353
           TLSMA SY               + +ED  ++ S  E   + EYAS+M   N +  P RS
Sbjct: 329 TLSMASSY---------------YTDEDGESVGS-PEKKPEKEYASSMLTKNGLAIPARS 372

Query: 354 SLRRSRFNTYRIRXXXXXXXXXXXXXXXXXXXXXHHLPLANNTSKTAIDPHKSPFRQQAE 413
           SLRRS+FNTYRIR                        P A +     +D  +SP R   +
Sbjct: 373 SLRRSKFNTYRIRNTSGGSTAPSNLRS----------PSAEHNE---LD--RSPIRVDQK 417

Query: 414 EPESMSSPGSIGDFQDIYDHYRQSS-----GEW--EQEMGIEKEAEVVATKFEID----- 461
             + + SP S+ DF +IYDHYRQSS     G +  E +         +A+K   D     
Sbjct: 418 NAQ-LQSPTSVNDFNEIYDHYRQSSFDSSLGAYPHEHQNAHTSNFHSIASKRPKDDTLLD 476

Query: 462 -----------SLEQDLELREEPV--GVIKSSSTEENKETKRH------RRRNGWTWLNN 502
                      SL + L+  ++    G +++++ +E K+  +H      R+++GW+W   
Sbjct: 477 SESSLHDLHKGSLNKALDDEQQASFRGHVEATNNDE-KDDHKHASSQAPRKKSGWSWFGK 535

Query: 503 KMNRDDDN--EGNQRDDENEENMDSQR------MERENSKRH-HISLFNGSEKAEQSNKE 553
           K ++D ++  E  QR   +   + S         E+ N  RH H S+    + A  S + 
Sbjct: 536 KSSKDQESSPEHTQRVSSDFLGVSSSAKPTNVPTEKINHSRHRHYSI---DDTANSSTES 592

Query: 554 EANSASAPTTTSQTRQKIEKTFANLFRR 581
             ++  + + +   +Q+ EK F  LF+R
Sbjct: 593 TTSNTVSSSQSPTKKQRKEKKFIQLFKR 620

 Score =  179 bits (455), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 100/218 (45%), Positives = 142/218 (65%), Gaps = 12/218 (5%)

Query: 704 LPKLQPAVSVS--------STKSNSRDTGEE-EIKKRNEKRSNTIELSNEQHRKYVQKEK 754
           L KLQP+VS++          K    + GE+  +  +++ R++++  S+ +      +E 
Sbjct: 700 LAKLQPSVSLTPKSRPPLTQDKPKQNNVGEDLRLNNQDKHRADSVLDSDSEPELEADEEA 759

Query: 755 THEQKAPCRSPSQAPSQAPGQS-PSQAPIETSIETPIETPSETPSEAPAKTQAAPPLRHT 813
                A     +++ +QA   +  + AP ET+  +  +  S T S+ P   +   P    
Sbjct: 760 GPRTDAIHEGITESNTQAEADTVTAYAPEETAAASADD--SFTKSQEPNAPELQAPAAGG 817

Query: 814 SVLPPRKLTFADVKKPDKPNAPVQFTDSAFGFPLPLLTVSTVIMFDHRLPINVERAIYRL 873
            VLPPRKL F+DV KP++PNAP++F+DS+FGFPLP LTVSTV+M DHRLPINVERAIYRL
Sbjct: 818 YVLPPRKLAFSDVIKPERPNAPMKFSDSSFGFPLPPLTVSTVVMIDHRLPINVERAIYRL 877

Query: 874 SHLKLSNSKRGLREQVLLSNFMYAYLNLVNHTLYMEQV 911
           SHLKL + KR LR+QV+LSNFMYAYLNLVNH+LY++Q+
Sbjct: 878 SHLKLGDPKRELRQQVILSNFMYAYLNLVNHSLYLQQL 915

>Kpol_541.10 s541 complement(26683..29853) [3171 bp, 1056 aa] {ON}
           complement(26683..29853) [3171 nt, 1057 aa]
          Length = 1056

 Score =  222 bits (565), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 212/703 (30%), Positives = 303/703 (43%), Gaps = 178/703 (25%)

Query: 20  ASQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLVDPELDIKFGGESNGRRSWSG 79
            S  DKRKS VLIAA+SLD E++ +K+LKR SIGSMD+L+DPEL+ +             
Sbjct: 28  TSMDDKRKSAVLIAAKSLDRELKHIKDLKRFSIGSMDMLMDPELEYRVSN---------- 77

Query: 80  TAYNSASTPGGTTRMNNTRYSDPTPLENLHERGD--LKLES-----SDKGRQSNYAGSKK 132
              N  ST   + R + T  SD  PL+   +  D  L ++S     S   R SN +G++ 
Sbjct: 78  --INKQSTDTYSKRRSIT--SDLQPLDANDDFSDDPLGIKSTEFLPSSVIRSSNPSGNRS 133

Query: 133 GVH----------------STSRXXXXXXXXXXXXWVPANQHPNVKPDNYLELVQDTLQN 176
             +                S +             WVPA++HPNV PDNY++++Q++L N
Sbjct: 134 DKYTRRKLSGSRSLNTIPDSMAYNSKASTTKKNLLWVPADKHPNVMPDNYIQMIQNSLNN 193

Query: 177 IQLXXXXXXXXXXXXXXXXXXXKVYDNKENDTENLNRAMSRHGTASLIRRPSTLRRSYTE 236
           + L                    +Y+    D E L+ A  R    SL+RRPS LR+SYTE
Sbjct: 194 LSLESNEDVDKDSKVLPQENKENIYE----DRERLSVAYKRRN-RSLVRRPSQLRKSYTE 248

Query: 237 FDDSED--DNGDSKTVNKVEE--------------RTSRI---KERPVSLRDITEELTKI 277
           F++S+D  DN D   ++K  +              +TS+    K   +SL+DIT ELTKI
Sbjct: 249 FNNSDDEEDNTDENNLSKNNKDTNENSANTSMDSIKTSKSFDNKRYSISLKDITAELTKI 308

Query: 278 SNSAGLTDNDAITLARTLSMAGSYSDKKDEAEPSNQEGHHIEEDSNAMTSQAEPSDD--- 334
           SNS GL+D+DA++LAR+LS+ G Y D+              E D         PSD+   
Sbjct: 309 SNSVGLSDSDAVSLARSLSITGPYQDE-------------TESDGAGDIMLDNPSDEESL 355

Query: 335 -GEYASNMPINNNMTWPERSSLRRSRFNTYRIRXXXXXXXXXXXXXXXXXXXXXHHLPLA 393
             E+ SNM + N +  P RSSLRRS+F TYR R                          +
Sbjct: 356 NDEFVSNMVLRNGLMIPTRSSLRRSKFTTYRSRTSSSDSLSPKKQNFDDKQET------S 409

Query: 394 NNTSKTAIDPHKSPF----------RQQAEEPESMSSPGSIGDFQDIYDHYRQSSGEWEQ 443
            ++SK   +  K+PF           +  E+ ES+ +  +  DFQDIYDHYRQ S +W+ 
Sbjct: 410 VSSSKANENEIKNPFGKLPEVNLKAEESNEDDESLKTSPAASDFQDIYDHYRQPSSDWDM 469

Query: 444 EMGIEKEAEVVAT------------------------------KFEIDSLE-------QD 466
           E     +     +                               +EIDS E        +
Sbjct: 470 EFKKHDDTSFTDSSITNSYSYTSSVQKLDTEPSDEIEDQNNDFSYEIDSYEVPDSDKFDN 529

Query: 467 LELREEPVGVIKSSS---------------TEENKETKRHRRRNGWTWLNNKMNRDDDNE 511
           L+  E  +    S+S                +EN+  K H R+  W W + +    + +E
Sbjct: 530 LDGTENSLNNKSSTSINKEHIETSKPSELLAKENEPEKHHSRKAAWPWFSKR--HGESHE 587

Query: 512 GNQRDDENE------ENM---------------------DSQRMERENSKRHHISLFNGS 544
            N  + ENE      E M                     DS    R  SK  HI +F   
Sbjct: 588 KNHTEHENEPSKQSFEGMQSFVVNGNVQEADDAKKIGSRDSSNNRRRTSKNRHIQIFKPF 647

Query: 545 EKAEQSNKEEAN-SASAPTTTSQTRQKIEKTFANLFRRKPHHK 586
           E   QS  EE N S  +  +++  +QK EKTF +LF+RK   K
Sbjct: 648 ES--QSTGEEKNDSGESNQSSNNIKQKFEKTFGDLFKRKGSRK 688

 Score =  191 bits (486), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 84/97 (86%), Positives = 89/97 (91%)

Query: 814  SVLPPRKLTFADVKKPDKPNAPVQFTDSAFGFPLPLLTVSTVIMFDHRLPINVERAIYRL 873
            SVLPPRKL FADV K D PN P+QFTDSAFGFPLPLLT+STVIMFDHRLP+NVERAIYRL
Sbjct: 928  SVLPPRKLVFADVHKSDIPNGPIQFTDSAFGFPLPLLTISTVIMFDHRLPVNVERAIYRL 987

Query: 874  SHLKLSNSKRGLREQVLLSNFMYAYLNLVNHTLYMEQ 910
            SHLKLS  KR LR+QVLLSNFMYAYL+LVNHTLYMEQ
Sbjct: 988  SHLKLSEPKRALRDQVLLSNFMYAYLHLVNHTLYMEQ 1024

>Kwal_27.10318 s27 (284806..287583) [2778 bp, 925 aa] {ON} YMR273C
           (ZDS1) - peripheral plasma membrane protein [contig 36]
           FULL
          Length = 925

 Score =  220 bits (561), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 205/640 (32%), Positives = 289/640 (45%), Gaps = 108/640 (16%)

Query: 5   NNEGTLRTTSNSKVTASQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLVDPELD 64
           NN+   ++ S +   +++ +KRKSEVLIAAQSLD+E++ VKNLKR+S GSMDL +DPE++
Sbjct: 12  NNDMRDQSVSGNTRRSARSEKRKSEVLIAAQSLDSELQHVKNLKRMSFGSMDLPLDPEME 71

Query: 65  IKFGGESNGRRSWSGTAY---------------NSASTPGGTTRMNNTRYSDPTPLENLH 109
            +     + R S S                   ++ S    +  +    Y +  P + L 
Sbjct: 72  FRMSPSHSQRSSSSDAVSLESQAEEPNQDDDSDDNLSYLNDSIELTAHEYLE-EPRDFLV 130

Query: 110 ERGDL-KLESSDKGRQSNYAGSKKGVHSTS----RXXXXXXXXXXXXWVPANQHPNVKPD 164
           ER  + K E S  GR  N +G ++G  S                   WVPANQHPNVKP+
Sbjct: 131 ERSSVSKSEDSHNGR--NLSGVRRGGMSKKPRELSNGGDDNVTQNLFWVPANQHPNVKPE 188

Query: 165 NYLELVQDTLQNIQLXXXXXXXXXXXXXXXXXXXKVYDNKENDTENLNRAMSRHGTASLI 224
           NYLELVQDTL  + +                      + K + +  L     R G  SL+
Sbjct: 189 NYLELVQDTLHTLSIDSEVEPPTDKTVEGNNPYLASANTKASPSSQL-----RSGQNSLV 243

Query: 225 RRPSTLRRSYTEFDD---SEDDNGDSKTVNKVEERTSRIKERP------VSLRDITEELT 275
           RRPS LR+SYTE +D    E  + D    N   E  + IK RP       SL+DITEELT
Sbjct: 244 RRPSGLRKSYTELEDLLQHEIQDSDENNENAQSELNNIIKNRPRATSSGSSLKDITEELT 303

Query: 276 KISNSAGLTDNDAITLARTLSMAGSYSDKKDEAEPSNQEGHHIEEDSNAMTSQAEPSDDG 335
           +ISN AG TD DA+ LARTLSMA SY  ++ +A  S    H               + D 
Sbjct: 304 RISNKAGFTDGDAVCLARTLSMASSYDGEQSQANQSANTDH---------------TPDS 348

Query: 336 EYASNMPINNNMTWPERSSLRRSRFNTYRIRXXXXXXXXXXXXXXXXXXXXXHHLPLANN 395
           EYAS +   N +  P RSSLRRS+FNTYRIR                        P    
Sbjct: 349 EYASTILTKNGLAIPARSSLRRSKFNTYRIRTPNGSSVTSSSLRSTSLPNEERKDP---- 404

Query: 396 TSKTAIDPHKSPFRQQAEEPESMSSPGSIGDFQDIYDHYRQSS-GEWEQEMGIEKEAEVV 454
                            E+ + + SP S+ DF +IYDHYRQ S G   +   ++ +A   
Sbjct: 405 -------------EGYIEKSDRLRSPTSVNDFNEIYDHYRQGSVGSTSEPHAVDNDASSA 451

Query: 455 A--TKFEIDSLEQDLELREEPVGVIKSS-----------------STEENKE-----TKR 490
           +   K  +     +  L EE     K S                 S  +NKE     T+ 
Sbjct: 452 SPFNKSLVHPSHHETHLNEESESSSKHSTDKTLNYPLEKDGKGNNSKAKNKENKPSGTQI 511

Query: 491 HRRRNGWTWLNNKMNRD----DDNEGNQRDDENEENMDSQR----MERENSKRH-HISLF 541
            R+++ W W   K ++D    +D+E N   D    + +++      E+ N  RH H S+ 
Sbjct: 512 LRKKSSWNWFGKKTSKDQDIANDDEQNTFSDFLSVSGNAKTSYIPTEKVNHSRHRHYSID 571

Query: 542 NGSEKAEQSNKEEANSASAPTTTSQTRQKIEKTFANLFRR 581
           +GS  +  ++  +   +S+P      +QK EK F  LF+R
Sbjct: 572 SGSRGSIAADPSKLAVSSSP-----KKQKREKKFIQLFKR 606

 Score =  172 bits (436), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 90/100 (90%)

Query: 815 VLPPRKLTFADVKKPDKPNAPVQFTDSAFGFPLPLLTVSTVIMFDHRLPINVERAIYRLS 874
            LPPRKLTF+DV KP++PN+P++F+DS+FGFPLP LT+STV+M DHRL INVERAIYRLS
Sbjct: 810 TLPPRKLTFSDVVKPERPNSPMKFSDSSFGFPLPPLTISTVVMIDHRLTINVERAIYRLS 869

Query: 875 HLKLSNSKRGLREQVLLSNFMYAYLNLVNHTLYMEQVAHD 914
           HLKL + KR LR+QV+LSNFMYAYLNLVNH+LY++Q+  D
Sbjct: 870 HLKLGDPKRELRQQVVLSNFMYAYLNLVNHSLYLQQLEED 909

>CAGL0F03421g Chr6 complement(336157..338610) [2454 bp, 817 aa] {ON}
           similar to uniprot|P50111 Saccharomyces cerevisiae
           YMR273c ZDS1
          Length = 817

 Score =  214 bits (545), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 210/616 (34%), Positives = 289/616 (46%), Gaps = 151/616 (24%)

Query: 28  SEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLVDPELDIKFGGESNGRRSWSGTAYNSAST 87
           SEV IAAQSLD E+RSVKNLKRLSIGSMDLL+DPE+D+     +  R SWS         
Sbjct: 6   SEVYIAAQSLDKELRSVKNLKRLSIGSMDLLMDPEMDM-LPYNNGYRNSWS------TQL 58

Query: 88  PGGTTRMNNTRYSDPT---------------------------PLEN----------LHE 110
             G   + +TRYSDPT                            +EN          L  
Sbjct: 59  EQGDKPLKSTRYSDPTHYNSKIVRQERLPFKQNQPQKSDKEQTQVENTKKQPGSPKSLTR 118

Query: 111 RGDLKLESSDKGRQSNYAGSKKGVHSTSRXXXXXXXXXXXXWVPANQHPNVKPDNYLELV 170
           RG +   S     +SN++ +   ++ T              WV A+QHPNVKP+NY+ELV
Sbjct: 119 RGAVNFSSRRPVDRSNHSKNSSKINDT----LPDEVAQNLLWVRADQHPNVKPENYIELV 174

Query: 171 QDTLQNIQLXXXXXXXXXXXXXXXXXXXKVYDNKENDT-------ENLNRAMSRHGTASL 223
           QD L NIQ+                     +D + +DT        N N   S + T  L
Sbjct: 175 QDALHNIQIDKTEE----------------HDKENSDTLDKVSRYYNSNNKRSPNNTG-L 217

Query: 224 IRRPSTLRRSYTEFDDSEDDN--GDSKTVNKVEERTSRIKERPVSLRDITEELTKISNSA 281
           +RRPS LR+SYTEFD+ +D +    S T N V+   S    +  +L+DITEELT+ISN A
Sbjct: 218 VRRPSLLRKSYTEFDEVKDSDIKEQSSTNNNVD---STPHNKKFTLKDITEELTRISNKA 274

Query: 282 GLTDNDAITLARTLSMAG-SYSDKKDEAEPSNQEGHHIEEDSNAMTSQAEPSDDGEYASN 340
           GLT+NDA+TLARTLSMA  +  D+ D+     QE    E+D      Q+  +DD  YAS 
Sbjct: 275 GLTNNDAVTLARTLSMASVAEEDETDDL----QERPEAEDD---YARQSRNNDDN-YAST 326

Query: 341 MPI-NNNMTWPERSSLRRSRFNTYRIRXXXXXXXXXXXXXXXXXXXXXHHLPLANNTSKT 399
           M +  +++   E S+L+RS++ TY IR                                 
Sbjct: 327 MLLPTDSLIKSEHSTLKRSKY-TYHIRTQEDK---------------------------- 357

Query: 400 AIDPHKSPFRQQAEEPESM-SSPGSIGDFQDIYDHYRQSSGEWEQEMGIEKEAEVVA-TK 457
             DP   P   +++  + + +SPGSI    DIYDHYR+ SG+W   + +  E E    T 
Sbjct: 358 --DP-TIPVSTESQHQDVIEASPGSIN---DIYDHYREPSGDWSSLIQVAPENENKKRTD 411

Query: 458 FEIDSLEQDLELREEPV-----GVIKSSSTEENKETKRHR-RRNGWTW---LNNKMNRDD 508
            +IDS  + ++   E V     G   S  ++ NK+   HR +RNGW W    + K+N   
Sbjct: 412 TDIDSNTKIVQHSTEHVDLGSTGHSTSDKSDINKKEPAHRKKRNGWLWSSKTSEKVNVTS 471

Query: 509 DNEGNQRDDENEENMDSQRMERENSKRHHISLFNGSEKAEQSNKEEANSASAPTTTSQTR 568
           D        ENE+ +   R    +SK  H  L+N   K E +N           T  + +
Sbjct: 472 DKH------ENEDIVPESRF--NHSKNRHEPLYN--HKIEIAN--------TLGTLPEKK 513

Query: 569 QKIEKTFANLFRRKPH 584
             I+K  +N+FRRK H
Sbjct: 514 NAIDKKISNIFRRKHH 529

 Score =  193 bits (490), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 90/119 (75%), Positives = 99/119 (83%)

Query: 792 TPSETPSEAPAKTQAAPPLRHTSVLPPRKLTFADVKKPDKPNAPVQFTDSAFGFPLPLLT 851
           T + TPS+    T ++       + PPRKLTFADVKK DK NAP++FTDSAFGFPLP LT
Sbjct: 697 TVTATPSQREEATDSSKTASKKPLYPPRKLTFADVKKKDKANAPIEFTDSAFGFPLPELT 756

Query: 852 VSTVIMFDHRLPINVERAIYRLSHLKLSNSKRGLREQVLLSNFMYAYLNLVNHTLYMEQ 910
            STVIMFDHRLPI+VERAIYRLSHLKLSNSKR LREQVLLSNFMY+YLNLVNHTLYMEQ
Sbjct: 757 YSTVIMFDHRLPIHVERAIYRLSHLKLSNSKRALREQVLLSNFMYSYLNLVNHTLYMEQ 815

>KNAG0G03370 Chr7 complement(724041..727271) [3231 bp, 1076 aa] {ON}
            Anc_8.831 YMR273C
          Length = 1076

 Score =  208 bits (530), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 115/213 (53%), Positives = 139/213 (65%), Gaps = 36/213 (16%)

Query: 702  DNLPKLQPAVSVSSTKSNSRDTGE--EEIKKRNEKRSNTIELSNEQHRKYVQKEKTHEQK 759
            D LP LQPAVSV+S K N+RD G+  E +++ +   S  I   + Q++            
Sbjct: 848  DELPGLQPAVSVTSAK-NTRDNGDVVETVRELDGDDSQDISGGDIQYQ------------ 894

Query: 760  APCRSPSQAPSQAPGQSPSQAPIETSIETPIETPSETPSEAPAKTQAAPPLRHTSVLPPR 819
                             P   P++  + T  +T + T + A A           S LPPR
Sbjct: 895  ---------------MQPIDEPVDGEVATVDDTQTVTAAAASALPAV------ISTLPPR 933

Query: 820  KLTFADVKKPDKPNAPVQFTDSAFGFPLPLLTVSTVIMFDHRLPINVERAIYRLSHLKLS 879
            KLT+ADVK+P+KPNAP+QFTDSAFGFPLP+LTVSTVIMFDHRL INVERAIYRLSHLKLS
Sbjct: 934  KLTYADVKRPEKPNAPIQFTDSAFGFPLPMLTVSTVIMFDHRLGINVERAIYRLSHLKLS 993

Query: 880  NSKRGLREQVLLSNFMYAYLNLVNHTLYMEQVA 912
            +SKR LR+QVLLSNFMYAYLNLVNHTLYMEQV+
Sbjct: 994  DSKRELRQQVLLSNFMYAYLNLVNHTLYMEQVS 1026

 Score =  180 bits (457), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 130/324 (40%), Positives = 164/324 (50%), Gaps = 51/324 (15%)

Query: 152 WVPANQHPNVKPDNYLELVQDTLQNIQLXXXXXXXXXXXXXXXXXXXKVYDNKENDTENL 211
           WVPANQHPNVKP+NYLELV DTLQ I                           E+D EN 
Sbjct: 237 WVPANQHPNVKPENYLELVHDTLQTINGEGDGDGDGHTIDTSADTGTAADSVDESDKENN 296

Query: 212 N---RAMSRHGTAS-LIRRPSTLRRSYTEFDDSEDDNGDSKTVNKVEERTSRIKER---- 263
           N   R   R+G AS L+RRPS LRRSY E D+ ED N  +  ++ +EE    + ER    
Sbjct: 297 NTRLRVRYRNGKASSLVRRPSRLRRSYIETDEDEDSNTSNAKIDDIEEGGRSLDERKPTR 356

Query: 264 ------PVSLRDITEELTKISNSAGLTDNDAITLARTLSMAGSYSDKKDEA----EPSNQ 313
                  VSLRDITEELTK+SNS GLTD+DA+TLARTL+M  +Y+D   E        ++
Sbjct: 357 TNGDRKSVSLRDITEELTKMSNSVGLTDDDAVTLARTLNMTCTYTDTDSEGLDNLRTDSK 416

Query: 314 EGHHIEEDSN--AMTSQAEPSDDGEYASNMPINNNMTWPERSSLRRSRFNTYRIRXXXXX 371
           E    EE  N    T      D+ ++ASNM + N ++ P RSSLRRS+FNTYRIR     
Sbjct: 417 EQLRAEESENPPGTTHAKILPDENQFASNMFMKNGLSIPTRSSLRRSKFNTYRIRTTSAP 476

Query: 372 XXXXXXXXXXXXXXXXHHLPLANNT-----SKTAID-----PHKSPFRQQA-----EEPE 416
                              P  NN+     S   +D      H+SP   Q+     +E  
Sbjct: 477 TPLVEK-------------PKRNNSRHARLSFVHLDDEEFASHESPAALQSPTVNNDEAG 523

Query: 417 SMSSPGSIGDFQDIYDHYRQSSGE 440
            + SPGSI    D+YDHY  ++ E
Sbjct: 524 VIESPGSIS---DLYDHYTGTASE 544

 Score = 74.7 bits (182), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 35/51 (68%), Positives = 44/51 (86%)

Query: 17 KVTASQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLVDPELDIKF 67
          + T   R+KRKSEVLIAAQSLD E+++VK+LKRLSIGSMDLL+DPEL+ + 
Sbjct: 18 RATEMDRNKRKSEVLIAAQSLDVEVQNVKHLKRLSIGSMDLLIDPELEFRV 68

>NCAS0B01110 Chr2 complement(182537..185518) [2982 bp, 993 aa] {ON}
           Anc_8.831 YML109W
          Length = 993

 Score =  200 bits (508), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 89/99 (89%), Positives = 95/99 (95%)

Query: 815 VLPPRKLTFADVKKPDKPNAPVQFTDSAFGFPLPLLTVSTVIMFDHRLPINVERAIYRLS 874
           VLP RKLTFADVK+PD+PNAP+QFTDSAFGFPLP+LTVSTVIMFDHRL INVERAIYRLS
Sbjct: 849 VLPARKLTFADVKRPDRPNAPIQFTDSAFGFPLPMLTVSTVIMFDHRLGINVERAIYRLS 908

Query: 875 HLKLSNSKRGLREQVLLSNFMYAYLNLVNHTLYMEQVAH 913
           HLKLS+SKR LR+QVLLSNFMYAYLNLVNHTLYMEQVA 
Sbjct: 909 HLKLSDSKRELRQQVLLSNFMYAYLNLVNHTLYMEQVAQ 947

 Score =  184 bits (466), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 170/513 (33%), Positives = 226/513 (44%), Gaps = 129/513 (25%)

Query: 152 WVPANQHPNVKPDNYLELVQDTLQNIQLXXXXXXXXXXXXXXXXXXXKVYDNKENDTENL 211
           WVPANQHPNVKP+NYLELVQDTLQNI L                    +  +K N +E  
Sbjct: 202 WVPANQHPNVKPENYLELVQDTLQNIHLEEPASSLQHENEKSNNNKENIDISKSNMSEE- 260

Query: 212 NRAMSRHGTA-------------SLIRRPSTLRRSYTEFDDSEDDNGDSKTVNKVEERTS 258
              + RH  +             SL+RRPS LR SYTEF++ +  N +       E + S
Sbjct: 261 -EPIDRHPQSLDKTFLEITNRNRSLVRRPSRLRTSYTEFEEDDYSNSEESEAKTNESQLS 319

Query: 259 RIKERP-------------------VSLRDITEELTKISNSAGLTDNDAITLARTLSMAG 299
             +E+P                   VSL+DITEELT ISN AGLTD+DAITLARTLSMA 
Sbjct: 320 SREEKPFLFNDRNGLNQLRNFSQRSVSLKDITEELTNISNKAGLTDSDAITLARTLSMAS 379

Query: 300 SYSDKKDEAEPSNQEGHHIEEDSNAMTSQAEPSDDGEYASNMPINNNMTWPERSSLRRSR 359
           S+SD       S                Q E +++ E+ASNM + N +T PERSSLRRS+
Sbjct: 380 SFSDGNVNLGKSKL--------------QNESNEESEFASNMFMKNGLTIPERSSLRRSK 425

Query: 360 FNTYRIRXXXXXXXXXXXXXXXXXXXXXHHLPLANNTS-----KTAIDPHKSPF---RQQ 411
           FNTYRIR                        PL  ++S         D  +SP     + 
Sbjct: 426 FNTYRIRSTSSSTSTREKTS-----------PLLQSSSFARQEADTDDLQRSPVSFTNRD 474

Query: 412 AEEPESMSSPGSIGDFQDIYDHYRQSSGEWEQ--------------EMGIEKEAEVVATK 457
           +    + SSPGSI    D+YDHY Q + E +Q                 I +E+  ++ +
Sbjct: 475 SYLATTTSSPGSIS---DLYDHY-QDNAESKQGNDNDNEARQGDLSHASISQESSFLSNE 530

Query: 458 FEIDSLEQDLELREEPVG------------------------VIKSSSTEENKETKRHRR 493
              DS      +  +P+G                        V K + T  +    +H +
Sbjct: 531 SSNDS------ILVKPLGSKSMIHENLDNGQDHDDDQPAYQKVSKLNPTIPDTSRSKH-K 583

Query: 494 RNGWTWLNNKMNRDDDNE--GNQRDDENEENMDSQRMERENSKRHHISLFNGSEKAEQSN 551
           RNGW+W  N+ N ++D     N +D++     D      + SK  H  +   S    + N
Sbjct: 584 RNGWSWSGNRANSEEDATVLVNSQDEDQTGYTD------QKSKSRHRPILARSRDHLKIN 637

Query: 552 KEEANSASAPTTTSQTRQKIEKTFANLFRRKPH 584
           KE    A  P   S  R+ IEK F  LFRRK H
Sbjct: 638 KE----AELP-KESHKRETIEKRFVKLFRRKGH 665

 Score = 87.4 bits (215), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 59/80 (73%), Gaps = 2/80 (2%)

Query: 1  MSNRNNEGTLRTTSNSKVTASQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLVD 60
          M +  N   LR TS S  T  QRDKRKSEVLIAAQSLDNE++SVKNLKRLSIGSMDLL+D
Sbjct: 1  MEHNTNLLPLRKTSGSLQT--QRDKRKSEVLIAAQSLDNEVQSVKNLKRLSIGSMDLLID 58

Query: 61 PELDIKFGGESNGRRSWSGT 80
          PEL+ +   + + + +  G+
Sbjct: 59 PELEFRVNNDKSNQSTPIGS 78

>NDAI0E00350 Chr5 (54073..57564) [3492 bp, 1163 aa] {ON} Anc_8.831
            YML109W
          Length = 1163

 Score =  199 bits (505), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 103/123 (83%), Gaps = 3/123 (2%)

Query: 790  IETPSETPSEAPAKTQAAPPLRHTSVLPPRKLTFADVKKPDKPNAPVQFTDSAFGFPLPL 849
            IE   +T S   + TQ   PL     LPPRKLTF DVK+P++PNAPV+FTDSAFGFPLP 
Sbjct: 1002 IEAEDQTQSFNDSATQ---PLSQQHGLPPRKLTFDDVKRPERPNAPVEFTDSAFGFPLPA 1058

Query: 850  LTVSTVIMFDHRLPINVERAIYRLSHLKLSNSKRGLREQVLLSNFMYAYLNLVNHTLYME 909
            LTVSTVIMFDHRL INVERAIYRLSHLKLS+SKR LREQVLLSNFMYAYLNLVNHTLYME
Sbjct: 1059 LTVSTVIMFDHRLGINVERAIYRLSHLKLSDSKRELREQVLLSNFMYAYLNLVNHTLYME 1118

Query: 910  QVA 912
            QVA
Sbjct: 1119 QVA 1121

 Score =  172 bits (435), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 133/342 (38%), Positives = 162/342 (47%), Gaps = 74/342 (21%)

Query: 152 WVPANQHPNVKPDNYLELVQDTLQNIQLXXXXXXXXXXXXXXXXXXXKVYDNKENDTENL 211
           WVPANQHPN+KP++YLELVQDTL NI L                    +    E + ENL
Sbjct: 270 WVPANQHPNIKPESYLELVQDTLHNIHLDDDNHNNDDAKVSTDDDLYSMDGTDETNKENL 329

Query: 212 N--------RAMSRHGTASLIRRPSTLRRSYTEFD-----DSEDDNGDSK---------- 248
           N         +  R    SL+RRPS LR+SYTEF+     D ED+  D +          
Sbjct: 330 NIDYLTKPSTSELRRKNKSLVRRPSGLRKSYTEFEEFNTSDEEDETSDCEEEQQLSTDNS 389

Query: 249 -------------------TVNKVEERTSRIKERPVSLRDITEELTKISNSAGLTDNDAI 289
                               + K   R+SR     VSL+DITEELTKISN+AGLTD+DAI
Sbjct: 390 TNNANHHQDIIINNKTPEIIIPKGNTRSSRF----VSLKDITEELTKISNNAGLTDSDAI 445

Query: 290 TLARTLSMAGSYSDKKDEAEPSNQEGHHIEEDSNAMTSQAEPSDDGEYASNMPINNNMTW 349
           TLARTLSMAGS+ D  +    S+       E+ N  T    P DD EYASNM + N +T 
Sbjct: 446 TLARTLSMAGSFQDNSNNNHNSDNF----NEEQNGNT----PEDD-EYASNMFMKNGLTI 496

Query: 350 PERSSLRRSRFNTYRIRXXXXXXXXXXXXXXXXXXXXXHHLPLANNTSKTAIDPHK---- 405
           P RSSLRRSRFNTYRIR                            N +KT  +P +    
Sbjct: 497 PTRSSLRRSRFNTYRIRSGSSSTSAQSSSSSRTTSGSQ-----MTNNNKTVTEPGRGNQP 551

Query: 406 -----SPFRQQAEEPESMS--SPGSIGDFQDIYDHYRQSSGE 440
                +P          MS  SPGSI    D+YDHY+ S  +
Sbjct: 552 EDHNNTPASHYTARLSYMSTTSPGSIS---DLYDHYQNSDSD 590

 Score = 72.8 bits (177), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 31/51 (60%), Positives = 46/51 (90%)

Query: 16 SKVTASQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLVDPELDIK 66
          + +  ++++KRKS++ IAA+SLDNE++SV+NLKRLSIGSMDLL+DPEL+ +
Sbjct: 28 ASIQQARKEKRKSDMFIAAKSLDNELQSVQNLKRLSIGSMDLLIDPELEFR 78

 Score = 34.3 bits (77), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 23/92 (25%), Positives = 43/92 (46%), Gaps = 11/92 (11%)

Query: 493 RRNGWTWLNNKMNRDDDNEGNQRDDENEENMDSQRMERENSKRHHISLFNGSEKAEQSNK 552
           +RNGW W + K   + + E +Q +               N+K  H+  F+ S   +  + 
Sbjct: 722 KRNGWHWSSQKNPIESNTELSQAN-----------QTTTNNKSRHLQFFSHSADLKDEST 770

Query: 553 EEANSASAPTTTSQTRQKIEKTFANLFRRKPH 584
             + + +  +T +Q ++  +K FA LF+RK H
Sbjct: 771 NSSTTDTDTSTLAQKKETFDKKFAKLFKRKSH 802

>ZYRO0G13992g Chr7 complement(1112324..1115959) [3636 bp, 1211 aa]
            {ON} similar to uniprot|P54786 Saccharomyces cerevisiae
            YML109W ZDS2 Protein that interacts with silencing
            proteins at the telomere involved in transcriptional
            silencing paralog of Zds1p
          Length = 1211

 Score =  194 bits (492), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 85/103 (82%), Positives = 96/103 (93%)

Query: 816  LPPRKLTFADVKKPDKPNAPVQFTDSAFGFPLPLLTVSTVIMFDHRLPINVERAIYRLSH 875
            LP RKLTF+DVK+ D+PNAP+QFTDSAFGFPLP+LTVSTV+MFDHRLPINVERAIYRLSH
Sbjct: 1070 LPARKLTFSDVKRLDRPNAPMQFTDSAFGFPLPMLTVSTVVMFDHRLPINVERAIYRLSH 1129

Query: 876  LKLSNSKRGLREQVLLSNFMYAYLNLVNHTLYMEQVAHDKEQQ 918
            LKLS+ KR LR+QV+LSNFMYAYLNLVNHTLYMEQVA +  Q+
Sbjct: 1130 LKLSDPKRELRQQVMLSNFMYAYLNLVNHTLYMEQVAQEGGQE 1172

 Score =  181 bits (459), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 109/231 (47%), Positives = 140/231 (60%), Gaps = 23/231 (9%)

Query: 152 WVPANQHPNVKPDNYLELVQDTLQNIQLXXXXXXXXXXXXXXXXXXXKVYDNKENDTENL 211
           WVPANQHPNVKP+NYLELVQDTL NI+L                   +   NKEN+    
Sbjct: 241 WVPANQHPNVKPENYLELVQDTLHNIRLEGNEDEQTGNDMNTTTAKVEHGTNKENE---- 296

Query: 212 NRAMSRHGTASLIRRPSTLRRSYTEFDDSEDDNGDSKTVNK------VEERT-----SRI 260
           ++        SL+R+PS LR+SYTEFD+  DD  D+   +K      VE+ +     S  
Sbjct: 297 DKGYLPRKNNSLVRKPSRLRKSYTEFDEENDDYLDTSGFSKKRSSEDVEDASNLTISSTN 356

Query: 261 KERPVSLRDITEELTKISNSAGLTDNDAITLARTLSMAGSYSDKKDEAEPSNQEGHHIEE 320
             R VSLRDIT+ELTKISN+AGLTD+DAITLARTLSMAGS++  + +    N  G   ++
Sbjct: 357 SSRAVSLRDITDELTKISNNAGLTDSDAITLARTLSMAGSFTSDEPDDIIENSRGTQGDD 416

Query: 321 -----DSNAMTSQAEPSDDGEYASNMPINNNMTWPERSSLRRSRFNTYRIR 366
                +++AM  +    DD E+ASNM + N    P RSSLRRS+FNTYR+R
Sbjct: 417 LQYYNEADAMEKK---EDDAEFASNMFMKNGFVIPARSSLRRSKFNTYRVR 464

 Score = 81.6 bits (200), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 37/61 (60%), Positives = 51/61 (83%), Gaps = 3/61 (4%)

Query: 21  SQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLVDPELDIKF---GGESNGRRSW 77
           + ++KRKSEV+IAAQSLDNE++SVKNLKR+SIGSMD+L+DPEL+ +     G+   R+SW
Sbjct: 53  TMKEKRKSEVMIAAQSLDNEVQSVKNLKRISIGSMDMLLDPELEYRVSSNAGKQENRKSW 112

Query: 78  S 78
           +
Sbjct: 113 T 113

 Score = 56.2 bits (134), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 35/46 (76%)

Query: 405 KSPFRQQAEEPESMSSPGSIGDFQDIYDHYRQSSGEWEQEMGIEKE 450
           KSP +   E+  +++SP +I DFQDIYDHYRQSS +WE+E+  E++
Sbjct: 557 KSPSQFIGEDGSNLTSPSTISDFQDIYDHYRQSSVDWEKELKKERD 602

>Kpol_1069.2 s1069 (1560..4565) [3006 bp, 1001 aa] {ON} (1560..4565)
           [3006 nt, 1002 aa]
          Length = 1001

 Score =  189 bits (480), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 84/105 (80%), Positives = 95/105 (90%), Gaps = 4/105 (3%)

Query: 807 APPLRHTSVLPPRKLTFADVKKPDKPNAPVQFTDSAFGFPLPLLTVSTVIMFDHRLPINV 866
           APP    ++LPPRKLTF DV++ D+PN  + FTDSAFGFPLPLLTVSTVIMFDHRLP+NV
Sbjct: 851 APP----TILPPRKLTFEDVERLDRPNGSMVFTDSAFGFPLPLLTVSTVIMFDHRLPVNV 906

Query: 867 ERAIYRLSHLKLSNSKRGLREQVLLSNFMYAYLNLVNHTLYMEQV 911
           ERAIYRLSHLKLS+S+R LREQVLLSNFMYAYL+LVNH+LYMEQV
Sbjct: 907 ERAIYRLSHLKLSDSRRSLREQVLLSNFMYAYLHLVNHSLYMEQV 951

 Score =  129 bits (324), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 85/219 (38%), Positives = 124/219 (56%), Gaps = 27/219 (12%)

Query: 152 WVPANQHPNVKPDNYLELVQDTLQNIQLXXXXXXXXXXXXXXXXXXXKVYDNKENDTENL 211
           WVPANQHP+VKP N++ELV DTLQN+ L                     +          
Sbjct: 203 WVPANQHPSVKPQNFVELVHDTLQNMSLDDVQTNESESKNEVSKDLLNTF---------- 252

Query: 212 NRAMSRHGTASLIRRPSTLRRSYTEFDDSEDD----NGDSKTVNKVEERTSRIKERPVSL 267
           +R M+     SL+RRPS LR+SYTEF++  ++       S  +N+  ++  + K R VSL
Sbjct: 253 SRDMNMRN-KSLVRRPSRLRKSYTEFEEETEEEVKPTTSSNNINESNKKNVQGK-RAVSL 310

Query: 268 RDITEELTKISNSAGLTDNDAITLARTLSMAGSYSDKKDEAEPSNQEGHHIEEDSNAMTS 327
           +DI +ELT ISN+ GL+++DAI+LAR+LS+AGS     +E           EE+   + +
Sbjct: 311 KDIADELTVISNNVGLSNSDAISLARSLSIAGSIGSTSEE-----------EEEDKVLNT 359

Query: 328 QAEPSDDGEYASNMPINNNMTWPERSSLRRSRFNTYRIR 366
            +    +  +ASN+   N ++ P RSSLRRS+FNTY+IR
Sbjct: 360 SSIGQSEEVFASNILAKNGISIPARSSLRRSKFNTYKIR 398

 Score = 77.8 bits (190), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 51/61 (83%), Gaps = 4/61 (6%)

Query: 5  NNEGTL-RTTSNSKVTASQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLVDPEL 63
          N+ GT+ +T +  K+   QRDKRKS VLIAAQSLD E+++VKNLKRLSIGSMDLL+DPEL
Sbjct: 4  NSGGTMEKTRAEEKI---QRDKRKSAVLIAAQSLDQEVQNVKNLKRLSIGSMDLLIDPEL 60

Query: 64 D 64
          +
Sbjct: 61 E 61

>KLLA0D01683g Chr4 complement(148855..151689) [2835 bp, 944 aa] {ON}
           some similarities with uniprot|P54786 Saccharomyces
           cerevisiae YML109W ZDS2 Protein that interacts with
           silencing proteins at the telomere involved in
           transcriptional silencing paralog of Zds1p and with
           YMR273C uniprot|P50111 Saccharomyces cerevisiae YMR273C
           ZDS1 Protein that interacts with silencing proteins at
           the telomere, involved in transcriptional silencing;
           also has a role in localization of Bcy1p, which is a
           regulatory subunit of protein kinase A; paralog of Zds2p
          Length = 944

 Score =  186 bits (472), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 80/96 (83%), Positives = 92/96 (95%)

Query: 816 LPPRKLTFADVKKPDKPNAPVQFTDSAFGFPLPLLTVSTVIMFDHRLPINVERAIYRLSH 875
           LPPRKLTFADV KPD+PN+P++FTDSAFGFPLP LT+STVIMFDHRLPI+VERAIYRLSH
Sbjct: 824 LPPRKLTFADVLKPDRPNSPMKFTDSAFGFPLPPLTISTVIMFDHRLPIHVERAIYRLSH 883

Query: 876 LKLSNSKRGLREQVLLSNFMYAYLNLVNHTLYMEQV 911
           LKLS+ KR LR+QVLLSNFMYAYLNLVNH+LY++Q+
Sbjct: 884 LKLSDPKRVLRQQVLLSNFMYAYLNLVNHSLYLQQI 919

 Score =  135 bits (339), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 92/217 (42%), Positives = 116/217 (53%), Gaps = 33/217 (15%)

Query: 152 WVPANQHPNVKPDNYLELVQDTLQNIQLXXXXXXXXXXXXXXXXXXXKVYDNKENDTENL 211
           WV A+QHPNVKP+NYLELVQ+TL+N+ L                    +           
Sbjct: 194 WVRADQHPNVKPENYLELVQNTLENMNLGGRSPTANETQAQSLSGLKTL----------- 242

Query: 212 NRAMSRHGTASLIRRPSTLRRSYTEFDDSEDDNG--DSKTVNKVEERTSRIKERPVSLRD 269
            R  S     SL RRPS LR SYTE  + ++D G  D          +SR   R VSL+D
Sbjct: 243 -RKRSMQSGNSLARRPSRLRTSYTELSEDDEDKGMTDQPLAAAAPTMSSR---RTVSLKD 298

Query: 270 ITEELTKISNSAGLTDNDAITLARTLSMAGSYSDKKDEAEPSNQEGHHIEEDSNAMTSQA 329
           ITEELTK+SN AGLTD DA+TLARTL +A       DE+  ++  G  +   SN +  + 
Sbjct: 299 ITEELTKLSNQAGLTDTDAVTLARTLWVA-------DES-TTDSTGQGL---SNNLADEE 347

Query: 330 EPSDDGEYASNMPINNNMTWPERSSLRRSRFNTYRIR 366
           E     E+AS M   +  T P R SLRRS+FNTYRI+
Sbjct: 348 E-----EFASTMFTKSGFTVPARHSLRRSKFNTYRIQ 379

 Score = 80.5 bits (197), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 48/61 (78%), Gaps = 5/61 (8%)

Query: 21 SQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLVDPELDIKFGGESNGRRSWSGT 80
          S+RDKRKSEVLIAAQSLD E++ VKNLKRLSIGSMDLL+DPEL+ +        R  +GT
Sbjct: 4  SKRDKRKSEVLIAAQSLDQEVKHVKNLKRLSIGSMDLLMDPELEYRVSS-----RQGTGT 58

Query: 81 A 81
          A
Sbjct: 59 A 59

>KAFR0B03860 Chr2 complement(798642..801173) [2532 bp, 843 aa] {ON}
           Anc_8.831 YMR273C
          Length = 843

 Score =  183 bits (464), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 82/100 (82%), Positives = 90/100 (90%)

Query: 811 RHTSVLPPRKLTFADVKKPDKPNAPVQFTDSAFGFPLPLLTVSTVIMFDHRLPINVERAI 870
           +H S+LPPRKLTF DVKKP+K N P+Q+TDSAFGFPLPLLTVSTVIM+D RL  NVERAI
Sbjct: 711 QHKSILPPRKLTFDDVKKPEKVNGPMQYTDSAFGFPLPLLTVSTVIMYDCRLATNVERAI 770

Query: 871 YRLSHLKLSNSKRGLREQVLLSNFMYAYLNLVNHTLYMEQ 910
           YRLSHLKL N KR LREQVL+SNFMYAYLNLVNHTL+MEQ
Sbjct: 771 YRLSHLKLGNRKRPLREQVLVSNFMYAYLNLVNHTLFMEQ 810

 Score =  112 bits (279), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 104/362 (28%), Positives = 163/362 (45%), Gaps = 64/362 (17%)

Query: 22  QRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLVDPELDIKFGGESNGRRSWSGTA 81
           Q+++R S + +AAQSL +E+++V +LKRLS+GS+D+L D   D++F      R   +   
Sbjct: 7   QKEQRNSRIYLAAQSLGHEVQNVNHLKRLSVGSIDMLTDT--DVEFSFNKLQRNISAKKT 64

Query: 82  YNSASTPGGTTRMNNTRYSDPTPLENLHERGDLKLESSDKGRQSNYA------------- 128
               S    +T   +  Y+  T LE  +   D + ES    R ++ +             
Sbjct: 65  QEILSQKRTSTETESVSYN--TLLEGFYGSDDAEDESEKTTRNTSISETRDKSPSVPARA 122

Query: 129 -GSKKGVHSTS--------RXXXXXXXXXXXXWVPANQHPNVKPDNYLELVQDTLQNIQL 179
            G K G  S S        +            WV A+ HPNVKP+NY+ELVQDTL+    
Sbjct: 123 RGRKVGAVSRSSRTANLGKKGGYDKEISKGLLWVSADVHPNVKPENYIELVQDTLEQYN- 181

Query: 180 XXXXXXXXXXXXXXXXXXXKVYDNKENDTENLNRAMSRHGTASLIRRPSTLRRSY--TEF 237
                               + +    D + L  A     + SL+R+PS LR+SY   E 
Sbjct: 182 ---------------SSDYSISERLPEDKQVLLSAFRAKKSHSLVRKPSKLRKSYISIES 226

Query: 238 DDSEDDNGDSKTVNKVEERTSRIKERPVSLRDITEELTKISNSAGLTDNDAITLARTLSM 297
           +++  +N D+    K    +       +SL++++EEL KIS+SAGLT +DAITLA TL +
Sbjct: 227 NNTPAENNDANAHRKPLGSSRDPVVSTISLKELSEELAKISSSAGLTKDDAITLATTLWL 286

Query: 298 AGSYSDKKDEAEPSNQEGHHIEEDSNAMTSQAEPSDDG---EYASNMPINNNMTWPERSS 354
                             H +    N  T ++    DG    +A++   +  +  P+RS 
Sbjct: 287 T-----------------HSLLHSDNVTTIKSSQDIDGYINSFATSFSRSGPLEIPKRSV 329

Query: 355 LR 356
           LR
Sbjct: 330 LR 331

>SAKL0D01716g Chr4 (135836..138664) [2829 bp, 942 aa] {ON} similar
           to uniprot|P54786 Saccharomyces cerevisiae YML109W ZDS2
           Protein that interacts with silencing proteins at the
           telomere involved in transcriptional silencing paralog
           of Zds1p
          Length = 942

 Score =  183 bits (465), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 81/96 (84%), Positives = 90/96 (93%)

Query: 816 LPPRKLTFADVKKPDKPNAPVQFTDSAFGFPLPLLTVSTVIMFDHRLPINVERAIYRLSH 875
           LPPRKL F DVK+P+ PNAP++FTDSAFGFPLP LTVSTVIMFDHRLPINVERAIYRLSH
Sbjct: 808 LPPRKLVFEDVKRPEYPNAPMKFTDSAFGFPLPPLTVSTVIMFDHRLPINVERAIYRLSH 867

Query: 876 LKLSNSKRGLREQVLLSNFMYAYLNLVNHTLYMEQV 911
           LKLS+ KR LR+QVLLSNFMYAYLNLVNH+LY++QV
Sbjct: 868 LKLSDPKRELRQQVLLSNFMYAYLNLVNHSLYLQQV 903

 Score =  181 bits (458), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 135/385 (35%), Positives = 192/385 (49%), Gaps = 74/385 (19%)

Query: 152 WVPANQHPNVKPDNYLELVQDTLQNIQLXXXXXXXXXXXXXXXXXXXKVYDNKENDTE-- 209
           WVPANQHP+VKP+NYLELVQDTLQN+QL                       NKEN  +  
Sbjct: 205 WVPANQHPSVKPENYLELVQDTLQNLQLENGVRDES---------------NKENTVKLI 249

Query: 210 -----NLNRAMSRHGTASLIRRPSTLRRSYTEFDDSEDDNGDSKTVNKVEERTSRIKERP 264
                N+++   + G  SL+RRPS LR+SYTEF+D+E+ N      +     +     R 
Sbjct: 250 HGLNSNVSQLPIQQGKNSLVRRPSRLRKSYTEFEDTEEYNLPISGNSSSLPSSVPTP-RS 308

Query: 265 VSLRDITEELTKISNSAGLTDNDAITLARTLSMAGSYSDKKDEAEPSNQEGHHIEEDSNA 324
           VSLR+IT+ELTK+SN+AGLTD+DAITLARTLSMA ++            EG + E+++ +
Sbjct: 309 VSLREITDELTKVSNNAGLTDSDAITLARTLSMASTF-----------YEGSNSEKENQS 357

Query: 325 MTSQAEPSDDGEYASNMPINNNMTWPERSSLRRSRFNTYRIRXXXXXXXXXXXXXXXXXX 384
            T +AE   + E+ASNM   N++  P RSSLRRS+FNTYRIR                  
Sbjct: 358 NTEKAE---EDEFASNMLNQNSLAIPARSSLRRSKFNTYRIRTPSGSSTNEFAQSNLKVS 414

Query: 385 XXXHHLPLANNTSKTAIDPHKSPFRQQAEEPESMSSPGSIGDFQDIYDHYRQSSGE---- 440
               +        +  I+        +  E   ++SP +I D QDIYDHY  SS E    
Sbjct: 415 STEEN-------PQPEIEVAVEETLPRVLEEHILNSPSTINDMQDIYDHYDTSSVEESLP 467

Query: 441 -------WEQEMGIEKEAE---------------VVATKFEIDSLEQDLELREEPVGVIK 478
                    Q+ G   +                 ++ +K  I   + D  +++E +  + 
Sbjct: 468 PQNSNYSSAQQDGDNLQDSPDSSDFSTDSSTANAILKSKQSIVQTKSD-SIQKEFLSPVT 526

Query: 479 SSSTEENKETKRHRRRNGWTWLNNK 503
            S+T    + KR +++ GW+W N K
Sbjct: 527 ESTT---ADVKRQKKKGGWSWFNKK 548

 Score = 75.5 bits (184), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 44/47 (93%)

Query: 21 SQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLVDPELDIKF 67
          + ++KRKSEVLIAAQSLDNE+++VKNLKRLSIGSMDLL+DPE++ + 
Sbjct: 31 TSKEKRKSEVLIAAQSLDNELQNVKNLKRLSIGSMDLLMDPEMEFRI 77

>AAL185W Chr1 (9537..12593) [3057 bp, 1018 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YML109W (ZDS2) and YMR273C
            (ZDS1)
          Length = 1018

 Score =  182 bits (463), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 106/226 (46%), Positives = 141/226 (62%), Gaps = 10/226 (4%)

Query: 703  NLPKLQPAVSVSSTKSNSRDTGEEE-----IKKRNEKRSNTIELSNEQ--HRKYVQKEKT 755
            ++  LQPAVSV+S++ +   T ++      + K +   SN + +S+++    K  + + +
Sbjct: 777  SITSLQPAVSVTSSRDSHEQTRQDPQPQSLVTKMDGSSSNGVTVSSQRAGFSKKGRSKTS 836

Query: 756  HEQKAPCRSPSQAPSQAPGQSPSQAPIETSIETPIETPSETPSEAPAKTQAAPP-LRHTS 814
            H +     S   AP         Q   E +           PS  P K+   P  + H+ 
Sbjct: 837  HSRSKLSTSHDIAPVDNRPSDVDQKSTEANNTLSSRAEDSHPSLDPGKSALGPGEIAHS- 895

Query: 815  VLPPRKLTFADVKKPDKPNAPVQFTDSAFGFPLPLLTVSTVIMFDHRLPINVERAIYRLS 874
             LPPRKL F DV +P+KPN+P++FT SAFGFPLP LTVSTVIMFDHRLPI VERAIYRLS
Sbjct: 896  -LPPRKLRFDDVLRPEKPNSPMKFTPSAFGFPLPPLTVSTVIMFDHRLPIYVERAIYRLS 954

Query: 875  HLKLSNSKRGLREQVLLSNFMYAYLNLVNHTLYMEQVAHDKEQQNQ 920
            HLKLS+ KR LR+QVLLSNFMY+YLNLVNH+LY++Q+  DK Q  Q
Sbjct: 955  HLKLSDPKRELRQQVLLSNFMYSYLNLVNHSLYLQQIEEDKNQGIQ 1000

 Score =  176 bits (446), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 140/391 (35%), Positives = 190/391 (48%), Gaps = 82/391 (20%)

Query: 19  TASQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLVDPELDIKFGG--------- 69
           T   ++KRKSEVLIAAQSLD E+++VKNLKR+SIGSMDLL+DPE++ +  G         
Sbjct: 66  TRQAKEKRKSEVLIAAQSLDYELQNVKNLKRISIGSMDLLMDPEMEFRMNGAAVSPSASP 125

Query: 70  ------------------ESNGRRSWSGTAYNSASTPGGTTRMNN----TRYSDPTPLEN 107
                             E  G       + ++ S+ GG++        T  S   P E 
Sbjct: 126 RNSLTEESLEWFQLSAEQEQGGELPLHAESIDAHSSAGGSSDTARDELLTSASSVVPSEE 185

Query: 108 LHERGDLKLESSDKGRQSNYAGSKKGVHST----SRXXXXXXXXXXXXWVPANQHPNVKP 163
           L     L   ++ K      + SK G   T    ++            WV A+QHPNVKP
Sbjct: 186 LSCSHPLSPPAAAKKSTLMSSRSKLGRQHTDTTHTKQATGEPFSSNLLWVRADQHPNVKP 245

Query: 164 DNYLELVQDTLQNIQLXXXXXXXXXXXXXXXXXXXKVYDNKENDTENLNRAMSRHGTASL 223
           +NYLELV DTL N+++                        ++++T   N   S     SL
Sbjct: 246 ENYLELVHDTLNNLRIGARHGRGDSPV-------------QQSNTPVANGESSTASARSL 292

Query: 224 IRRPSTLRRSYTEFDDSE-----DDNGDSKTVNKVEERTSRIKERPVSLRDITEELTKIS 278
           +R+ S LR+S+TE +  E     D  G    V K        + R  SL++ITEELT+IS
Sbjct: 293 VRKQSRLRKSFTEVEAIEESQFTDSIGSEIPVGK--------RMRVSSLKEITEELTRIS 344

Query: 279 NSAGLTDNDAITLARTLSMAGSYSDKKDEAEPSNQEGHHIEEDSNAMTSQAEPS---DDG 335
           N+AGLTD+DAITLARTL + GS S                  D +A  S+  PS   ++ 
Sbjct: 345 NNAGLTDSDAITLARTLGI-GSQS-----------------ADEHATFSECVPSAEAEEN 386

Query: 336 EYASNMPINNNMTWPERSSLRRSRFNTYRIR 366
           EYAS++   N +  P RSSLRRS+F TYRIR
Sbjct: 387 EYASSILAKNGLAIPARSSLRRSKFTTYRIR 417

>TPHA0I00200 Chr9 complement(34713..37862) [3150 bp, 1049 aa] {ON}
           Anc_8.831 YMR273C
          Length = 1049

 Score =  179 bits (453), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 79/106 (74%), Positives = 91/106 (85%)

Query: 814 SVLPPRKLTFADVKKPDKPNAPVQFTDSAFGFPLPLLTVSTVIMFDHRLPINVERAIYRL 873
           S LP RKLTF DV KP++PN P++FTDSAFGFPLP LT STVIMFDHRLP+NVERAIYRL
Sbjct: 883 SSLPARKLTFKDVVKPERPNGPMEFTDSAFGFPLPKLTTSTVIMFDHRLPVNVERAIYRL 942

Query: 874 SHLKLSNSKRGLREQVLLSNFMYAYLNLVNHTLYMEQVAHDKEQQN 919
           SHLKLS+ KR LREQ+LLSNFMYAYL+LVNH+LY+EQ     ++ N
Sbjct: 943 SHLKLSDPKRELREQILLSNFMYAYLHLVNHSLYIEQAEQQAKESN 988

 Score =  140 bits (352), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 97/236 (41%), Positives = 137/236 (58%), Gaps = 26/236 (11%)

Query: 152 WVPANQHPNVKPDNYLELVQDTLQNIQLXXXXXXXXXXXXXXXXXXXKVYDNKENDTENL 211
           WVPAN+HP VKP+NY+EL+QDTLQNI L                    V D +      +
Sbjct: 210 WVPANKHPGVKPENYVELLQDTLQNINLNLNETQNNVEDTSNKTSDKMVMDREVIRRRRI 269

Query: 212 NRAMSRHGTASLIRRPSTLRRSYTE----FDDSEDD----NGDSK-------------TV 250
           ++ ++R+  +SL+RRP+ LR SY+E    F D+ +     N D +             T+
Sbjct: 270 SQDLNRNH-SSLVRRPTGLRISYSESVEEFHDALESENSLNSDKEREPSLSQNSISMITI 328

Query: 251 NKVEERTSRIKERPVSLRDITEELTKISNSAGLTDNDAITLARTLSMAGSYSDKKDEAEP 310
           +   + T ++ +   SL+DITEELTKISN AGL+++DAI+LAR+LS+AGS S K D +  
Sbjct: 329 DLQNKSTYQMGKNYASLKDITEELTKISNKAGLSNSDAISLARSLSIAGSVS-KTDNSVS 387

Query: 311 SNQEGHHIEEDSNAMTSQAEPSDDGEYASNMPINNNMTWPERSSLRRSRFNTYRIR 366
            N +      D N   S +E S+ G YASN+ + N +T P R SLRRS+FNTY+IR
Sbjct: 388 DNLQSATQGNDDNKPRS-SEVSEAG-YASNILVRNGITMPTR-SLRRSKFNTYKIR 440

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 31/45 (68%), Positives = 38/45 (84%)

Query: 24 DKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLVDPELDIKFG 68
          +KRKS VLIAAQSLD E+++VK LKRLS+GSMDLL+DPE +   G
Sbjct: 15 EKRKSAVLIAAQSLDLEVQNVKKLKRLSVGSMDLLLDPEFEYTMG 59

>Smik_13.25 Chr13 (47889..50738) [2850 bp, 949 aa] {ON} YML109W
           (REAL)
          Length = 949

 Score =  175 bits (444), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 80/104 (76%), Positives = 88/104 (84%)

Query: 809 PLRHTSVLPPRKLTFADVKKPDKPNAPVQFTDSAFGFPLPLLTVSTVIMFDHRLPINVER 868
           P   T  L PRKLTF DV KP  PNAP++FTDSAFGFPLP++T STVIMFDHRL INVER
Sbjct: 817 PETQTPNLIPRKLTFGDVVKPKYPNAPIKFTDSAFGFPLPMITNSTVIMFDHRLGINVER 876

Query: 869 AIYRLSHLKLSNSKRGLREQVLLSNFMYAYLNLVNHTLYMEQVA 912
           AIYRLSHLKLS+  R LR+QVLLSNFMY+YLNLVNHTLYMEQ+ 
Sbjct: 877 AIYRLSHLKLSDPGRELRQQVLLSNFMYSYLNLVNHTLYMEQMG 920

 Score = 70.1 bits (170), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 32/44 (72%), Positives = 40/44 (90%)

Query: 24 DKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLVDPELDIKF 67
          +KRKS+V IAA+SLD EI++VKNLKRLSIGSMDL++DPEL+ K 
Sbjct: 47 EKRKSDVFIAAKSLDTEIQNVKNLKRLSIGSMDLVIDPELEFKV 90

>Suva_13.35 Chr13 (51377..54325) [2949 bp, 982 aa] {ON} YML109W
           (REAL)
          Length = 982

 Score =  175 bits (443), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 77/99 (77%), Positives = 88/99 (88%)

Query: 814 SVLPPRKLTFADVKKPDKPNAPVQFTDSAFGFPLPLLTVSTVIMFDHRLPINVERAIYRL 873
           S+L P+KLTF DV  P+ PNAP++FTDSAFGFPLP++T STVIMFDHRL INVERAIYRL
Sbjct: 855 SILLPKKLTFEDVITPEYPNAPIKFTDSAFGFPLPMITNSTVIMFDHRLGINVERAIYRL 914

Query: 874 SHLKLSNSKRGLREQVLLSNFMYAYLNLVNHTLYMEQVA 912
           SHLKLS+  R LR+QVLLSNFMY+YLNLVNHTLYMEQ+ 
Sbjct: 915 SHLKLSDPGRELRQQVLLSNFMYSYLNLVNHTLYMEQIG 953

 Score =  172 bits (437), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 135/384 (35%), Positives = 194/384 (50%), Gaps = 93/384 (24%)

Query: 152 WVPANQHPNVKPDNYLELVQDTLQNIQLXXXXXXXXXXXXXXXXXXXKVYDNKENDTENL 211
           WVPA+QHPNVKP+NYLELVQDTLQNIQ+                      D K +D  N 
Sbjct: 251 WVPASQHPNVKPENYLELVQDTLQNIQITTDQDP----------------DEKNSDLSNN 294

Query: 212 NRAMSRHGTASLIRRPSTLRRSYTEFDDSEDDNGDSKTVN--KVEERTSRIKE---RPVS 266
           +   +R  + S++RRPS L+ SYT+FDD E  + D +     + E+R S ++    R VS
Sbjct: 295 HVFSNRQRSGSIVRRPSHLKTSYTKFDD-EPSSVDRQRQGHGQAEKRISSLETKSIRCVS 353

Query: 267 LRDITEELTKISNSAGLTDNDAITLARTLSMAGSYSDKKDEAEPSNQEGHHIEEDSNAMT 326
           L++ITEELTKIS++AGLTD+DAITLAR+LSM+GS+++          E  H+        
Sbjct: 354 LKEITEELTKISDNAGLTDSDAITLARSLSMSGSFTN----------ESLHL-------- 395

Query: 327 SQAEPSDDGEYASNMPINNNMTWPERSSLRRSRFNTYRIRXXXXXXXXXXXXXXXXXXXX 386
           S  +   D E+ASNM   + +T PERS LRRS+FNTY+IR                    
Sbjct: 396 SSNKTDSDNEFASNMFNKSGLTIPERS-LRRSKFNTYKIRLENNDL-------------- 440

Query: 387 XHHLPLANNTSKTAIDPHKSPFRQQAEEPESMSSP----GSIGDFQDIYDHYRQSSGEWE 442
              LP     S   +  +    R++A  P S + P      + DFQ+I++HYR++S +W 
Sbjct: 441 ---LPTGRPNSLMNVQTNDD--RRRASSPASYTQPPQDQTPLNDFQEIFEHYRRTSTDW- 494

Query: 443 QEMGIEKEAEVVATKFEID-------SLEQD------------LELREEPVGVIKSS--- 480
              G E    V  T +  D       S+ QD            + ++    G + S    
Sbjct: 495 ---GTENTKYVDNTNYYSDEEDLTHASISQDSSFLSTDSSNNSVLVKPHNAGSMISERLD 551

Query: 481 ---STEENKETKRHRRRNGWTWLN 501
              ++ EN++   +   +GW+WLN
Sbjct: 552 QDIASNENEDIDINEPNHGWSWLN 575

 Score = 70.9 bits (172), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 40/44 (90%)

Query: 24 DKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLVDPELDIKF 67
          +KRKS+VLIAA+SLD EI+ VKNLKRLSIGSMDL++DPEL+ K 
Sbjct: 51 EKRKSDVLIAAKSLDTEIQHVKNLKRLSIGSMDLVIDPELEFKV 94

>Skud_13.32 Chr13 (51228..54074) [2847 bp, 948 aa] {ON} YML109W
           (REAL)
          Length = 948

 Score =  172 bits (436), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 87/104 (83%)

Query: 809 PLRHTSVLPPRKLTFADVKKPDKPNAPVQFTDSAFGFPLPLLTVSTVIMFDHRLPINVER 868
           P    S L PRKL F DV KP+ PNAP++FTDSAFGFPLP++  STVIMFDHRL INVER
Sbjct: 816 PAPQISTLLPRKLIFEDVIKPEYPNAPIKFTDSAFGFPLPMIANSTVIMFDHRLNINVER 875

Query: 869 AIYRLSHLKLSNSKRGLREQVLLSNFMYAYLNLVNHTLYMEQVA 912
           AIYRLSHLKLS+  R LR+QVLLSNFMY+YLNLVNHTLYMEQ+ 
Sbjct: 876 AIYRLSHLKLSDPGRELRQQVLLSNFMYSYLNLVNHTLYMEQMG 919

 Score =  171 bits (432), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 117/301 (38%), Positives = 155/301 (51%), Gaps = 61/301 (20%)

Query: 152 WVPANQHPNVKPDNYLELVQDTLQNIQLXXXXXXXXXXXXXXXXXXXKVYDNKENDTENL 211
           WVPANQHPNVKP+NYLEL+QDTLQNIQ+                     +D  + +  N 
Sbjct: 217 WVPANQHPNVKPENYLELIQDTLQNIQISVDQE----------------FDESKLELGNN 260

Query: 212 NRAMSRHGTASLIRRPSTLRRSYTEFDDSEDDNGDSKTVNKVEER---TSRIKE-RPVSL 267
           +   +R  + S++R PS L+ SY++FDD     G  +   +  ER   +S  K  R VSL
Sbjct: 261 HAFPNRQRSGSIVRNPSRLKTSYSKFDDEPSLAGQPQQEQEQVERRIPSSEFKSMRSVSL 320

Query: 268 RDITEELTKISNSAGLTDNDAITLARTLSMAGSYSDKKDEAEPSNQEGHHIEEDSNAMTS 327
           ++ITEELTKISN+AGLTD+DA+TLAR+LSM+GS++                    N   S
Sbjct: 321 KEITEELTKISNNAGLTDSDAVTLARSLSMSGSFT------------------SGNLHLS 362

Query: 328 QAEPSDDGEYASNMPINNNMTWPERSSLRRSRFNTYRIRXXXXXXXXXXXXXXXXXXXXX 387
                +D E+ASNM        PERSSLRRS+FNTY+IR                     
Sbjct: 363 NNNAENDNEFASNMFNEIGGGIPERSSLRRSKFNTYKIRLEGSGLSQASR---------- 412

Query: 388 HHLPLANNTSKTAIDPHKSPFRQQAEEPESMS----SPGSIGDFQDIYDHYRQSSGEWEQ 443
                 N+     I    S  R+ A  P S +      GS+ DFQ+I+DHYR++S EW  
Sbjct: 413 -----PNSLMSIQI----SEGRRSASLPASYAQLPQQQGSLNDFQEIFDHYRKTSTEWGT 463

Query: 444 E 444
           E
Sbjct: 464 E 464

 Score = 71.6 bits (174), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 47/61 (77%), Gaps = 2/61 (3%)

Query: 7  EGTLRTTSNSKVTASQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLVDPELDIK 66
          +G +R T  SK      +KRKS+VLIAA+SLD EI++VKNLKRLSIGSMDL+ DPEL+ K
Sbjct: 36 QGRMRKTQLSK--KELFEKRKSDVLIAAKSLDTEIQNVKNLKRLSIGSMDLVFDPELEFK 93

Query: 67 F 67
           
Sbjct: 94 L 94

>Ecym_2710 Chr2 (1373818..1376508) [2691 bp, 896 aa] {ON} similar to
           Ashbya gossypii AAL185W
          Length = 896

 Score =  172 bits (435), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 75/101 (74%), Positives = 90/101 (89%)

Query: 815 VLPPRKLTFADVKKPDKPNAPVQFTDSAFGFPLPLLTVSTVIMFDHRLPINVERAIYRLS 874
            LPPR+LTF DV +P+KPN+P++FT SAFGFPLP LT+STVIMFDHRLPI  ERAIYRLS
Sbjct: 790 ALPPRELTFDDVIRPEKPNSPMKFTPSAFGFPLPPLTISTVIMFDHRLPIYAERAIYRLS 849

Query: 875 HLKLSNSKRGLREQVLLSNFMYAYLNLVNHTLYMEQVAHDK 915
           HLKLS+ KR LR+QVLLSNFMY+YLNLVNH+LY++Q+  +K
Sbjct: 850 HLKLSDPKRELRQQVLLSNFMYSYLNLVNHSLYLQQIEEEK 890

 Score =  135 bits (339), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 119/414 (28%), Positives = 182/414 (43%), Gaps = 70/414 (16%)

Query: 152 WVPANQHPNVKPDNYLELVQDTLQNIQLXXXXXXXXXXXXXXXXXXXKVYDNKENDTENL 211
           WVPA+QHPNVK +NYLELV DTL N+QL                     Y   + ++ + 
Sbjct: 131 WVPADQHPNVKLENYLELVTDTLHNLQLVGREQLEKNPNSN--------YQLSQTNSTSA 182

Query: 212 NRAMSRHGTASLIRRPSTLRRSYTEFDDSEDDNGDSKTVNKVEERTSRIKERPVSLRDIT 271
           + A+      SL+R+PS LR+S+TE ++ +D N D       E   S+ ++R  SL++IT
Sbjct: 183 HEAIPSKN--SLVRKPSRLRKSFTEAENIDDPNSDEDL--NTETPISK-RKRVSSLKEIT 237

Query: 272 EELTKISNSAGLTDNDAITLARTLSMAG-SYSDKKDEAEPSNQEGHHIEEDSNAMTSQAE 330
           EELT+ISN+AGLTD+DAITLARTL +   + +D+++           I+E          
Sbjct: 238 EELTRISNNAGLTDSDAITLARTLGIGTPAATDRRNFTNTDVASNDEIDE---------- 287

Query: 331 PSDDGEYASNMPINNNMTWPERSSLRRSRFNTYRIRXXXXXXXXXXXXXXXXXXXXXHHL 390
                EYASN+   N ++  + SSLRRS+F TYRIR                     +  
Sbjct: 288 -----EYASNILTKNGLSISQGSSLRRSKFATYRIRSPSGDSLPLLESGSLLPSLPEYAQ 342

Query: 391 PLANNTSKTAIDPHKSPFRQQAEEPESMSSPGSIGDFQDIYDHY---------------- 434
               N  K   D H     Q  +  ++  +P S     DIYDHY                
Sbjct: 343 EQVANHLK---DAHVFKEGQPPQSWDASITPQSPNSINDIYDHYNTTDTDEYVSDDLTSP 399

Query: 435 --------------RQSSGEWEQE-MGIEKEAEVVATKFEIDSLEQDLELREEPVGVIKS 479
                         + S G  +++   I       ++   ID+      + + P+  I +
Sbjct: 400 STQMSGASYTVSPAQVSCGHSKKDTYAISSSTTSPSSNPPIDATSTSSLISKSPIRTIPA 459

Query: 480 SSTEENKETKRHRRRNGWTWLNNKMNRDDDNEGNQRDDENEENMDSQRMERENS 533
           +   ++    R +++ GW W NNK    +        D ++ N D  + E+ NS
Sbjct: 460 NLPAKDSTKSREKKKPGWNWFNNKRTPSE-------TDNSDSNSDQLQFEKGNS 506

>TBLA0B03200 Chr2 complement(743165..746425) [3261 bp, 1086 aa] {ON}
            Anc_8.831 YMR273C
          Length = 1086

 Score =  170 bits (431), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 79/104 (75%), Positives = 88/104 (84%), Gaps = 2/104 (1%)

Query: 818  PRKLTFADVKKPDKPNAPVQFTDSAFGFPLPLLTVSTVIMFDHRLPINVERAIYRLSHLK 877
            P KL+F+DVK+ DKPN  + FTDSAFGFPLPLLT STVIMFD+RLPI+VERAIYRLSHLK
Sbjct: 968  PHKLSFSDVKRLDKPNGTMIFTDSAFGFPLPLLTNSTVIMFDYRLPISVERAIYRLSHLK 1027

Query: 878  LSNSKRGLREQVLLSNFMYAYLNLVNHTLYMEQVA--HDKEQQN 919
            LS  KR LR+QVLLSNFMYAYL+LVNHTLYME+ A  HD    N
Sbjct: 1028 LSEPKRTLRQQVLLSNFMYAYLHLVNHTLYMEKYAKSHDMNSHN 1071

 Score =  155 bits (392), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 134/377 (35%), Positives = 181/377 (48%), Gaps = 63/377 (16%)

Query: 26  RKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLVDPELDIKFGGESNGRRSWSGTAYN-S 84
           R+ E+LIAAQ+LD E++SVK LKR SIGS DL+ DPEL+ +     N   +   +    S
Sbjct: 36  REDELLIAAQTLDFEVQSVKELKRFSIGSNDLVGDPELEFRVNTNVNDLSTNDVSLVKRS 95

Query: 85  ASTPGGTT---RMNNTRYSDPTPLENLHERGDLKLESSDKGRQSNYAGS--KKGVHSTSR 139
           AS   G+T   R  NT             RG    + S  GR S    S  K+  H T  
Sbjct: 96  ASLSRGSTISKRTANTSL----------RRGQSTSKVSYNGRISYNKSSMPKQHTHQTLD 145

Query: 140 XXXXXXX---XXXXXWVPANQHPNVKPDNYLELVQDTLQNIQLXXXXXXXXXXXXXXXXX 196
                          WVPA+QHPN KP N   + QD+L N  L                 
Sbjct: 146 DDIDNENVPISKNLLWVPASQHPNAKPKN---INQDSLLNNGLVQDSNSD---------- 192

Query: 197 XXKVYDNKENDTENLNRAMSRHGTASLIRRPSTLRRSYTEFDDSEDDNGDSKTVN----- 251
                D +E    N +   SR    SL+R+PSTLR+SYT+F D + D   S+  N     
Sbjct: 193 ----LDTQEELQRNKSYLNSRRKNNSLVRKPSTLRKSYTDFTDDDSDYNRSREANTSNNS 248

Query: 252 -----------KVEERTSRIKERPVSLRDITEELTKISNSAGLTDNDAITLARTLSMAGS 300
                      K     S   +   SL DI EEL+KISNSAGLT+ +A TLAR+LS+ G 
Sbjct: 249 RNTSDNEMNNLKASHGNSPSADSTFSLNDIKEELSKISNSAGLTETNAATLARSLSITGK 308

Query: 301 YSDKK-----DEAEPSNQEGHHIE-----EDSNAMTSQAEPSD-DGEYASNMPINNNMTW 349
           Y +++     DEA  S+      +     ED + +    + ++ DGE+AS++ +  N+  
Sbjct: 309 YINRELLEEDDEASTSDDNNDANDINTSIEDKSTLKQIPDLNEVDGEFASHILLTKNVNV 368

Query: 350 PERSSLRRSRFNTYRIR 366
           P RSSLRR +FNTYR+R
Sbjct: 369 PVRSSLRRKKFNTYRVR 385

 Score = 32.0 bits (71), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 27/114 (23%), Positives = 48/114 (42%), Gaps = 36/114 (31%)

Query: 426 DFQDIYDHYRQSSGEWEQEMGIEKEAE-------VVATKFEIDSLEQDLE---------- 468
           D QDIY+HYRQ S + E+ +   K  +        V T F   S  Q+            
Sbjct: 505 DIQDIYNHYRQPSSDDEEILKYLKSKDNEETTHKEVETDFSHSSGSQESINISSSPSPET 564

Query: 469 ----------------LREEPVGVIKS--SSTEENKETKRHR-RRNGWTWLNNK 503
                           +    +  +KS  S+ +   +++RH+ +R+GW+W++N+
Sbjct: 565 IVTVPDNSIAGLNTNAISNSNISTLKSTISNIDSKLQSRRHKHKRHGWSWVSNQ 618

>CAGL0J06688g Chr10 complement(640041..642527) [2487 bp, 828 aa]
           {ON} similar to uniprot|P54786 Saccharomyces cerevisiae
           YML109w ZDS2 or uniprot|P50111 Saccharomyces cerevisiae
           YMR273c ZDS1
          Length = 828

 Score =  167 bits (424), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 76/102 (74%), Positives = 87/102 (85%)

Query: 815 VLPPRKLTFADVKKPDKPNAPVQFTDSAFGFPLPLLTVSTVIMFDHRLPINVERAIYRLS 874
           V  P+KLTF DVKKP++ NAP++FTDSAFGFPLP LT+STVIM DHRL INVERAIYRLS
Sbjct: 693 VGKPKKLTFDDVKKPERANAPMEFTDSAFGFPLPPLTISTVIMCDHRLGINVERAIYRLS 752

Query: 875 HLKLSNSKRGLREQVLLSNFMYAYLNLVNHTLYMEQVAHDKE 916
           HLKLS + R LR+QVLLSNFMYAYLNLV HTL +E+   DK+
Sbjct: 753 HLKLSETNRELRQQVLLSNFMYAYLNLVEHTLSVEEAEQDKQ 794

 Score =  163 bits (412), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 130/376 (34%), Positives = 185/376 (49%), Gaps = 53/376 (14%)

Query: 24  DKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLVDPELDIKFGGESNGRRSWSGTAYN 83
           D   SE L AAQSLD E+++VKNLKRLSIGS+DL+ DPEL++   G      S+     N
Sbjct: 17  DGVSSEYLRAAQSLDQEVQNVKNLKRLSIGSIDLITDPELNVTVTGTEREDTSYDADLSN 76

Query: 84  SASTPGGTT--------------RMNNTRYSDPTPLENLHERGDLKLESSDKGRQSN--- 126
            + T    T               ++ TR    T  +N  E  +   +   + R  N   
Sbjct: 77  GSFTEEDDTTTEIDGSDADETSASIDRTRVEYLTSYDNTQESSNESPKGVARTRSLNLNY 136

Query: 127 YAGSKKGVHSTSRX--------------XXXXXXXXXXXWVPANQHPNVKPDNYLELVQD 172
           +A S   +    R                          WVPANQHPNVKP+NYLELV++
Sbjct: 137 HANSNSDISIKERTLRGSRSLSNLKKPKNEEQSVSDKLFWVPANQHPNVKPENYLELVKE 196

Query: 173 TLQNIQLXXXXXXXXXXXXXXXXXXXKVYDNKENDTENLNRAMSRHGTASLIRRPSTLRR 232
           TL  I+                    +   NKEN  EN           S++RRPS LR+
Sbjct: 197 TLNKIR-----DINTDGKEKSENNSEEEVSNKENINEN------GRLRGSIVRRPSKLRK 245

Query: 233 SYTEFDDSEDDNGDSKTV--NKVEERTSRIKERPVSLRDITEELTKISNSAGLTDNDAIT 290
           SYTEF  SED     K +  N++    +    + +SL++IT EL K SN AGLTD++A+T
Sbjct: 246 SYTEFS-SEDLELLDKALSNNRIISTRNTTNSKRLSLKEITNELVKHSNKAGLTDDNAVT 304

Query: 291 LARTLSMAGSYSDKKDEAEPSNQEGHHIEEDSNAMTSQAEPSDDGEYASNMPINNNMTWP 350
           LARTLS+A S +++       N+ G + ++ +     Q+E +DD  +A+ +  N++    
Sbjct: 305 LARTLSIASSVTNQ-------NETGRN-DQSNTEQQKQSEDADDDTFATAVVGNSHSLAS 356

Query: 351 ERSSLRRSRFNTYRIR 366
             SSLRRS+FNTYR++
Sbjct: 357 NTSSLRRSKFNTYRVK 372

>TPHA0C04720 Chr3 complement(1017585..1020803) [3219 bp, 1072 aa] {ON}
            Anc_8.831 YMR273C
          Length = 1072

 Score =  166 bits (421), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 78/122 (63%), Positives = 92/122 (75%)

Query: 791  ETPSETPSEAPAKTQAAPPLRHTSVLPPRKLTFADVKKPDKPNAPVQFTDSAFGFPLPLL 850
            +TP  +     A T    P   TS LP RKLTFADV    + N PVQF DS FGFPLPLL
Sbjct: 913  KTPKRSSRGQQASTNGNGPAPVTSTLPLRKLTFADVPPTGRANGPVQFMDSTFGFPLPLL 972

Query: 851  TVSTVIMFDHRLPINVERAIYRLSHLKLSNSKRGLREQVLLSNFMYAYLNLVNHTLYMEQ 910
            T ST+IMF++RLPI+VERAIYRLSHLKL ++K+ LR+QVLLSNFMYAYL+LVNH+LY+EQ
Sbjct: 973  TRSTIIMFENRLPISVERAIYRLSHLKLGDTKKELRQQVLLSNFMYAYLHLVNHSLYLEQ 1032

Query: 911  VA 912
              
Sbjct: 1033 YG 1034

 Score =  123 bits (309), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 146/502 (29%), Positives = 207/502 (41%), Gaps = 118/502 (23%)

Query: 26  RKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLVDPELDIKFGG------ESNGRRSWSG 79
           R   +L A Q LD EI++V +LKR SIGSMD+L+DPEL+ +         ES   +  S 
Sbjct: 14  RNPAMLKAVQYLDREIKNVNHLKRFSIGSMDMLIDPELEYRISNTVTKDIESEKPKRRSV 73

Query: 80  TAYNS-ASTPGGTTRMNNTRYSDPTPLENLHERGDLKLESSDKGRQSN-----YAGSKKG 133
              N+ AS+    T+ ++   +      N+    DL   S  + R S      ++  K+ 
Sbjct: 74  LLLNTFASSDDVPTKAHSKAPNIGIMQSNIDYSNDLVNMSIQRRRSSTRQFPTFSKYKES 133

Query: 134 VHSTSRXXXXXXXXXXXXWVPANQHPNVKPDNYLELVQDTLQNIQLXXXXXXXXXXXXXX 193
           V                 WV A+QHPNV P   L  V   L+N+ +              
Sbjct: 134 V--PVYNEEKVDSTNAVKWVRADQHPNVSPSKQLNEV---LENLHI-------------- 174

Query: 194 XXXXXKVYDNKENDTENLNRAMSRHGTASLIRRPSTLRRSYTE--FDDSEDDNGDSK--- 248
                   ++K+   ++      +   +S++RRPS LR S  +  FD   +D   +K   
Sbjct: 175 --------EDKQVTKKDRLSITYKKNKSSIVRRPSKLRHSSNDESFDSDIEDPSFTKDHD 226

Query: 249 -----------TVNKVEERTSRIKERP-----------VSLRDITEELTKISNSAGLTDN 286
                      T ++ +   +R   R            +SL++IT+ELT+ISN AGL D+
Sbjct: 227 TFSFENESSFSTNDQTDISITRFDSRDTINSNGNSNHRLSLKNITDELTRISNDAGLVDS 286

Query: 287 DAITLARTLSMAGSYS-------DKKDEA-------EPSNQEGHHIEEDSNAMTSQAEPS 332
           DAI LA++L +  SY        D K+ A       E SN E     E    +   +E S
Sbjct: 287 DAINLAQSLGLTSSYQNNINDFYDDKNLAIYDSTINESSNMET--FNEQDKILNLNSENS 344

Query: 333 DDGEYASNMPINNNMTWPERSSLRRSRFNTYRI-RXXXXXXXXXXXXXXXXXXXXXHHL- 390
             G +A      N M  P RSSLRRS+FNTYR  R                      H+ 
Sbjct: 345 KGGTFAV-----NGMKVPMRSSLRRSKFNTYRYSRNNQKDSDIPEKKEIENPYMGSQHIS 399

Query: 391 ----------------------PLANNTSKTAIDPHKS----PFRQQAEEPE-SMSSPGS 423
                                 P  NN   +  D  K     P  ++A+  E S SSP  
Sbjct: 400 EEKSDVTEIQVALSNNQNALVSPERNNDKISFKDSQKDYLTKPIEEKADADEQSGSSP-- 457

Query: 424 IGDFQDIYDHYRQSSGEWEQEM 445
           + DFQDIYDHYRQ S EWE E+
Sbjct: 458 VSDFQDIYDHYRQPSSEWEDEI 479

 Score = 32.0 bits (71), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 10/15 (66%), Positives = 10/15 (66%)

Query: 489 KRHRRRNGWTWLNNK 503
           K H RR GW W NNK
Sbjct: 611 KHHYRRGGWAWFNNK 625

>TBLA0D03190 Chr4 complement(776722..781770) [5049 bp, 1682 aa] {ON}
            Anc_8.831 YMR273C
          Length = 1682

 Score =  154 bits (390), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 71/94 (75%), Positives = 82/94 (87%)

Query: 820  KLTFADVKKPDKPNAPVQFTDSAFGFPLPLLTVSTVIMFDHRLPINVERAIYRLSHLKLS 879
            KLTFADVK+  +PN+ + F +SAFGFPLP LT ST+IM D+RLPINVERAIYRLSHLKLS
Sbjct: 1430 KLTFADVKRNLQPNSSMIFQESAFGFPLPPLTNSTIIMIDNRLPINVERAIYRLSHLKLS 1489

Query: 880  NSKRGLREQVLLSNFMYAYLNLVNHTLYMEQVAH 913
            + KR LREQVLLSNFMY+YL+LVNHTLY+EQV  
Sbjct: 1490 DPKRELREQVLLSNFMYSYLHLVNHTLYLEQVTQ 1523

 Score =  100 bits (248), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 90/356 (25%), Positives = 152/356 (42%), Gaps = 63/356 (17%)

Query: 152 WVPANQHPNVKPDNYLELVQDTLQ---NIQLXXXXXXXXXXXXXXXXXXXKVYDNKENDT 208
           W   N+  ++KPDNY+ELV D +    N+ +                    + D+++   
Sbjct: 370 WSSVNKRSSLKPDNYIELVNDAINSSNNVSVTTNSTPTANKIEQGDSYYDNIPDSRK--- 426

Query: 209 ENLNRAMSRHGTASLIRRPSTLRRSYTEFD----DSEDDNGDSKTVNKVEER-------- 256
                   ++   S +RRPS+LR SYT+ D    D ED+   S   N ++E         
Sbjct: 427 -------VKYRRNSNVRRPSSLRNSYTDLDFNLADYEDNLNISNVSNSIDEVSNNDHQLT 479

Query: 257 -----------TSRIKERPVSLRDITEELTKISNSAGLTDNDAITLARTLSMAGSYSDKK 305
                      T+      ++L+D+T+ELTK+SN+AGLTD+DAITLA+TLS+     D  
Sbjct: 480 PDDSFNFDANVTNNSVASNLTLKDLTDELTKLSNNAGLTDSDAITLAKTLSLNERLLDNT 539

Query: 306 DEAEPSNQEGHHIEEDSNAMTSQAEPS-------------DDGEYASNMPINNNMTWPER 352
                +     +     N        +             DD EYASN+  ++N+    R
Sbjct: 540 TTVNSNTNVKRYKSNKINLFNEDNINNIPNNMNQDEEIVEDDKEYASNLNYDDNINISNR 599

Query: 353 SSLRRSRFNTYRIRXXXXXXXXXXXXXXXXXXXXXHHLPLANNTSKTAIDPHKSPFRQQA 412
           S+L+R++F +   R                     +++P     SK+ ID + S    ++
Sbjct: 600 STLKRNKFKSATSRGNSSEESNLQLDLETIKRDPSNNMPNI-IISKSTIDVNDSIDNAES 658

Query: 413 EEPESMSSPGSIGD-------FQDIYDHYRQSSGEWEQEMGIEKEAEVVATKFEID 461
              + + S   + +         +IYDHYRQ+SG+W  ++   +E      +F++D
Sbjct: 659 NNKKFLDSNEMLNNQLNVSPSASEIYDHYRQTSGDWTDDLNKARE------QFQVD 708

 Score = 57.4 bits (137), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/55 (52%), Positives = 42/55 (76%)

Query: 11 RTTSNSKVTASQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLVDPELDI 65
          R+ S ++ +   R KR S+V IAAQSLD ++++VK LKR SIGS+DLL DP+L++
Sbjct: 20 RSKSQNRKSLLDRQKRNSDVRIAAQSLDLQVQNVKKLKRQSIGSIDLLADPDLEL 74

>Skud_14.8 Chr14 (9768..9905,9909..9914,9918..9926,9930..9998) [222
           bp, 74 aa] {ON} YMR273C (REAL)
          Length = 74

 Score = 78.6 bits (192), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 48/79 (60%), Positives = 54/79 (68%), Gaps = 11/79 (13%)

Query: 225 RRPSTLRRSYTEFDDSEDDNG----DSKTVNKVEERTSRIKERPV--SLRDITEELTKIS 278
           RR STLR SYTEFDD ED+NG    DSK VNKVEERTSRI+E     +L++      KIS
Sbjct: 1   RRSSTLRSSYTEFDDIEDENGQRNKDSKFVNKVEERTSRIRENECHETLKN-----KKIS 55

Query: 279 NSAGLTDNDAITLARTLSM 297
           NSA LTD   I L RTLS+
Sbjct: 56  NSASLTDIGVIALVRTLSI 74

>Kwal_47.17362 s47 complement(370637..370966) [330 bp, 109 aa] {OFF}
           [contig 209] FULL
          Length = 109

 Score = 37.0 bits (84), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 34/52 (65%), Gaps = 4/52 (7%)

Query: 759 KAPCRSPSQAPSQAPGQ----SPSQAPIETSIETPIETPSETPSEAPAKTQA 806
           K+P RSP++ P+++P +    SP + PI + IE+PIE P E P+  P + +A
Sbjct: 45  KSPNRSPNKNPARSPARCSVRSPVRCPIRSPIESPIENPVENPTNQPTQQRA 96

>TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]
           {ON} Anc_3.92 YDR490C
          Length = 1347

 Score = 38.9 bits (89), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 24/40 (60%)

Query: 763 RSPSQAPSQAPGQSPSQAPIETSIETPIETPSETPSEAPA 802
           R  S + S  P QSP Q+PI + I TP  TPS TPS  P+
Sbjct: 596 RKVSSSNSITPLQSPLQSPINSPIPTPSHTPSHTPSHTPS 635

>Kpol_1032.63 s1032 complement(145306..147774) [2469 bp, 822 aa]
           {ON} complement(145306..147774) [2469 nt, 823 aa]
          Length = 822

 Score = 38.9 bits (89), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 20/85 (23%), Positives = 46/85 (54%)

Query: 752 KEKTHEQKAPCRSPSQAPSQAPGQSPSQAPIETSIETPIETPSETPSEAPAKTQAAPPLR 811
           K +TH    P +S  Q+P+Q+  QSP+Q+  ++  ++  ++P+++  ++PA++    P +
Sbjct: 307 KGQTHYLSTPTQSSFQSPAQSSFQSPAQSSFQSPAQSSFQSPAQSLFQSPAQSSFQSPAQ 366

Query: 812 HTSVLPPRKLTFADVKKPDKPNAPV 836
            +   P +      ++ P    AP+
Sbjct: 367 SSFQSPAQAPVGTHIQSPMPSPAPI 391

>TBLA0C00840 Chr3 complement(172404..173678) [1275 bp, 424 aa] {ON}
           Anc_2.638 YMR067C
          Length = 424

 Score = 37.4 bits (85), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 28/40 (70%), Gaps = 3/40 (7%)

Query: 760 APCRSPSQAPSQAPGQSPSQAPIETSIETPIE--TPSETP 797
           AP ++P QAP QAP Q+P+QA  ++S   P++   PSETP
Sbjct: 174 APVQAPVQAPVQAPAQTPAQAQTKSS-PPPLQVFVPSETP 212

>Suva_13.151 Chr13 (238296..241412) [3117 bp, 1038 aa] {ON} YML010W
            (REAL)
          Length = 1038

 Score = 37.4 bits (85), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 38/74 (51%), Gaps = 8/74 (10%)

Query: 68   GGESNGRRS-WSGTA----YNSASTPGGTTRMNNTRYSDPTPLENLHERGDLKLESSDKG 122
            GGESNG  S W GT     Y  AST GGT +  +TR    +   N  + G  +   +++G
Sbjct: 967  GGESNGAVSTWGGTGDRSTYGGASTWGGTNKNKSTRDGGASAWGN--QDGGNRSAWNNQG 1024

Query: 123  RQSNYAG-SKKGVH 135
             +SNY G S  G H
Sbjct: 1025 NKSNYGGNSTWGGH 1038

>Skud_13.141 Chr13 (233891..237064) [3174 bp, 1057 aa] {ON} YML010W
            (REAL)
          Length = 1057

 Score = 35.8 bits (81), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 34/67 (50%), Gaps = 7/67 (10%)

Query: 68   GGESNGRRS-WSGT----AYNSASTPGGTTRMNNTRYSDPTPLENLHERGDLKLESSDKG 122
            GGESNG  S W GT    AY  AST GG     +TR    +   N  + G  +   +++G
Sbjct: 986  GGESNGATSTWGGTGDKSAYGGASTWGGNNNNKSTRDGGASAWGN--QDGGNRSAWNNQG 1043

Query: 123  RQSNYAG 129
             +SNY G
Sbjct: 1044 NKSNYGG 1050

>YBL069W Chr2 (90741..92030) [1290 bp, 429 aa] {ON}  AST1Lipid raft
           associated protein; interacts with the plasma membrane
           ATPase Pma1p and has a role in its targeting to the
           plasma membrane by influencing its incorporation into
           lipid rafts; sometimes classified in the medium-chain
           dehydrogenase/reductases (MDRs) superfamily
          Length = 429

 Score = 35.0 bits (79), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 17/32 (53%)

Query: 792 TPSETPSEAPAKTQAAPPLRHTSVLPPRKLTF 823
            P E P +AP   + A PLRH   +P + L F
Sbjct: 24  APKEIPMDAPVLKRVARPLRHVKFIPIKSLIF 55

>TPHA0C02030 Chr3 complement(455550..458213) [2664 bp, 887 aa] {ON}
           Anc_8.442 YDR227W
          Length = 887

 Score = 35.4 bits (80), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 25/45 (55%), Gaps = 1/45 (2%)

Query: 765 PSQAPSQAPGQSPSQAPIETSIETPIETPSETPSEAP-AKTQAAP 808
           P++ P+ AP + P+ AP E     P E P+  P+E P A T A P
Sbjct: 716 PNEVPNAAPNEVPNAAPNEVPNAAPNEVPNAAPNEVPNAVTNAVP 760

>CAGL0G03267g Chr7 complement(308963..310240) [1278 bp, 425 aa] {ON}
           highly similar to uniprot|P35183 Saccharomyces
           cerevisiae YBL069w AST1 or uniprot|P39945 Saccharomyces
           cerevisiae YER101c AST2
          Length = 425

 Score = 34.3 bits (77), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 27/57 (47%), Gaps = 7/57 (12%)

Query: 793 PSETPSEAPAKTQAAPPLRHTSVLPPRKLTFADVKKPDKPNAPVQFT-DSAFGFPLP 848
           P E   +AP  T+ A PLRH   +P + L F           P++FT D+    P+P
Sbjct: 23  PKEIKPDAPKLTRVARPLRHIKHIPVKALCF------HSKQGPIEFTYDNKIKMPVP 73

>Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101W
           (HSL1) - Putative protein kinase homologous to S. pombe
           cdr1/nim1 [contig 55] FULL
          Length = 1267

 Score = 34.3 bits (77), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 14/53 (26%), Positives = 29/53 (54%)

Query: 765 PSQAPSQAPGQSPSQAPIETSIETPIETPSETPSEAPAKTQAAPPLRHTSVLP 817
           P+Q P Q P Q P+Q P +  ++ P++ P +  +  P+  +    +R ++ +P
Sbjct: 576 PAQKPDQKPIQKPAQKPAQQFVQKPVQKPIQKLAPQPSPARETSGVRKSTAMP 628

>Smik_2.47 Chr2 (84723..86012) [1290 bp, 429 aa] {ON} YBL069W (REAL)
          Length = 429

 Score = 33.9 bits (76), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 19/38 (50%)

Query: 786 IETPIETPSETPSEAPAKTQAAPPLRHTSVLPPRKLTF 823
           ++  I  P E P + P   + A PLRH   +P + L F
Sbjct: 18  VDHTIPAPKEIPIDEPVLKRVARPLRHVKFIPIKSLVF 55

>YML010W Chr13 (247677..250868) [3192 bp, 1063 aa] {ON}  SPT5Component
            of the universally conserved Spt4/5 complex (DSIF
            complex); the complex has multiple roles in concert with
            RNA polymerases I and II, including regulation of
            transcription elongation, RNA processing, quality
            control, and transcription-coupled DNA repair
          Length = 1063

 Score = 33.9 bits (76), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 38/74 (51%), Gaps = 8/74 (10%)

Query: 68   GGESNGRRS-WSGT----AYNSASTPGGTTRMNNTRYSDPTPLENLHERGDLKLESSDKG 122
            GGESNG  S W GT    AY  AST GG     +TR    +   N  + G+ +   +++G
Sbjct: 992  GGESNGAMSTWGGTGDRSAYGGASTWGGNNNNKSTRDGGASAWGN-QDDGN-RSAWNNQG 1049

Query: 123  RQSNYAG-SKKGVH 135
             +SNY G S  G H
Sbjct: 1050 NKSNYGGNSTWGGH 1063

>Smik_13.141 Chr13 (236419..239604) [3186 bp, 1061 aa] {ON} YML010W
            (REAL)
          Length = 1061

 Score = 33.5 bits (75), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 35/67 (52%), Gaps = 7/67 (10%)

Query: 68   GGESNGRRS-WSGT----AYNSASTPGGTTRMNNTRYSDPTPLENLHERGDLKLESSDKG 122
            GGESNG  S W GT    AY  AST GG     +TR    +   N  + G+ +   +++G
Sbjct: 990  GGESNGAMSTWGGTGDKSAYGGASTWGGNNNNKSTRDGGASAWGN-QDDGN-RSAWNNQG 1047

Query: 123  RQSNYAG 129
             +SNY G
Sbjct: 1048 NKSNYGG 1054

>CAGL0D04818g Chr4 complement(469863..471011) [1149 bp, 382 aa] {ON}
           similar to uniprot|Q06505 Saccharomyces cerevisiae
           YPR133c
          Length = 382

 Score = 32.3 bits (72), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 21/30 (70%)

Query: 771 QAPGQSPSQAPIETSIETPIETPSETPSEA 800
           +AP ++P +A +E S+E P+E P E+  EA
Sbjct: 18  EAPVEAPVEAALEPSVEAPVEAPVESTVEA 47

>Kwal_27.10832 s27 (518369..519655) [1287 bp, 428 aa] {ON} YER101C
           (AST2) - involved in targeting of plasma membrane
           [H+]ATPase [contig 33] FULL
          Length = 428

 Score = 32.0 bits (71), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 16/32 (50%)

Query: 792 TPSETPSEAPAKTQAAPPLRHTSVLPPRKLTF 823
            P E P E  A  + A PLRH   +P + L F
Sbjct: 24  VPKEIPQEEVALRRVARPLRHVKYIPVKNLVF 55

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.307    0.124    0.343 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 92,130,259
Number of extensions: 4216600
Number of successful extensions: 38537
Number of sequences better than 10.0: 883
Number of HSP's gapped: 38058
Number of HSP's successfully gapped: 1242
Length of query: 923
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 804
Effective length of database: 39,836,145
Effective search space: 32028260580
Effective search space used: 32028260580
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 71 (32.0 bits)